BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF024I10

Length=435
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN76413.1|  hypothetical protein VITISV_043812                     259   1e-81   Vitis vinifera
emb|CDP05334.1|  unnamed protein product                                264   4e-80   Coffea canephora [robusta coffee]
ref|XP_006587679.1|  PREDICTED: conserved oligomeric Golgi comple...    259   7e-80   
ref|XP_004506344.1|  PREDICTED: conserved oligomeric Golgi comple...    261   6e-79   Cicer arietinum [garbanzo]
ref|XP_010089680.1|  hypothetical protein L484_001268                   260   7e-79   Morus notabilis
ref|XP_004238762.1|  PREDICTED: conserved oligomeric Golgi comple...    260   9e-79   Solanum lycopersicum
ref|XP_006490119.1|  PREDICTED: conserved oligomeric Golgi comple...    259   1e-78   Citrus sinensis [apfelsine]
ref|XP_002304412.2|  conserved oligomeric Golgi complex component...    259   1e-78   
ref|XP_011033997.1|  PREDICTED: conserved oligomeric Golgi comple...    259   1e-78   Populus euphratica
gb|KHN11738.1|  Conserved oligomeric Golgi complex subunit 7            259   2e-78   Glycine soja [wild soybean]
gb|AIU51119.1|  embryo yellow protein                                   259   2e-78   Glycine max [soybeans]
ref|XP_003534367.1|  PREDICTED: conserved oligomeric Golgi comple...    259   2e-78   Glycine max [soybeans]
ref|XP_008439087.1|  PREDICTED: conserved oligomeric Golgi comple...    259   3e-78   Cucumis melo [Oriental melon]
gb|AIU51115.1|  embryo yellow protein                                   259   3e-78   Carica papaya [mamon]
gb|KDO65493.1|  hypothetical protein CISIN_1g003266mg                   258   4e-78   Citrus sinensis [apfelsine]
ref|XP_006421663.1|  hypothetical protein CICLE_v10004313mg             258   4e-78   Citrus clementina [clementine]
gb|AIU51138.1|  embryo yellow protein                                   258   6e-78   Phaseolus vulgaris [French bean]
ref|XP_007131467.1|  hypothetical protein PHAVU_011G016000g             258   6e-78   Phaseolus vulgaris [French bean]
ref|XP_006357255.1|  PREDICTED: conserved oligomeric Golgi comple...    258   6e-78   Solanum tuberosum [potatoes]
gb|EYU24953.1|  hypothetical protein MIMGU_mgv1a001327mg                258   7e-78   Erythranthe guttata [common monkey flower]
gb|KDP22425.1|  hypothetical protein JCGZ_26256                         258   7e-78   Jatropha curcas
ref|XP_002267657.1|  PREDICTED: conserved oligomeric Golgi comple...    258   7e-78   Vitis vinifera
ref|XP_009372929.1|  PREDICTED: conserved oligomeric Golgi comple...    254   7e-78   
gb|AIU51140.1|  embryo yellow protein                                   257   1e-77   Ricinus communis
ref|XP_002510953.1|  conserved hypothetical protein                     257   1e-77   Ricinus communis
gb|KHN46499.1|  Conserved oligomeric Golgi complex subunit 7            257   1e-77   Glycine soja [wild soybean]
gb|AIU51141.1|  embryo yellow protein                                   242   1e-77   Saruma henryi
gb|KEH17632.1|  oligomeric component-related/COG complex component      257   2e-77   Medicago truncatula
gb|AIU51149.1|  embryo yellow protein                                   256   2e-77   Lactuca sativa [cultivated lettuce]
ref|XP_010062284.1|  PREDICTED: conserved oligomeric Golgi comple...    256   2e-77   Eucalyptus grandis [rose gum]
gb|AIU51131.1|  embryo yellow protein                                   256   2e-77   Manihot esculenta [manioc]
ref|XP_004165037.1|  PREDICTED: conserved oligomeric Golgi comple...    256   3e-77   
ref|XP_004148143.1|  PREDICTED: conserved oligomeric Golgi comple...    256   3e-77   Cucumis sativus [cucumbers]
ref|XP_009374477.1|  PREDICTED: conserved oligomeric Golgi comple...    256   3e-77   Pyrus x bretschneideri [bai li]
ref|XP_009340575.1|  PREDICTED: conserved oligomeric Golgi comple...    256   4e-77   Pyrus x bretschneideri [bai li]
ref|XP_008376080.1|  PREDICTED: conserved oligomeric Golgi comple...    256   4e-77   
gb|AIU51114.1|  embryo yellow protein                                   253   5e-76   Gossypium raimondii
ref|XP_009625424.1|  PREDICTED: conserved oligomeric Golgi comple...    252   7e-76   Nicotiana tomentosiformis
ref|XP_009786961.1|  PREDICTED: conserved oligomeric Golgi comple...    251   2e-75   Nicotiana sylvestris
ref|XP_007038383.1|  Oligomeric Golgi complex component-related /...    251   2e-75   
gb|AIU51110.1|  embryo yellow protein                                   251   2e-75   Theobroma cacao [chocolate]
ref|XP_011076371.1|  PREDICTED: conserved oligomeric Golgi comple...    250   4e-75   Sesamum indicum [beniseed]
ref|XP_004307803.1|  PREDICTED: conserved oligomeric Golgi comple...    250   6e-75   Fragaria vesca subsp. vesca
ref|XP_006838140.1|  hypothetical protein AMTR_s00106p00086320          249   8e-75   Amborella trichopoda
emb|CDX99921.1|  BnaC09g27840D                                          246   1e-74   
gb|AIU51112.1|  embryo yellow protein                                   248   3e-74   Sarcandra glabra
gb|AIU51152.1|  embryo yellow protein                                   248   4e-74   Platanus x hispanica [London plane tree]
gb|AIU51129.1|  embryo yellow protein                                   247   5e-74   Medicago truncatula
ref|XP_003618191.1|  Conserved oligomeric Golgi complex subunit         247   5e-74   Medicago truncatula
gb|AIU51120.1|  embryo yellow protein                                   244   1e-73   Illicium henryi
emb|CDY56655.1|  BnaA02g11250D                                          245   1e-73   Brassica napus [oilseed rape]
emb|CDY00475.1|  BnaA10g07980D                                          245   2e-73   
ref|XP_009107451.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    246   2e-73   
gb|AIU51154.1|  embryo yellow protein                                   246   2e-73   Houttuynia cordata [chameleon-plant]
ref|XP_009127310.1|  PREDICTED: conserved oligomeric Golgi comple...    245   2e-73   Brassica rapa
gb|AIU51121.1|  embryo yellow protein                                   245   3e-73   Buxus sinica
gb|AIU51106.1|  embryo yellow protein                                   244   5e-73   Magnolia denudata [haku-mokuren]
ref|XP_008234406.1|  PREDICTED: conserved oligomeric Golgi comple...    244   5e-73   Prunus mume [ume]
gb|AIU51147.1|  embryo yellow protein                                   244   5e-73   Schrenkiella parvula
ref|XP_006401980.1|  hypothetical protein EUTSA_v10012691mg             244   6e-73   Eutrema salsugineum [saltwater cress]
ref|XP_010264264.1|  PREDICTED: conserved oligomeric Golgi comple...    244   6e-73   Nelumbo nucifera [Indian lotus]
gb|AIU51102.1|  embryo yellow protein                                   244   9e-73   Aquilegia coerulea [Rocky Mountain columbine]
gb|AIU51151.1|  embryo yellow protein                                   243   1e-72   Cinnamomum camphora
ref|XP_007218916.1|  hypothetical protein PRUPE_ppa001391mg             243   1e-72   Prunus persica
gb|AIU51136.1|  embryo yellow protein                                   243   1e-72   Prunus persica
gb|EPS73811.1|  hypothetical protein M569_00940                         243   2e-72   Genlisea aurea
ref|XP_010536539.1|  PREDICTED: conserved oligomeric Golgi comple...    243   2e-72   Tarenaya hassleriana [spider flower]
ref|XP_010442641.1|  PREDICTED: conserved oligomeric Golgi comple...    236   3e-72   Camelina sativa [gold-of-pleasure]
emb|CDX91578.1|  BnaC02g15820D                                          241   1e-71   
ref|XP_006280007.1|  hypothetical protein CARUB_v10025880mg             241   1e-71   Capsella rubella
gb|AIU51116.1|  embryo yellow protein                                   241   1e-71   Capsella rubella
dbj|BAG15881.1|  conserved oligomeric Golgi complex component 7-r...    241   1e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AIU51104.1|  embryo yellow protein                                   241   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199956.1|  COG7-like protein EYE                                 241   1e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26748.1|  hypothetical protein AALP_AA8G288200                    241   1e-71   Arabis alpina [alpine rockcress]
dbj|BAF00649.1|  hypothetical protein                                   241   1e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AIU51103.1|  embryo yellow protein                                   240   2e-71   Arabidopsis lyrata [lyrate rockcress]
ref|XP_002865861.1|  hypothetical protein ARALYDRAFT_495214             240   2e-71   
gb|AIU51157.1|  embryo yellow protein                                   239   4e-71   Trachycarpus fortunei
ref|XP_010482477.1|  PREDICTED: conserved oligomeric Golgi comple...    239   4e-71   Camelina sativa [gold-of-pleasure]
gb|AIU51143.1|  embryo yellow protein                                   239   5e-71   Yucca filamentosa [Adam's-needle]
ref|XP_010934963.1|  PREDICTED: conserved oligomeric Golgi comple...    239   6e-71   Elaeis guineensis
ref|XP_008376425.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    236   8e-71   
gb|AIU51158.1|  embryo yellow protein                                   238   1e-70   Cabomba caroliniana
ref|XP_008796946.1|  PREDICTED: conserved oligomeric Golgi comple...    237   2e-70   Phoenix dactylifera
ref|XP_010443240.1|  PREDICTED: conserved oligomeric Golgi comple...    237   3e-70   Camelina sativa [gold-of-pleasure]
gb|AIU51153.1|  embryo yellow protein                                   235   2e-69   Ginkgo biloba [ginkgo]
gb|AIU51125.1|  embryo yellow protein                                   235   2e-69   Chimonanthus praecox [wintersweet]
gb|AIU51156.1|  embryo yellow protein                                   234   3e-69   Alisma plantago-aquatica
gb|AIU51127.1|  embryo yellow protein                                   233   8e-69   Asparagus officinalis
gb|AIU51124.1|  embryo yellow protein                                   231   4e-68   Ceratophyllum demersum [hornwort]
gb|AIU51150.1|  embryo yellow protein                                   231   4e-68   Ceratophyllum platyacanthum subsp. oryzetorum
ref|XP_010692941.1|  PREDICTED: conserved oligomeric Golgi comple...    231   6e-68   Beta vulgaris subsp. vulgaris [field beet]
gb|AIU51107.1|  embryo yellow protein                                   230   1e-67   Musa acuminata [banana]
ref|XP_009399332.1|  PREDICTED: conserved oligomeric Golgi comple...    230   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU51142.1|  embryo yellow protein                                   223   3e-65   Dioscorea oppositifolia
ref|XP_006657236.1|  PREDICTED: conserved oligomeric Golgi comple...    222   1e-64   Oryza brachyantha
gb|EEC81147.1|  hypothetical protein OsI_24056                          221   1e-64   Oryza sativa Indica Group [Indian rice]
gb|AIU51108.1|  embryo yellow protein                                   221   1e-64   Pinellia ternata
dbj|BAD45448.1|  oligomeric golgi complex 7-like                        221   1e-64   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ94393.1|  predicted protein                                      219   7e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003618197.1|  Conserved oligomeric Golgi complex subunit         218   1e-63   
gb|AIU51155.1|  embryo yellow protein                                   218   2e-63   Zea mays [maize]
ref|XP_008658135.1|  PREDICTED: uncharacterized protein LOC100193...    218   3e-63   
gb|AIU51146.1|  embryo yellow protein                                   218   3e-63   Sorghum bicolor [broomcorn]
ref|XP_002438832.1|  hypothetical protein SORBIDRAFT_10g026850          217   3e-63   Sorghum bicolor [broomcorn]
ref|XP_004966309.1|  PREDICTED: conserved oligomeric Golgi comple...    216   7e-63   Setaria italica
gb|AIU51144.1|  embryo yellow protein                                   216   7e-63   Setaria italica
gb|AIU51128.1|  embryo yellow protein                                   216   7e-63   Aristolochia tagala
gb|AIU51137.1|  embryo yellow protein                                   216   9e-63   Panicum virgatum
dbj|BAJ95800.1|  predicted protein                                      216   1e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001770876.1|  predicted protein                                  213   2e-61   
gb|AIU51130.1|  embryo yellow protein                                   209   2e-60   Canna indica [canna]
gb|AIU51111.1|  embryo yellow protein                                   199   7e-57   Acorus calamus [flagroot]
ref|XP_002972505.1|  hypothetical protein SELMODRAFT_148467             184   2e-51   
ref|XP_002992562.1|  hypothetical protein SELMODRAFT_135591             181   3e-50   
gb|EEE66191.1|  hypothetical protein OsJ_22310                          176   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003563389.1|  PREDICTED: conserved oligomeric Golgi comple...    176   3e-48   
gb|AIU51109.1|  embryo yellow protein                                   173   2e-47   Brachypodium distachyon [annual false brome]
ref|XP_010062289.1|  PREDICTED: conserved oligomeric Golgi comple...    160   5e-43   Eucalyptus grandis [rose gum]
gb|EMT03910.1|  hypothetical protein F775_26031                         146   5e-38   
gb|EMS57916.1|  hypothetical protein TRIUR3_24838                       146   6e-38   Triticum urartu
ref|XP_003055554.1|  predicted protein                                  123   2e-29   Micromonas pusilla CCMP1545
ref|XP_005847546.1|  hypothetical protein CHLNCDRAFT_133750             104   6e-23   Chlorella variabilis
ref|XP_002503576.1|  predicted protein                                  102   3e-22   Micromonas commoda
ref|XP_002953697.1|  component of oligomeric golgi complex 7            100   2e-21   Volvox carteri f. nagariensis
emb|CEF98773.1|  Conserved oligomeric Golgi complex subunit 7         99.0    8e-21   Ostreococcus tauri
ref|XP_001418731.1|  predicted protein                                97.8    2e-20   Ostreococcus lucimarinus CCE9901
ref|XP_001628559.1|  predicted protein                                95.1    1e-19   Nematostella vectensis
ref|XP_786237.3|  PREDICTED: conserved oligomeric Golgi complex s...  94.7    2e-19   Strongylocentrotus purpuratus [purple urchin]
ref|XP_006623838.1|  PREDICTED: conserved oligomeric Golgi comple...  94.7    2e-19   Apis dorsata [rock honeybee]
ref|XP_006623839.1|  PREDICTED: conserved oligomeric Golgi comple...  94.0    3e-19   Apis dorsata [rock honeybee]
ref|XP_011154014.1|  PREDICTED: conserved oligomeric Golgi comple...  94.0    3e-19   Harpegnathos saltator
ref|XP_011068677.1|  PREDICTED: conserved oligomeric Golgi comple...  94.0    4e-19   Acromyrmex echinatior
ref|XP_003691700.1|  PREDICTED: conserved oligomeric Golgi comple...  93.2    6e-19   
gb|EGI69206.1|  Conserved oligomeric Golgi complex subunit 7          93.6    7e-19   Acromyrmex echinatior
ref|XP_394713.2|  PREDICTED: conserved oligomeric Golgi complex s...  93.2    7e-19   
ref|XP_003703617.1|  PREDICTED: conserved oligomeric Golgi comple...  93.2    7e-19   
ref|XP_006825808.1|  PREDICTED: conserved oligomeric Golgi comple...  89.4    7e-19   Saccoglossus kowalevskii
ref|XP_011159533.1|  PREDICTED: conserved oligomeric Golgi comple...  92.8    1e-18   Solenopsis invicta [imported red fire ant]
ref|XP_004351649.1|  hypothetical protein ACA1_397180                 92.4    1e-18   Acanthamoeba castellanii str. Neff
gb|EFZ22757.1|  hypothetical protein SINV_01051                       92.4    1e-18   
ref|XP_003397366.1|  PREDICTED: conserved oligomeric Golgi comple...  92.0    1e-18   Bombus terrestris [large earth bumblebee]
ref|XP_011340195.1|  PREDICTED: conserved oligomeric Golgi comple...  92.0    2e-18   
ref|XP_003490215.1|  PREDICTED: conserved oligomeric Golgi comple...  92.0    2e-18   
ref|XP_011340196.1|  PREDICTED: conserved oligomeric Golgi comple...  91.7    2e-18   
gb|KDR16116.1|  Conserved oligomeric Golgi complex subunit 7          90.1    7e-18   Zootermopsis nevadensis
ref|XP_001701937.1|  component of oligomeric golgi complex 7          90.1    9e-18   Chlamydomonas reinhardtii
ref|XP_011264701.1|  PREDICTED: conserved oligomeric Golgi comple...  89.7    9e-18   
ref|XP_011264700.1|  PREDICTED: conserved oligomeric Golgi comple...  89.7    1e-17   
ref|XP_007513783.1|  predicted protein                                90.1    1e-17   Bathycoccus prasinos
gb|EFA86654.1|  oligomeric Golgi complex component                    89.4    1e-17   Heterostelium album PN500
ref|XP_005643872.1|  hypothetical protein COCSUDRAFT_67854            89.4    1e-17   Coccomyxa subellipsoidea C-169
ref|XP_637633.1|  oligomeric Golgi complex component                  88.2    5e-17   Dictyostelium discoideum AX4
ref|XP_009062761.1|  hypothetical protein LOTGIDRAFT_194952           86.3    2e-16   Lottia gigantea
ref|XP_011299070.1|  PREDICTED: conserved oligomeric Golgi comple...  86.3    2e-16   Fopius arisanus
ref|XP_011299078.1|  PREDICTED: conserved oligomeric Golgi comple...  85.9    2e-16   Fopius arisanus
ref|XP_011299085.1|  PREDICTED: conserved oligomeric Golgi comple...  85.9    2e-16   Fopius arisanus
ref|XP_011431811.1|  PREDICTED: conserved oligomeric Golgi comple...  84.0    1e-15   Crassostrea gigas
gb|EKC24157.1|  Conserved oligomeric Golgi complex subunit 7          84.0    1e-15   Crassostrea gigas
ref|XP_008559723.1|  PREDICTED: conserved oligomeric Golgi comple...  82.8    3e-15   
ref|XP_008474492.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    5e-15   
ref|XP_007903980.1|  PREDICTED: conserved oligomeric Golgi comple...  81.6    7e-15   Callorhinchus milii [Australian ghost shark]
ref|XP_007903979.1|  PREDICTED: conserved oligomeric Golgi comple...  81.6    7e-15   Callorhinchus milii [Australian ghost shark]
ref|NP_001264493.1|  conserved oligomeric Golgi complex subunit 7     81.6    7e-15   Gallus gallus [bantam]
ref|XP_005810284.1|  PREDICTED: conserved oligomeric Golgi comple...  81.3    1e-14   Xiphophorus maculatus
ref|XP_010442640.1|  PREDICTED: conserved oligomeric Golgi comple...  80.9    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008202376.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    2e-14   
ref|XP_008202373.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    2e-14   Nasonia vitripennis
ref|XP_008202375.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    2e-14   Nasonia vitripennis
ref|XP_008202374.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    2e-14   Nasonia vitripennis
ref|XP_008299300.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    2e-14   Stegastes partitus
ref|XP_010717801.1|  PREDICTED: conserved oligomeric Golgi comple...  80.1    2e-14   Meleagris gallopavo [common turkey]
ref|XP_002128341.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    3e-14   Ciona intestinalis [sea vase]
ref|NP_001015714.1|  component of oligomeric golgi complex 7          79.7    3e-14   Xenopus tropicalis [western clawed frog]
ref|XP_005748533.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    4e-14   Pundamilia nyererei
gb|ELT88100.1|  hypothetical protein CAPTEDRAFT_161050                79.3    4e-14   Capitella teleta
ref|XP_006892752.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    4e-14   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_007233023.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    4e-14   
ref|XP_004080382.1|  PREDICTED: conserved oligomeric Golgi comple...  79.0    6e-14   Oryzias latipes [Japanese rice fish]
ref|XP_011372750.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    8e-14   
ref|XP_004571418.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    1e-13   Maylandia zebra
ref|XP_006808092.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    1e-13   Neolamprologus brichardi [lyretail cichlid]
ref|XP_002711891.2|  PREDICTED: conserved oligomeric Golgi comple...  78.2    1e-13   
ref|XP_003438511.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    1e-13   Oreochromis niloticus
ref|XP_010621761.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    1e-13   Fukomys damarensis [Damara mole rat]
ref|XP_008434639.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    1e-13   Poecilia reticulata
ref|NP_001085832.1|  component of oligomeric golgi complex 7          77.8    1e-13   Xenopus laevis [clawed frog]
ref|XP_007571524.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    1e-13   Poecilia formosa
ref|XP_007571519.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    1e-13   Poecilia formosa
ref|XP_007058642.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    1e-13   Chelonia mydas [green seaturtle]
ref|XP_005288959.1|  PREDICTED: conserved oligomeric Golgi comple...  77.8    2e-13   Chrysemys picta bellii
ref|XP_004604166.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Sorex araneus [Eurasian shrew]
emb|CAG04322.1|  unnamed protein product                              76.6    2e-13   Tetraodon nigroviridis
ref|XP_003961343.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   Takifugu rubripes [tiger puffer]
emb|CBN81326.1|  Conserved oligomeric Golgi complex subunit 7         76.3    2e-13   Dicentrarchus labrax [European sea bass]
ref|XP_007516677.1|  PREDICTED: conserved oligomeric Golgi comple...  77.4    2e-13   
ref|XP_005935571.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    2e-13   Haplochromis burtoni
ref|XP_007951381.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    2e-13   Orycteropus afer afer
ref|XP_004360949.1|  oligomeric Golgi complex component               77.4    2e-13   Cavenderia fasciculata
ref|XP_006637161.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    4e-13   Lepisosteus oculatus
ref|XP_010791235.1|  PREDICTED: conserved oligomeric Golgi comple...  76.6    4e-13   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_004706118.1|  PREDICTED: conserved oligomeric Golgi comple...  76.3    4e-13   Echinops telfairi [lesser hedgehog tenrec]
gb|KFO84349.1|  Conserved oligomeric Golgi complex subunit 7          75.9    6e-13   Buceros rhinoceros silvestris
ref|XP_005351192.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    7e-13   Microtus ochrogaster [prairie voles]
ref|XP_003285944.1|  hypothetical protein DICPUDRAFT_15317            75.1    1e-12   Dictyostelium purpureum
ref|XP_006027196.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    2e-12   Alligator sinensis
ref|XP_006268482.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  74.3    2e-12   
ref|XP_010731365.1|  PREDICTED: conserved oligomeric Golgi comple...  74.3    2e-12   
ref|XP_010903275.1|  PREDICTED: conserved oligomeric Golgi comple...  73.2    5e-12   Esox lucius
ref|XP_005105726.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    9e-12   Aplysia californica
ref|XP_004586873.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    1e-11   Ochotona princeps [southern American pika]
emb|CDQ66102.1|  unnamed protein product                              72.4    1e-11   Oncorhynchus mykiss
ref|NP_001070861.1|  conserved oligomeric Golgi complex subunit 7     72.0    1e-11   Danio rerio [leopard danio]
ref|XP_008312851.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    2e-11   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005825555.1|  oligomeric Golgi complex subunit 7               70.9    3e-11   Guillardia theta CCMP2712
ref|XP_006125865.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  70.9    3e-11   
ref|XP_010144199.1|  PREDICTED: conserved oligomeric Golgi comple...  70.5    4e-11   Buceros rhinoceros silvestris
ref|XP_974190.1|  PREDICTED: conserved oligomeric Golgi complex s...  70.1    5e-11   Tribolium castaneum [rust-red flour beetle]
ref|XP_002407978.1|  conserved oligomeric golgi complex subunit, ...  69.7    7e-11   Ixodes scapularis [blacklegged tick]
ref|XP_011502446.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    1e-10   Ceratosolen solmsi marchali
gb|EXX54575.1|  hypothetical protein RirG_233350                      68.2    3e-10   Rhizophagus irregularis DAOM 197198w
gb|ESA17025.1|  hypothetical protein GLOINDRAFT_345271                67.8    4e-10   
dbj|GAM17697.1|  hypothetical protein SAMD00019534_008720             67.0    5e-10   Acytostelium subglobosum LB1
ref|XP_010731364.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    6e-10   
gb|KFM79728.1|  Conserved oligomeric Golgi complex subunit 7          63.2    9e-10   Stegodyphus mimosarum
gb|ERL93874.1|  hypothetical protein D910_11160                       66.2    1e-09   Dendroctonus ponderosae
gb|KJE94721.1|  hypothetical protein CAOG_009840                      65.5    2e-09   Capsaspora owczarzaki ATCC 30864
ref|XP_004347003.2|  hypothetical protein CAOG_05318                  65.1    3e-09   Capsaspora owczarzaki ATCC 30864
ref|XP_006003103.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    4e-09   Latimeria chalumnae
ref|XP_002058398.1|  GJ14333                                          64.3    4e-09   Drosophila virilis
gb|EHJ78638.1|  putative component of oligomeric golgi complex 7      63.9    6e-09   
gb|EEZ99445.1|  hypothetical protein TcasGA2_TC030721                 63.9    7e-09   
ref|XP_001993908.1|  GH22206                                          63.5    8e-09   Drosophila grimshawi
ref|XP_001357618.1|  GA15960                                          62.0    3e-08   Drosophila pseudoobscura pseudoobscura
ref|XP_002109935.1|  hypothetical protein TRIADDRAFT_53345            61.6    3e-08   Trichoplax adhaerens
ref|XP_002073360.1|  GK14089                                          61.6    4e-08   Drosophila willistoni
ref|XP_005188405.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    1e-07   Musca domestica
ref|XP_009024750.1|  hypothetical protein HELRODRAFT_178406           59.3    2e-07   Helobdella robusta
ref|XP_002001440.1|  GI21972                                          59.7    2e-07   Drosophila mojavensis
ref|XP_011207193.1|  PREDICTED: conserved oligomeric Golgi comple...  59.7    2e-07   Bactrocera dorsalis [papaya fruit fly]
gb|KGB34884.1|  Conserved oligomeric Golgi complex subunit 7          58.5    2e-07   Schistosoma haematobium
ref|XP_002431030.1|  conserved hypothetical protein                   58.5    3e-07   Pediculus humanus corporis [human body lice]
ref|XP_006912615.1|  PREDICTED: conserved oligomeric Golgi comple...  58.2    5e-07   
gb|ENN72950.1|  hypothetical protein YQE_10421                        55.5    6e-07   Dendroctonus ponderosae
emb|CCD80953.1|  putative protein arginine n-methyltransferase        56.2    2e-06   Schistosoma mansoni
ref|XP_001955508.1|  GF16218                                          53.9    1e-05   Drosophila ananassae
ref|XP_002037280.1|  GM12202                                          53.9    1e-05   Drosophila sechellia
gb|ELK12106.1|  Conserved oligomeric Golgi complex subunit 7          53.9    1e-05   Pteropus alecto
ref|XP_002105431.1|  GD17535                                          53.5    1e-05   Drosophila simulans
ref|XP_004925156.1|  PREDICTED: conserved oligomeric Golgi comple...  53.5    1e-05   
ref|NP_651750.1|  Cog7                                                53.5    1e-05   Drosophila melanogaster
ref|XP_002911600.1|  hypothetical protein CC1G_14133                  52.8    3e-05   Coprinopsis cinerea okayama7#130
ref|XP_007323090.1|  hypothetical protein SERLADRAFT_418038           52.0    5e-05   Serpula lacrymans var. lacrymans S7.9
gb|KIK39828.1|  hypothetical protein CY34DRAFT_14142                  51.6    7e-05   Suillus luteus UH-Slu-Lm8-n1
emb|CBY32864.1|  unnamed protein product                              50.8    8e-05   Oikopleura dioica
gb|KIK67210.1|  hypothetical protein GYMLUDRAFT_857700                51.2    9e-05   Gymnopus luxurians FD-317 M1
emb|CBY21571.1|  unnamed protein product                              51.2    9e-05   Oikopleura dioica
emb|CCM00447.1|  predicted protein                                    50.4    1e-04   Fibroporia radiculosa
ref|XP_003030457.1|  hypothetical protein SCHCODRAFT_57227            49.3    3e-04   Schizophyllum commune H4-8
gb|EPS95322.1|  hypothetical protein FOMPIDRAFT_20550                 48.9    4e-04   Fomitopsis pinicola FP-58527 SS1
gb|KFD70340.1|  hypothetical protein M514_06928                       48.9    5e-04   Trichuris suis
gb|KFD52215.1|  hypothetical protein M513_06928                       48.9    6e-04   Trichuris suis
gb|KDR75221.1|  hypothetical protein GALMADRAFT_122928                48.5    6e-04   Galerina marginata CBS 339.88
gb|KFH66525.1|  hypothetical protein MVEG_07050                       48.5    7e-04   Mortierella verticillata NRRL 6337
gb|EJU00574.1|  hypothetical protein DACRYDRAFT_80789                 48.1    9e-04   Dacryopinax primogenitus



>emb|CAN76413.1| hypothetical protein VITISV_043812 [Vitis vinifera]
Length=444

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDVIRLRDDA+SLR SVSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSAAALLRVPRATRDVIRLRDDAVSLRHSVSSILLKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPKAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLDSMVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDSMVQPRLTDALS  196



>emb|CDP05334.1| unnamed protein product [Coffea canephora]
Length=845

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDALSLRSSV+SILQKL KAEGSSAES+ATLAKVDT
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDALSLRSSVASILQKLIKAEGSSAESIATLAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLDSMVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLDSMVQPRLTDALT  196



>ref|XP_006587679.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X2 [Glycine max]
Length=636

 Score =   259 bits (662),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDNMVQPRLTDALS  196



>ref|XP_004506344.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cicer arietinum]
Length=835

 Score =   261 bits (666),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDVIRLRDD++SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSAAALLRVPRATRDVIRLRDDSVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDTMVQPRLTDALS  196



>ref|XP_010089680.1| hypothetical protein L484_001268 [Morus notabilis]
 gb|EXC36303.1| hypothetical protein L484_001268 [Morus notabilis]
Length=833

 Score =   260 bits (665),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDVIRLRDDA+SLRS+V+SILQKL+KAEGSSAES+A LAKVDT
Sbjct  52   SLEEQSAAALLRVPRATRDVIRLRDDAVSLRSAVASILQKLKKAEGSSAESIAALAKVDT  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  112  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  171

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDA+S
Sbjct  172  RKQLEVLEDRLDAMVQPRLTDAIS  195



>ref|XP_004238762.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solanum 
lycopersicum]
 gb|AIU51145.1| embryo yellow protein, partial [Solanum lycopersicum]
Length=835

 Score =   260 bits (664),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRA RDVIRLRDDALSLRSS+S+ILQKL+KAEGSSAESVATLAKVDT
Sbjct  53   SLEEQSSAALLRVPRANRDVIRLRDDALSLRSSLSAILQKLKKAEGSSAESVATLAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVE+VF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEEVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            R+QLEVLEDRLDS+VQPRLTDALS
Sbjct  173  RRQLEVLEDRLDSVVQPRLTDALS  196



>ref|XP_006490119.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Citrus sinensis]
Length=835

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSASALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSLTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDAMVQPRLTDALS  196



>ref|XP_002304412.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|EEE79391.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|AIU51135.1| embryo yellow protein, partial [Populus trichocarpa]
Length=831

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDV+RLRDDA+SLR+SVSSILQKL+KAEG+SAES+A LAKVDT
Sbjct  52   SLEEQSAAALLRVPRATRDVVRLRDDAVSLRTSVSSILQKLKKAEGTSAESIAALAKVDT  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  112  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  171

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLDSMVQPRL DALS
Sbjct  172  RKQLEVLEDRLDSMVQPRLMDALS  195



>ref|XP_011033997.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
 ref|XP_011010844.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
Length=831

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDV+RLRDDA+SLR+SVSSILQKL+KAEG+SAES+A LAKVDT
Sbjct  52   SLEEQSAAALLRVPRATRDVVRLRDDAVSLRTSVSSILQKLKKAEGTSAESIAALAKVDT  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  112  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  171

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLDSMVQPRL DALS
Sbjct  172  RKQLEVLEDRLDSMVQPRLMDALS  195



>gb|KHN11738.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDNMVQPRLTDALS  196



>gb|AIU51119.1| embryo yellow protein, partial [Glycine max]
Length=833

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDNMVQPRLTDALS  196



>ref|XP_003534367.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Glycine max]
Length=834

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDNMVQPRLTDALS  196



>ref|XP_008439087.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cucumis 
melo]
Length=834

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEELSA+AL RVPRATRDVIRLRDDA+SLRS+VS ILQKL+KAEGSSAES+A LA+VDT
Sbjct  53   SLEELSANALLRVPRATRDVIRLRDDAVSLRSAVSGILQKLKKAEGSSAESIAALARVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGL QLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLAQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLDAMVQPRLTDALT  196



>gb|AIU51115.1| embryo yellow protein, partial [Carica papaya]
Length=839

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSS+ES+A LAKVDT
Sbjct  53   SLEEQSAAALLRVPRATRDVVRLRDDAVSLRSSVAGILQKLKKAEGSSSESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDAMVQPRLTDALS  196



>gb|KDO65493.1| hypothetical protein CISIN_1g003266mg [Citrus sinensis]
 gb|AIU51117.1| embryo yellow protein, partial [Citrus sinensis]
Length=835

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A L+KVDT
Sbjct  53   SLEEQSASALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALSKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSLTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDAMVQPRLTDALS  196



>ref|XP_006421663.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|ESR34903.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|AIU51113.1| embryo yellow protein, partial [Citrus clementina]
Length=835

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A L+KVDT
Sbjct  53   SLEEQSASALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALSKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSLTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDAMVQPRLTDALS  196



>gb|AIU51138.1| embryo yellow protein, partial [Phaseolus vulgaris]
Length=833

 Score =   258 bits (659),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYDTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPR+TDALS
Sbjct  173  RKQLEVLEDRLDTMVQPRITDALS  196



>ref|XP_007131467.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
 gb|ESW03461.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
Length=834

 Score =   258 bits (659),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYDTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPR+TDALS
Sbjct  173  RKQLEVLEDRLDTMVQPRITDALS  196



>ref|XP_006357255.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Solanum tuberosum]
 gb|AIU51134.1| embryo yellow protein, partial [Solanum tuberosum]
Length=835

 Score =   258 bits (659),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRA RDVIRLRDDALSLRSS+S+IL KL+KAEGSSAESVATLAKVDT
Sbjct  53   SLEEQSAAALLRVPRANRDVIRLRDDALSLRSSLSAILLKLKKAEGSSAESVATLAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVE+VF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEEVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            R+QLEVLEDRLDS+VQPRLTDALS
Sbjct  173  RRQLEVLEDRLDSVVQPRLTDALS  196



>gb|EYU24953.1| hypothetical protein MIMGU_mgv1a001327mg [Erythranthe guttata]
 gb|AIU51132.1| embryo yellow protein, partial [Erythranthe guttata]
Length=839

 Score =   258 bits (658),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S+SAL RVPRA+RDV+RLRDDALSLRSSV++IL  L+KAEGSSAES+ATLAKVDT
Sbjct  53   SLEEQSSSALLRVPRASRDVLRLRDDALSLRSSVANILLFLKKAEGSSAESIATLAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFANI
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLDSMVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLDSMVQPRLTDALN  196



>gb|KDP22425.1| hypothetical protein JCGZ_26256 [Jatropha curcas]
Length=832

 Score =   258 bits (658),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA++L RVPRATRDVIRLRDDALSLR+SVSSILQKL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSATSLLRVPRATRDVIRLRDDALSLRNSVSSILQKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYRTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRL DALS
Sbjct  173  RKQLEVLEDRLDAMVQPRLMDALS  196



>ref|XP_002267657.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vitis 
vinifera]
 emb|CBI24597.3| unnamed protein product [Vitis vinifera]
 gb|AIU51148.1| embryo yellow protein, partial [Vitis vinifera]
Length=838

 Score =   258 bits (658),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDVIRLRDDA+SLR SVSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSAAALLRVPRATRDVIRLRDDAVSLRHSVSSILLKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPKAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLDSMVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDSMVQPRLTDALS  196



>ref|XP_009372929.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=651

 Score =   254 bits (649),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYET QDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETSQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLDSMVQPRLTDA+S
Sbjct  173  RKQLEVLEDRLDSMVQPRLTDAIS  196



>gb|AIU51140.1| embryo yellow protein, partial [Ricinus communis]
Length=831

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDVIRLRDDA+SLR+SVS+I QKL+KAEGSSAES+A LAKVDT
Sbjct  52   SLEEQSAAALLRVPRATRDVIRLRDDAVSLRNSVSAIFQKLKKAEGSSAESIAALAKVDT  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  112  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  171

Query  363  RKQLEVLEDRLDSMVQPRLTDAL  431
            R+QLEVLEDRLD+MVQPRLTDAL
Sbjct  172  RRQLEVLEDRLDAMVQPRLTDAL  194



>ref|XP_002510953.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51555.1| conserved hypothetical protein [Ricinus communis]
Length=832

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDVIRLRDDA+SLR+SVS+I QKL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSAAALLRVPRATRDVIRLRDDAVSLRNSVSAIFQKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDAL  431
            R+QLEVLEDRLD+MVQPRLTDAL
Sbjct  173  RRQLEVLEDRLDAMVQPRLTDAL  195



>gb|KHN46499.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRL DALS
Sbjct  173  RKQLEVLEDRLDNMVQPRLMDALS  196



>gb|AIU51141.1| embryo yellow protein, partial [Saruma henryi]
Length=262

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S +AL RVPRA+RDVIRLRDDA+SLRS+VS IL KL+KAEGSSAES+A LAKVDT
Sbjct  53   SLDEQSTAALLRVPRASRDVIRLRDDAVSLRSAVSGILLKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQL VLEDRL+ MVQPRL+DALS
Sbjct  173  RKQLAVLEDRLEEMVQPRLSDALS  196



>gb|KEH17632.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=834

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDVIRLRDDA+SLRS+VS+ILQKL+KAEGSS+ES++ LAKVD 
Sbjct  53   SLEEQSAAALLRVPRATRDVIRLRDDAVSLRSAVSAILQKLKKAEGSSSESISALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQL+VLEDRLD+MVQPRLTDALS
Sbjct  173  RKQLQVLEDRLDTMVQPRLTDALS  196



>gb|AIU51149.1| embryo yellow protein, partial [Lactuca sativa]
Length=827

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++A+ RVPRATRDVIRLRDDALSLR SV SIL KL+KAEGSSAES+ATLAKVDT
Sbjct  53   SLEEQSSAAILRVPRATRDVIRLRDDALSLRQSVGSILLKLKKAEGSSAESIATLAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVEDVF+S DLPRAAETLANMRHCL+AVGEVAEFANI
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEDVFASKDLPRAAETLANMRHCLTAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLDSMVQPRLTDA++
Sbjct  173  RKQLEVLEDRLDSMVQPRLTDAIT  196



>ref|XP_010062284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Eucalyptus grandis]
 gb|KCW90838.1| hypothetical protein EUGRSUZ_A02893 [Eucalyptus grandis]
 gb|AIU51118.1| embryo yellow protein, partial [Eucalyptus grandis]
Length=838

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRD++RLRDDA+SLR SVS ILQKL+KAEGSSAES++ LAKVDT
Sbjct  53   SLEEQSAAALLRVPRATRDIVRLRDDAVSLRHSVSGILQKLKKAEGSSAESISALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAA+TLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAADTLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDNMVQPRLTDALS  196



>gb|AIU51131.1| embryo yellow protein, partial [Manihot esculenta]
Length=833

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA++L RVPRATRDVIRLRDDA+SLR+SVS ILQKL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSAASLLRVPRATRDVIRLRDDAVSLRNSVSGILQKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RME AYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMETAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLE RLD+MVQPRLTDALS
Sbjct  173  RKQLEVLESRLDAMVQPRLTDALS  196



>ref|XP_004165037.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
Length=834

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEELSA+AL RVPRATRDVIRLRDDA+SLRS+VS IL KL+KAEGSSAES+A LA+VDT
Sbjct  53   SLEELSANALLRVPRATRDVIRLRDDAVSLRSAVSGILLKLKKAEGSSAESIAALARVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGL QLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLAQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLDAMVQPRLTDALT  196



>ref|XP_004148143.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
 gb|KGN57266.1| hypothetical protein Csa_3G175670 [Cucumis sativus]
Length=834

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEELSA+AL RVPRATRDVIRLRDDA+SLRS+VS IL KL+KAEGSSAES+A LA+VDT
Sbjct  53   SLEELSANALLRVPRATRDVIRLRDDAVSLRSAVSGILLKLKKAEGSSAESIAALARVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGL QLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLAQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLDAMVQPRLTDALT  196



>ref|XP_009374477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLDSMVQPRLTDA+S
Sbjct  173  RKQLEVLEDRLDSMVQPRLTDAIS  196



>ref|XP_009340575.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   256 bits (653),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLDSMVQPRLTDA+S
Sbjct  173  RKQLEVLEDRLDSMVQPRLTDAIS  196



>ref|XP_008376080.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Malus domestica]
Length=838

 Score =   256 bits (653),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLDSMVQPRLTDA+S
Sbjct  173  RKQLEVLEDRLDSMVQPRLTDAIS  196



>gb|AIU51114.1| embryo yellow protein, partial [Gossypium raimondii]
 gb|KJB51433.1| hypothetical protein B456_008G216000 [Gossypium raimondii]
Length=830

 Score =   253 bits (645),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDV+RL+DDA+SLR+SV+ IL KL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSSAALLRVPRATRDVLRLQDDAVSLRNSVAGILDKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDTMVQPRLTDALS  196



>ref|XP_009625424.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
tomentosiformis]
Length=835

 Score =   252 bits (644),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPR TRDV RLRDD+L+LRS++S+IL KL+KAEGSSAESVATLAKVD 
Sbjct  53   SLEEQSAAALLRVPRTTRDVSRLRDDSLTLRSALSAILLKLKKAEGSSAESVATLAKVDA  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFANI
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLAAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            R+QLEVLEDRLDSMVQPRLTDALS
Sbjct  173  RRQLEVLEDRLDSMVQPRLTDALS  196



>ref|XP_009786961.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
sylvestris]
Length=834

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPR TRDV RLRDDAL+LRS++S+IL KL+KAEGSSAESVATLAKVD 
Sbjct  53   SLEEQSAAALLRVPRTTRDVSRLRDDALTLRSALSAILLKLKKAEGSSAESVATLAKVDA  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANM HCL+AVGEVAEFANI
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMSHCLAAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            R+QLEVLEDRLDSMVQPRLTDALS
Sbjct  173  RRQLEVLEDRLDSMVQPRLTDALS  196



>ref|XP_007038383.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
 gb|EOY22884.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
Length=832

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRA+RDV+RLR+DA+SLR SV+ IL KL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSAAALLRVPRASRDVLRLREDAVSLRISVAGILDKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDTMVQPRLTDALS  196



>gb|AIU51110.1| embryo yellow protein, partial [Theobroma cacao]
Length=831

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRA+RDV+RLR+DA+SLR SV+ IL KL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSAAALLRVPRASRDVLRLREDAVSLRISVAGILDKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDALS
Sbjct  173  RKQLEVLEDRLDTMVQPRLTDALS  196



>ref|XP_011076371.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sesamum 
indicum]
Length=838

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRA+RDV+RLRD+ALSLRSSV++IL  L+KAEGSSAES+ATLAKVDT
Sbjct  53   SLEEQSSAALLRVPRASRDVLRLRDEALSLRSSVANILLFLKKAEGSSAESIATLAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAA+TLANMRHCL+AVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAADTLANMRHCLTAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLDSMVQPRLTD+L+
Sbjct  173  RKQLEVLEDRLDSMVQPRLTDSLN  196



>ref|XP_004307803.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Fragaria 
vesca subsp. vesca]
Length=832

 Score =   250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SAS+L RVPRATR+VIRLRDDA+SLRS+VSSIL KL+KAEG SAES+  LAK D 
Sbjct  53   SLEEQSASSLLRVPRATREVIRLRDDAVSLRSAVSSILDKLKKAEGLSAESIMALAKYDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLDSMVQPRLTDA+S
Sbjct  173  RKQLEVLEDRLDSMVQPRLTDAIS  196



>ref|XP_006838140.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
 gb|ERN00709.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
Length=827

 Score =   249 bits (636),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+ELSASAL R+PRA+RDV+RLRDDA+SLRS++S ILQKL KAEGSSAES+A LAKVD 
Sbjct  53   SLDELSASALLRIPRASRDVVRLRDDAISLRSAISGILQKLEKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLS VGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSVVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL+ MVQPRL+DALS
Sbjct  173  RKQLEVLEDRLEGMVQPRLSDALS  196



>emb|CDX99921.1| BnaC09g27840D [Brassica napus]
Length=641

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S SAL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+
Sbjct  53   SLEEQSGSALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDS  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALT  196



>gb|AIU51112.1| embryo yellow protein, partial [Sarcandra glabra]
Length=836

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S +AL RVPRA+RDVIRLRDDA+SLRSSVS IL KL+KAEGSSAESVA LAK+DT
Sbjct  53   SLDEQSGAALLRVPRASRDVIRLRDDAVSLRSSVSGILLKLKKAEGSSAESVAALAKIDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSA+GEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAIGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL+ MVQPRL+DALS
Sbjct  173  RKQLEVLEDRLEEMVQPRLSDALS  196



>gb|AIU51152.1| embryo yellow protein, partial [Platanus x acerifolia]
Length=839

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRA+RDVIRLRDDA+SLR+SVS IL KL+KAEGSSAES++ LAKVDT
Sbjct  53   SLEEQSSAALLRVPRASRDVIRLRDDAVSLRNSVSGILLKLKKAEGSSAESISALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRL DALS
Sbjct  173  RKQLEVLEDRLETMVQPRLYDALS  196



>gb|AIU51129.1| embryo yellow protein, partial [Medicago truncatula]
Length=827

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL  VPRATRDV+RLRDDA SLRS+VS IL  L+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLHVPRATRDVVRLRDDAGSLRSAVSVILHNLQKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFTSGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQP LTDALS
Sbjct  173  RKQLEVLEDRLDTMVQPPLTDALS  196



>ref|XP_003618191.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74409.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=828

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL  VPRATRDV+RLRDDA SLRS+VS IL  L+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLHVPRATRDVVRLRDDAGSLRSAVSVILHNLQKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFTSGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQP LTDALS
Sbjct  173  RKQLEVLEDRLDTMVQPPLTDALS  196



>gb|AIU51120.1| embryo yellow protein, partial [Illicium henryi]
Length=720

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S +AL RVPRA+RDVIRLRD+A+SLRSS+S ILQ+L+KAEG SAES+A L+KVDT
Sbjct  53   SLDEQSTAALLRVPRASRDVIRLRDEAISLRSSLSGILQRLKKAEGCSAESIAALSKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            R+QLEVLEDRL++MVQPRL+DALS
Sbjct  173  RRQLEVLEDRLEAMVQPRLSDALS  196



>emb|CDY56655.1| BnaA02g11250D [Brassica napus]
Length=788

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSAE +ATLA+VD 
Sbjct  52   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSAECIATLARVDC  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  112  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  171

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  172  RKQLEVLEDRLEAMVQPRLTDALT  195



>emb|CDY00475.1| BnaA10g07980D [Brassica napus]
Length=788

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S SAL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+
Sbjct  52   SLEEQSGSALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDS  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  112  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  171

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  172  RKQLEVLEDRLEAMVQPRLTDALT  195



>ref|XP_009107451.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7-like [Brassica rapa]
Length=831

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S SAL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+
Sbjct  53   SLEEQSGSALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDS  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALT  196



>gb|AIU51154.1| embryo yellow protein, partial [Houttuynia cordata]
Length=833

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E SA+AL R+PRATRDV+RLRDDALSLRS+VS+IL KL+KAEGSSAE++A LAKVDT
Sbjct  53   SLDEQSAAALLRIPRATRDVVRLRDDALSLRSAVSAILLKLKKAEGSSAEAIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQL VLEDRL+ MVQPRL+DAL+
Sbjct  173  RKQLAVLEDRLEEMVQPRLSDALT  196



>ref|XP_009127310.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Brassica rapa]
Length=829

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSAE +ATLA+VD 
Sbjct  52   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSAECIATLARVDC  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  112  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  171

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  172  RKQLEVLEDRLEAMVQPRLTDALT  195



>gb|AIU51121.1| embryo yellow protein, partial [Buxus sinica]
Length=839

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRA+RDVIRLRDDA+SLR+SVS IL KL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSSAALLRVPRASRDVIRLRDDAMSLRNSVSGILLKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLT+LS++VE VF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTELSASVEGVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLED+L+ MVQPRLTDALS
Sbjct  173  RKQLEVLEDKLEEMVQPRLTDALS  196



>gb|AIU51106.1| embryo yellow protein, partial [Magnolia denudata]
Length=829

 Score =   244 bits (624),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S++ALHRVPRA+RDV+RLRDDA+SLRS+VS IL KL+KAEG+S+ESVA LAKVDT
Sbjct  53   SLDEQSSAALHRVPRASRDVVRLRDDAVSLRSAVSGILVKLKKAEGTSSESVAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL+ MV PRL+DALS
Sbjct  173  RKQLEVLEDRLEEMVHPRLSDALS  196



>ref|XP_008234406.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Prunus 
mume]
Length=839

 Score =   244 bits (624),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SAS+L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASSLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLS+TVEDVF+SGDLP AAE LA+MRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSATVEDVFASGDLPLAAEHLASMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLED+LDSMVQPRLTDA+S
Sbjct  173  RKQLEVLEDKLDSMVQPRLTDAIS  196



>gb|AIU51147.1| embryo yellow protein, partial [Schrenkiella parvula]
Length=831

 Score =   244 bits (624),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +ATLA+VDT
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIATLARVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALT  196



>ref|XP_006401980.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
 gb|ESQ43433.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
Length=832

 Score =   244 bits (624),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +ATLA+VDT
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIATLARVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALT  196



>ref|XP_010264264.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nelumbo 
nucifera]
Length=839

 Score =   244 bits (624),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S+++L RVPRA+RDVIRLRDDA+SLR+SV+ IL KL+KAEGSSAESVA LAKVDT
Sbjct  53   SLEEQSSASLLRVPRASRDVIRLRDDAISLRNSVTGILLKLKKAEGSSAESVAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEF+N+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFSNV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRL+DALS
Sbjct  173  RKQLEVLEDRLEAMVQPRLSDALS  196



>gb|AIU51102.1| embryo yellow protein, partial [Aquilegia coerulea]
Length=835

 Score =   244 bits (622),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRA+RDVIRLRDDALS R+SVS IL KL+KAEGSSAES+  LAKVD 
Sbjct  53   SLEEQSAAALLRVPRASRDVIRLRDDALSFRTSVSGILLKLKKAEGSSAESIDALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPQAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRL+DALS
Sbjct  173  RKQLEVLEDRLEAMVQPRLSDALS  196



>gb|AIU51151.1| embryo yellow protein, partial [Cinnamomum camphora]
Length=838

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S +AL RVPRA+RDVIRLRD+A+SLRSSVS IL KL+KAEGSSAES+A LAKVDT
Sbjct  53   SLDEQSNAALLRVPRASRDVIRLRDEAISLRSSVSGILLKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL+ MV PRL+DALS
Sbjct  173  RKQLEVLEDRLEEMVHPRLSDALS  196



>ref|XP_007218916.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
 gb|EMJ20115.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
Length=839

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SAS+L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASSLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLS+TVEDVF+SGDLP AAE LA+MRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSATVEDVFASGDLPLAAEHLASMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDAL  431
            RKQLEVLED+LDSMVQPRLTDA+
Sbjct  173  RKQLEVLEDKLDSMVQPRLTDAI  195



>gb|AIU51136.1| embryo yellow protein, partial [Prunus persica]
Length=838

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SAS+L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASSLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLS+TVEDVF+SGDLP AAE LA+MRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSATVEDVFASGDLPLAAEHLASMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDAL  431
            RKQLEVLED+LDSMVQPRLTDA+
Sbjct  173  RKQLEVLEDKLDSMVQPRLTDAI  195



>gb|EPS73811.1| hypothetical protein M569_00940, partial [Genlisea aurea]
Length=838

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++A+ R+PRA+RDV+RL+DDALSLRSS++ IL  L+KAEGSSAES+ATLA+VDT
Sbjct  53   SLEEQSSAAILRIPRASRDVLRLQDDALSLRSSIAGILLFLKKAEGSSAESIATLARVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFANI
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLDSMVQ  L DALS
Sbjct  173  RKQLEVLEDRLDSMVQHHLIDALS  196



>ref|XP_010536539.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tarenaya 
hassleriana]
Length=837

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  A+ RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD 
Sbjct  53   SLEEQSGGAILRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLDAMVQPRLTDALT  196



>ref|XP_010442641.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like, 
partial [Camelina sativa]
Length=491

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A L++VD+
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALSRVDS  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDA GLTQLSSTVE VF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDADGLTQLSSTVESVFNSGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL+ MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEKMVQPRLTDALT  196



>emb|CDX91578.1| BnaC02g15820D [Brassica napus]
Length=801

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDC  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAA++TLQDA+GLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAFKTLQDASGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALT  196



>ref|XP_006280007.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
 gb|EOA12905.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
Length=836

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETL++MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLSSMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALT  196



>gb|AIU51116.1| embryo yellow protein, partial [Capsella rubella]
Length=835

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETL++MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLSSMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALT  196



>dbj|BAG15881.1| conserved oligomeric Golgi complex component 7-related [Arabidopsis 
thaliana]
Length=836

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALT  196



>gb|AIU51104.1| embryo yellow protein, partial [Arabidopsis thaliana]
Length=835

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALT  196



>ref|NP_199956.1| COG7-like protein EYE [Arabidopsis thaliana]
 dbj|BAB09754.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96080.1| COG complex component-related protein [Arabidopsis thaliana]
Length=836

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALT  196



>gb|KFK26748.1| hypothetical protein AALP_AA8G288200 [Arabis alpina]
Length=836

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALT  196



>dbj|BAF00649.1| hypothetical protein [Arabidopsis thaliana]
Length=836

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALT  196



>gb|AIU51103.1| embryo yellow protein, partial [Arabidopsis lyrata]
Length=835

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALT  196



>ref|XP_002865861.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42120.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
Length=836

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALT  196



>gb|AIU51157.1| embryo yellow protein, partial [Trachycarpus fortunei]
Length=821

 Score =   239 bits (610),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE  SA AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DT
Sbjct  54   ALERESADALRRVPVACRDVVRLRDDALALRSVISSILLKLKKAEGTSAESIAALAKIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL+ MVQPRL+DALS
Sbjct  174  RKQLEVLEDRLEEMVQPRLSDALS  197



>ref|XP_010482477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   239 bits (610),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +ATLA+VD+
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIATLARVDS  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDA GLTQLSSTVE VF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDADGLTQLSSTVESVFNSGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL+ MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEKMVQPRLTDALT  196



>gb|AIU51143.1| embryo yellow protein, partial [Yucca filamentosa]
Length=822

 Score =   239 bits (610),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLE  S+ AL RVP A RDV RLR+DA+ LRS+VSSILQKL+KAEG+SAES+A LAK+DT
Sbjct  54   SLERESSDALRRVPLAVRDVARLREDAIQLRSAVSSILQKLKKAEGTSAESIAALAKIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL+ MVQPRL+DALS
Sbjct  174  RKQLEVLEDRLEEMVQPRLSDALS  197



>ref|XP_010934963.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elaeis 
guineensis]
Length=824

 Score =   239 bits (609),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE  SA AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DT
Sbjct  54   ALERESADALRRVPLACRDVVRLRDDALALRSIISSILLKLKKAEGTSAESIAALAKIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL+ MVQPRL+DALS
Sbjct  174  RKQLEVLEDRLEEMVQPRLSDALS  197



>ref|XP_008376425.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Malus domestica]
Length=648

 Score =   236 bits (601),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 130/143 (91%), Gaps = 6/143 (4%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+R+RDDA      VSSIL K +KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASALLRVPRATRDVVRIRDDA------VSSILDKFKKAEGSSAESMAALAKVDI  106

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLP AAETLANMRHCLSAVGEVAEFAN+
Sbjct  107  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPLAAETLANMRHCLSAVGEVAEFANL  166

Query  363  RKQLEVLEDRLDSMVQPRLTDAL  431
            RKQLEVLEDRLDSMVQPRLTDA+
Sbjct  167  RKQLEVLEDRLDSMVQPRLTDAI  189



>gb|AIU51158.1| embryo yellow protein, partial [Cabomba caroliniana]
Length=804

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S +AL RVPR+TRDV+RLRDDA SLRS+V  ILQ+L+KAEGSSAES+  LA++D 
Sbjct  21   SLDEQSQAALLRVPRSTRDVVRLRDDASSLRSAVLLILQRLKKAEGSSAESITALAEIDM  80

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  81   VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  140

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD+MVQPRL+DA+S
Sbjct  141  RKQLEVLEDRLDAMVQPRLSDAIS  164



>ref|XP_008796946.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Phoenix 
dactylifera]
Length=824

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE  SA AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DT
Sbjct  54   ALERESADALRRVPLACRDVVRLRDDALALRSVISSILLKLKKAEGTSAESIAALAKIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPQAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL+ MVQPRL+DALS
Sbjct  174  RKQLEVLEDRLEEMVQPRLSDALS  197



>ref|XP_010443240.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD+
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDS  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDA GLTQLSSTVE VF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDADGLTQLSSTVESVFNSGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL+ MVQPRLTDAL+
Sbjct  173  RKQLEVLEDRLEKMVQPRLTDALT  196



>gb|AIU51153.1| embryo yellow protein, partial [Ginkgo biloba]
Length=816

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E SA+AL RVPRA+RDVIR+RDDA++LRS+VS ILQKL+KAEGSSAES+A LA+VDT
Sbjct  28   SLDEQSAAALLRVPRASRDVIRVRDDAIALRSAVSGILQKLKKAEGSSAESIAALARVDT  87

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLT+LS+TVEDVF+SGDL +AAETLANMRHCLS VGEVAEFAN+
Sbjct  88   VKQRMEAAYETLQDAAGLTKLSATVEDVFASGDLSQAAETLANMRHCLSVVGEVAEFANV  147

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            ++QLEVLEDRL+ MVQPRL++A+S
Sbjct  148  KRQLEVLEDRLEGMVQPRLSEAIS  171



>gb|AIU51125.1| embryo yellow protein, partial [Chimonanthus praecox]
Length=828

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  27   ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  206
            AL R+PRA+RDVIRLRD+A+SLRSSVSSIL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRIPRASRDVIRLRDEAVSLRSSVSSILLKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  207  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLE  386
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVLE
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVLE  180

Query  387  DRLDSMVQPRLTDALS  434
            DRL+ MV PRL+ ALS
Sbjct  181  DRLEEMVHPRLSVALS  196



>gb|AIU51156.1| embryo yellow protein, partial [Alisma plantago-aquatica]
Length=823

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE  S  AL RVP A RDV+RLRD+A+SLR+ VS ILQKL KA+GSSAE+++ +AK+D 
Sbjct  54   ALERESTDALRRVPVAVRDVLRLRDEAISLRAVVSGILQKLNKADGSSAEAISAIAKIDV  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RME+AYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  114  VKKRMESAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  173

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD MVQPRL+DALS
Sbjct  174  RKQLEVLEDRLDQMVQPRLSDALS  197



>gb|AIU51127.1| embryo yellow protein, partial [Asparagus officinalis]
Length=822

 Score =   233 bits (594),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLE  S+ AL RVP A RDV RLR+DA+ LRS+V+SILQKL+KAEG+SAE +A LAK+DT
Sbjct  54   SLERESSDALRRVPAAVRDVARLREDAIQLRSAVNSILQKLKKAEGTSAEHIAALAKIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDL RAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLSRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRLD MVQPRL+DAL+
Sbjct  174  RKQLEVLEDRLDEMVQPRLSDALT  197



>gb|AIU51124.1| embryo yellow protein, partial [Ceratophyllum demersum]
Length=813

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S+++L RVPRA+RDV+RLR+DA++L++SV+ ILQKL KAEG+++ESVA LA VD 
Sbjct  53   SLDEQSSASLLRVPRASRDVVRLREDAMTLKASVTGILQKLIKAEGTASESVAALATVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL+ MVQPRL+DA++
Sbjct  173  RKQLEVLEDRLEGMVQPRLSDAIA  196



>gb|AIU51150.1| embryo yellow protein, partial [Ceratophyllum platyacanthum subsp. 
oryzetorum]
Length=813

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S+++L RVPRA+RDV+RLR+DA++L++SV+ ILQKL KAEG+++ESVA LA VD 
Sbjct  53   SLDEQSSASLLRVPRASRDVVRLREDAMTLKASVTGILQKLIKAEGTASESVAALATVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL+ MVQPRL+DA++
Sbjct  173  RKQLEVLEDRLEGMVQPRLSDAIA  196



>ref|XP_010692941.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Beta 
vulgaris subsp. vulgaris]
Length=836

 Score =   231 bits (588),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+A+ RVPRATRDVIR+RDDA+SLRSS+SSIL K+++AEGS+A+S+A LAKVDT
Sbjct  53   SLEEQSAAAILRVPRATRDVIRIRDDAVSLRSSISSILGKIKQAEGSAADSIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKFRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQLEVLEDRL++MVQPRLTDALS
Sbjct  173  RKQLEVLEDRLEAMVQPRLTDALS  196



>gb|AIU51107.1| embryo yellow protein, partial [Musa acuminata]
Length=814

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +L+  SA AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D+
Sbjct  54   ALDRESADALRRVPLACRDVLRLRDDALSLRSLVSSILLALSKAEGTSAESIAAIAKIDS  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVLEDRLDSMVQPRLTDAL  431
            RKQLEVLEDRL+ MVQPRL DAL
Sbjct  174  RKQLEVLEDRLEEMVQPRLFDAL  196



>ref|XP_009399332.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Musa 
acuminata subsp. malaccensis]
Length=818

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +L+  SA AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D+
Sbjct  54   ALDRESADALRRVPLACRDVLRLRDDALSLRSLVSSILLALSKAEGTSAESIAAIAKIDS  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVLEDRLDSMVQPRLTDAL  431
            RKQLEVLEDRL+ MVQPRL DAL
Sbjct  174  RKQLEVLEDRLEEMVQPRLFDAL  196



>gb|AIU51142.1| embryo yellow protein, partial [Dioscorea oppositifolia]
Length=831

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  18   SASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRM  197
            SA +L R+P A RD++RLRDDA +LR  VS++L  L +AEG+SAES+AT+A++DTVKRRM
Sbjct  59   SADSLRRLPLACRDLLRLRDDAHALRHLVSALLTNLAQAEGTSAESIATIARIDTVKRRM  118

Query  198  EAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLE  377
            EAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLE
Sbjct  119  EAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLE  178

Query  378  VLEDRLDSMVQPRLTDALS  434
            VLEDRL+ MVQPRL+DALS
Sbjct  179  VLEDRLEEMVQPRLSDALS  197



>ref|XP_006657236.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Oryza brachyantha]
Length=824

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  SA AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTV
Sbjct  55   LERDSADALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            KQLEVLE+RLD MVQPRL DALS
Sbjct  175  KQLEVLEERLDDMVQPRLVDALS  197



>gb|EEC81147.1| hypothetical protein OsI_24056 [Oryza sativa Indica Group]
Length=825

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  SA AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTV
Sbjct  55   LERDSADALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            KQLEVLE+RLD MVQPRL DALS
Sbjct  175  KQLEVLEERLDDMVQPRLVDALS  197



>gb|AIU51108.1| embryo yellow protein, partial [Pinellia ternata]
Length=829

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE+ SA AL RVP A RDV+RLRD+A +LRS VSSIL KL+KA  +S+ESV  L+++D 
Sbjct  54   TLEKESADALRRVPLAVRDVLRLRDEAHALRSVVSSILLKLKKAGETSSESVEALSRIDA  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKRRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RK+LEVLEDRL+ MVQPRL+DALS
Sbjct  174  RKRLEVLEDRLEDMVQPRLSDALS  197



>dbj|BAD45448.1| oligomeric golgi complex 7-like [Oryza sativa Japonica Group]
Length=873

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  SA AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTV
Sbjct  55   LERDSADALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            KQLEVLE+RLD MVQPRL DALS
Sbjct  175  KQLEVLEERLDDMVQPRLVDALS  197



>dbj|BAJ94393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   219 bits (558),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  SA AL RVP A RD +RLRDDAL+LRS ++S+L  L +AEGSSAES+  LA++DTV
Sbjct  55   LERDSADALRRVPLACRDALRLRDDALALRSHLASVLHSLSQAEGSSAESITALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            KQLEVLE+RLD MVQPRL DALS
Sbjct  175  KQLEVLEERLDEMVQPRLLDALS  197



>ref|XP_003618197.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74415.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=755

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVI LRDDA SL S+VS IL  L+K  GSSAES+A LAKVD 
Sbjct  49   SLEEQSSAALLRVPRATRDVICLRDDAGSLCSAVSVILHNLQKRNGSSAESIAALAKVDV  108

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RME AYETLQDAAGLTQLSSTVEDVF SGDLP AAETLANMRHCLSAVGEVAEFANI
Sbjct  109  VKQRMEVAYETLQDAAGLTQLSSTVEDVFDSGDLPCAAETLANMRHCLSAVGEVAEFANI  168

Query  363  RKQLEVLEDRLDSMV  407
            RKQLEVLEDRLD+M+
Sbjct  169  RKQLEVLEDRLDTMI  183



>gb|AIU51155.1| embryo yellow protein, partial [Zea mays]
Length=818

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  S  AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTV
Sbjct  55   LERDSGDALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            KQLEVLE+RLD MVQPRL DALS
Sbjct  175  KQLEVLEERLDEMVQPRLVDALS  197



>ref|XP_008658135.1| PREDICTED: uncharacterized protein LOC100193995 isoform X1 [Zea 
mays]
 gb|AFW87715.1| hypothetical protein ZEAMMB73_766806 [Zea mays]
Length=820

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  S  AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTV
Sbjct  55   LERDSGDALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            KQLEVLE+RLD MVQPRL DALS
Sbjct  175  KQLEVLEERLDEMVQPRLVDALS  197



>gb|AIU51146.1| embryo yellow protein, partial [Sorghum bicolor]
Length=818

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  S  AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTV
Sbjct  55   LERDSGDALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            KQLEVLE+RLD MVQPRL DALS
Sbjct  175  KQLEVLEERLDEMVQPRLVDALS  197



>ref|XP_002438832.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
 gb|EER90199.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
Length=820

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  S  AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTV
Sbjct  55   LERDSGDALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            KQLEVLE+RLD MVQPRL DALS
Sbjct  175  KQLEVLEERLDEMVQPRLVDALS  197



>ref|XP_004966309.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Setaria italica]
Length=820

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  S  AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTV
Sbjct  55   LERDSGDALRRVPLACRDALRLRDDAVALRAHLASVLQSLSLAEGSSAESIAALAQIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            KQLEVLE+RLD MVQPRL DALS
Sbjct  175  KQLEVLEERLDEMVQPRLVDALS  197



>gb|AIU51144.1| embryo yellow protein, partial [Setaria italica]
Length=818

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  S  AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTV
Sbjct  55   LERDSGDALRRVPLACRDALRLRDDAVALRAHLASVLQSLSLAEGSSAESIAALAQIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            KQLEVLE+RLD MVQPRL DALS
Sbjct  175  KQLEVLEERLDEMVQPRLVDALS  197



>gb|AIU51128.1| embryo yellow protein, partial [Aristolochia tagala]
Length=834

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S +AL RVPRA+RDVIRLRDDA+SLRS++S IL KL+KAEGSSA ++A+LAKVDT
Sbjct  53   SLDEQSTAALLRVPRASRDVIRLRDDAVSLRSAISGILLKLKKAEGSSAAAIASLAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLA+MRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLASMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            RKQL VLEDRL+ MVQPRL+DALS
Sbjct  173  RKQLAVLEDRLEEMVQPRLSDALS  196



>gb|AIU51137.1| embryo yellow protein, partial [Panicum virgatum]
Length=818

 Score =   216 bits (550),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  18   SASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRM  197
            S  AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTVK+RM
Sbjct  59   SGDALRRVPLACRDALRLRDDAVALRAHLASVLQSLNLAEGSSAESIAALAQIDTVKQRM  118

Query  198  EAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLE  377
            EAAY TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLE
Sbjct  119  EAAYTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLE  178

Query  378  VLEDRLDSMVQPRLTDALS  434
            VLE+RLD MVQPRL DALS
Sbjct  179  VLEERLDEMVQPRLVDALS  197



>dbj|BAJ95800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  SA AL RVP A RD +RLRDDAL+LRS ++S+L  L +AEGSSAES+  LA++DTV
Sbjct  55   LERDSADALRRVPLACRDALRLRDDALALRSHLASVLHSLSQAEGSSAESITALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            KQLEVLE+RL  MVQPRL DALS
Sbjct  175  KQLEVLEERLVEMVQPRLLDALS  197



>ref|XP_001770876.1| predicted protein [Physcomitrella patens]
 gb|EDQ64400.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA AL RVPRA+RDV R+RDDALSLRS+VS++LQKL++AEG+SAESVA LA+VD 
Sbjct  53   SLEEQSAQALLRVPRASRDVFRVRDDALSLRSTVSAVLQKLQQAEGTSAESVAALARVDA  112

Query  183  VKRRMEAAYETL-QDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFAN  359
            VK+RMEAA+ETL QDAAGL +LS++VEDVF+SG+LP+AAETLA MR CL+ VGEV EFAN
Sbjct  113  VKQRMEAAHETLQQDAAGLAKLSASVEDVFASGNLPQAAETLAQMRRCLAVVGEVPEFAN  172

Query  360  IRKQLEVLEDRLDSMVQPRLTDALS  434
            +++QLE LEDRL+ MVQPRL DAL+
Sbjct  173  VKRQLEGLEDRLEGMVQPRLADALT  197



>gb|AIU51130.1| embryo yellow protein, partial [Canna indica]
Length=815

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +L+  SA AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D 
Sbjct  54   ALDRESADALRRVPLACRDVLRLRDDALSLRSLVSSILLSLNKAEGTSAESIAAIAKIDI  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVLEDRLDSMVQPRLTDAL  431
            RKQLEVLEDRL+ MVQPRL DAL
Sbjct  174  RKQLEVLEDRLEEMVQPRLFDAL  196



>gb|AIU51111.1| embryo yellow protein, partial [Acorus calamus]
Length=827

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            L + ++ A+  VP A RDV RLRD+ALSLRSSVSSIL KL++AEGS+AES+A LAK+DTV
Sbjct  55   LSKRTSEAMLSVPHAARDVARLRDEALSLRSSVSSILSKLKQAEGSAAESIAVLAKIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAA+ TLQ+AAGLT+LS++VE VF+SGDL +AAETLA MR  L AVGEVAEFAN+R
Sbjct  115  KQRMEAAHTTLQEAAGLTELSASVESVFASGDLRQAAETLAQMRRRLFAVGEVAEFANVR  174

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            KQLEVLEDRLD MVQP+L+DALS
Sbjct  175  KQLEVLEDRLDEMVQPQLSDALS  197



>ref|XP_002972505.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
 gb|EFJ26591.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
Length=779

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE+ S +AL R+PRA RDV RL DDALSLRS+VS +L KLR AEG SA SVA L++VD 
Sbjct  52   ALEDQSTAALLRIPRALRDVSRLHDDALSLRSTVSGMLLKLRTAEGLSAGSVAALSRVDL  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAA++TL+DAAGL QL ++VE VF+SG+L  AA TLANMR CL+ VGEV EFA++
Sbjct  112  VKQRMEAAHKTLKDAAGLAQLCASVETVFASGNLDEAAGTLANMRRCLAVVGEVPEFASV  171

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            +++LE LE+RLD MVQ RLTDAL+
Sbjct  172  KRELEALENRLDGMVQTRLTDALT  195



>ref|XP_002992562.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
 gb|EFJ06368.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
Length=779

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE+ S +AL R+PRA RDV RL DDALSLRS+VS +L KLR AE  SA SVA L++VD 
Sbjct  52   ALEDQSTAALLRIPRALRDVSRLHDDALSLRSTVSGMLLKLRTAESLSAGSVAALSRVDL  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAA++TL+DAAGL QL ++VE VF+SG+L  AA TLANMR CL+ VGEV EFA++
Sbjct  112  VKQRMEAAHKTLKDAAGLAQLCASVETVFASGNLDEAAGTLANMRRCLAVVGEVPEFASV  171

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            +++LE LE+RLD MVQ RLTDAL+
Sbjct  172  KRELEALENRLDGMVQTRLTDALT  195



>gb|EEE66191.1| hypothetical protein OsJ_22310 [Oryza sativa Japonica Group]
Length=790

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  129  KAEGSSAESVATLAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLA  308
            +AEGSSAES+  LA++DTVK+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA
Sbjct  61   EAEGSSAESITALARIDTVKQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLA  120

Query  309  NMRHCLSAVGEVAEFANIRKQLEVLEDRLDSMVQPRLTDALS  434
             MRHCLSAVGEVAEFAN+RKQLEVLE+RLD MVQPRL DALS
Sbjct  121  TMRHCLSAVGEVAEFANVRKQLEVLEERLDDMVQPRLVDALS  162



>ref|XP_003563389.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Brachypodium 
distachyon]
Length=825

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE  SA AL RVP A RD +RLRDDA++LRS V+S+LQ L +AEGSSAES+  LA++DT
Sbjct  54   ALERDSADALRRVPLACRDALRLRDDAVALRSHVASVLQSLSQAEGSSAESITALARIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEV    N 
Sbjct  114  VKQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVRNPPNF  173

Query  363  RKQLEVLEDRLDSM  404
             K+L+     LD +
Sbjct  174  EKRLKKFTPFLDPL  187



>gb|AIU51109.1| embryo yellow protein, partial [Brachypodium distachyon]
Length=784

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE  SA AL RVP A RD +RLRDDA++LRS V+S+LQ L +AEGSSAES+  LA++DT
Sbjct  54   ALERDSADALRRVPLACRDALRLRDDAVALRSHVASVLQSLSQAEGSSAESITALARIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGE AE   I
Sbjct  114  VKQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEGAEIPQI  173

Query  363  RKQ  371
             K+
Sbjct  174  LKK  176



>ref|XP_010062289.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Eucalyptus grandis]
Length=722

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = +3

Query  195  MEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  374
            MEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAA+TLANMRHCLSAVGEVAEFAN+RKQL
Sbjct  1    MEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAADTLANMRHCLSAVGEVAEFANVRKQL  60

Query  375  EVLEDRLDSMVQPRLTDALS  434
            EVLEDRLD+MVQPRLTDALS
Sbjct  61   EVLEDRLDNMVQPRLTDALS  80



>gb|EMT03910.1| hypothetical protein F775_26031 [Aegilops tauschii]
Length=697

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  195  MEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  374
            MEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQL
Sbjct  1    MEAAYTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQL  60

Query  375  EVLEDRLDSMVQPRLTDALS  434
            EVLE+RLD MVQPRL DALS
Sbjct  61   EVLEERLDEMVQPRLLDALS  80



>gb|EMS57916.1| hypothetical protein TRIUR3_24838 [Triticum urartu]
Length=706

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  195  MEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  374
            MEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQL
Sbjct  1    MEAAYTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQL  60

Query  375  EVLEDRLDSMVQPRLTDALS  434
            EVLE+RLD MVQPRL DALS
Sbjct  61   EVLEERLDEMVQPRLLDALS  80



>ref|XP_003055554.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60806.1| predicted protein [Micromonas pusilla CCMP1545]
Length=809

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S + L+R+PRA  ++ R+  D  +L++ V  IL++L  AEGSS ESV  L +VD 
Sbjct  53   ALEEQSNAGLNRIPRAVAEIDRVEHDTKALQTRVQGILKRLNDAEGSSRESVRRLTRVDA  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RMEAA +TL++AAGL +L ++VEDVF++G++   A+ LA+MR  L  VG V EF + 
Sbjct  113  VKGRMEAARDTLREAAGLAELMASVEDVFAAGNVRSMADVLASMRRALKVVGGVPEFQDA  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
             ++++ LE RL+ +++P L  AL+
Sbjct  173  PEKVDALERRLEQILKPELVKALT  196



>ref|XP_005847546.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
 gb|EFN55444.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
Length=753

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 96/155 (62%), Gaps = 12/155 (8%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLR----------DDALSLRSSVSSILQKLRKA-EGSSAE  152
            L++ S  A+ R+P A ++++R++          DD  +LR S ++ L++L  A  G +A 
Sbjct  53   LQDHSGRAMQRIPAAAKELLRIKVRVRLADRNSDDVATLRGSAAAALKQLEDAGSGQAAA  112

Query  153  SVATLAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSA  332
             V  L  VDTVKRRME A  TL++AAGL+ L   V+D F+SG+L R A+TLA MR  L+ 
Sbjct  113  VVGQLQAVDTVKRRMEDACSTLKEAAGLSALFQQVDDHFASGNLRRVADTLAGMRRGLAV  172

Query  333  VGE-VAEFANIRKQLEVLEDRLDSMVQPRLTDALS  434
            VG+ VAEF   R +L  LE+R  +MV+  LT A +
Sbjct  173  VGDSVAEFRGGRDRLARLEERFAAMVEAPLTAAFA  207



>ref|XP_002503576.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64834.1| predicted protein [Micromonas sp. RCC299]
Length=770

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 92/144 (64%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S + L R+PRA  ++ R+  ++ +L++ ++ IL++L +AE  S  SV  L  +D 
Sbjct  53   ALEEQSVAGLQRIPRAVAEIDRVELESKNLQTRIAGILKRLDEAETGSRASVNLLRDIDA  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RME   +TL +AAGL +L  + +DVF+ G++   A+ +A+MR  L  VG V EF + 
Sbjct  113  VKGRMELTRDTLAEAAGLAELMRSADDVFAGGNVRSMADIVASMRRSLKVVGSVPEFEDA  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
             +++E LE RL+  V+P L  AL+
Sbjct  173  PERVEALEHRLEQAVKPELVKALA  196



>ref|XP_002953697.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
 gb|EFJ45321.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
Length=957

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 91/144 (63%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +L + SA A+ R+P A +++ RL+ D   ++  V  + Q +++    +  SVA ++++  
Sbjct  52   TLSDNSAQAMRRIPFAIQEIYRLQGDIQGMQDQVQVMAQTVQRDATEAQSSVAHISELHR  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK  ME+A  +L+ A  L+ L   VEDVF++GDLP+ AE LA+MR  LS VG+V EF   
Sbjct  112  VKANMESACNSLKQATELSGLFVKVEDVFAAGDLPKVAEILASMRRSLSLVGDVPEFRAG  171

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            R++L  LEDRL + V+  L +AL+
Sbjct  172  RQKLRALEDRLQTQVEGSLGEALA  195



>emb|CEF98773.1| Conserved oligomeric Golgi complex subunit 7 [Ostreococcus tauri]
Length=786

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 88/143 (62%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S  A  RVPRATR++ R+     +LR    ++L +L + E  S  SV  L ++D 
Sbjct  64   ALEERSREATSRVPRATREIERVERRVEALREETRAMLTRLDEVEEVSRASVDALRQLDA  123

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
             KRRME+A ETLQ+  GL  L + V+ +F+SG++   ++ LA M+  L+ VG+V EFA+ 
Sbjct  124  AKRRMESAKETLQETNGLADLMANVDGIFASGNIRSMSDALARMKRALAVVGDVPEFADG  183

Query  363  RKQLEVLEDRLDSMVQPRLTDAL  431
            + ++   E +L+ +V+P L  A 
Sbjct  184  QDKVNAFEHKLEGIVRPALVTAF  206



>ref|XP_001418731.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97024.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=816

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 89/143 (62%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S   + RVP+A +++  +      L   V  IL +L + E  S  SV  L ++D 
Sbjct  90   SLEERSREGVARVPKAVKEIEVVEGRVKRLHEEVRGILDRLDEVESESRASVEALRQLDA  149

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
             K+RME+A ETLQ+A GL  L ++V+ +F+SG++   +E+LA M+  L+ VG+V EFA+ 
Sbjct  150  AKQRMESARETLQEANGLADLMASVDGIFASGNIRNMSESLARMKRGLAVVGDVPEFADG  209

Query  363  RKQLEVLEDRLDSMVQPRLTDAL  431
            + ++   E +L+++V+P L  AL
Sbjct  210  QDKVNAFEHKLEAIVRPALITAL  232



>ref|XP_001628559.1| predicted protein [Nematostella vectensis]
 gb|EDO36496.1| predicted protein [Nematostella vectensis]
Length=713

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 91/144 (63%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S  A++ +PR  R++  ++ +A  LR  +  + + ++K E ++A+S+  L ++DT
Sbjct  51   ALEETSVQAVNNIPRVVREIDNVQHEASLLREQMHMVKEDIKKVEENTAQSMKMLMELDT  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK  M+AA + LQ+A   T LSS V+ VF SGD+   ++ L  M   L+ + +V ++A  
Sbjct  111  VKSHMQAASQGLQEADNWTTLSSDVDKVFESGDIIAISDKLVGMHKSLNVLQDVPDYAER  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            R+ LE L++RL++++ P++  A +
Sbjct  171  RRMLEGLKNRLEALLSPKIVAAFN  194



>ref|XP_786237.3| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Strongylocentrotus purpuratus]
Length=762

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL  +PR  RDV  +R +A  L+  +  + + ++K E  ++ES+  L ++DT
Sbjct  53   SLEETSQQALQNLPRVLRDVEAVRQEAGFLKDQMQLVKEDIKKVEEDTSESMKMLLEIDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K RM+AA + LQ+A   T L + V++VF+S D+   A+ L  M+H LS +    ++   
Sbjct  113  IKSRMKAASDALQEADNWTTLMADVDEVFASKDVQLIADKLLAMQHSLSMLAHCGDYDER  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
             + LEVL++RL++++ P+L  A +
Sbjct  173  CQSLEVLKNRLEALLSPQLVSAFN  196



>ref|XP_006623838.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Apis dorsata]
Length=760

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 52/144 (36%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D 
Sbjct  77   ALEETSQSVLSSLPRVLRDTQFLQQEALALREKMIAVKQEIEKVEKDTASSMATLEKIDR  136

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + 
Sbjct  137  IKTDLQTAKQGLHEADNWTVLANDVEEVFESGDVEAIANKLFSMQKSLAMLVNVIDYEDK  196

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  P+L  A +
Sbjct  197  KLQLEGLKNRLEAIASPKLVQAFT  220



>ref|XP_006623839.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X2 [Apis dorsata]
Length=734

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 52/144 (36%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D 
Sbjct  51   ALEETSQSVLSSLPRVLRDTQFLQQEALALREKMIAVKQEIEKVEKDTASSMATLEKIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + 
Sbjct  111  IKTDLQTAKQGLHEADNWTVLANDVEEVFESGDVEAIANKLFSMQKSLAMLVNVIDYEDK  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  P+L  A +
Sbjct  171  KLQLEGLKNRLEAIASPKLVQAFT  194



>ref|XP_011154014.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Harpegnathos 
saltator]
 gb|EFN88360.1| Conserved oligomeric Golgi complex subunit 7 [Harpegnathos saltator]
Length=735

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 87/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D 
Sbjct  51   ALEETSQSVLSSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + 
Sbjct  111  IKTELQTAKQGLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDK  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL++M  PRL  A +
Sbjct  171  KLQLEGLKNRLEAMASPRLVQAFT  194



>ref|XP_011068677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Acromyrmex 
echinatior]
Length=735

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 88/144 (61%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD + L+ + L+LR  + ++ Q++ K E  +A S+A L K+D 
Sbjct  51   ALEETSQSVLSSLPRILRDTLLLQQETLALREKMVAVKQEIAKIEKDTASSMAMLEKIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + 
Sbjct  111  IKTELQTAKQGLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDK  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  PRL  A +
Sbjct  171  KLQLEGLKNRLEAIASPRLVQAFT  194



>ref|XP_003691700.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Apis florea]
Length=697

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 51/144 (35%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D 
Sbjct  13   ALEETSQSVLSSLPRVLRDTQFLQQEALALREKMVAVKQEIEKVEKDTASSMATLEKIDK  72

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + 
Sbjct  73   IKTDLQTAKQGLHEADNWSVLANDVEEVFESGDVEAIANKLFSMQKSLAMLVNVIDYEDK  132

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  P+L  A +
Sbjct  133  KLQLEGLKNRLEAIASPKLVQAFT  156



>gb|EGI69206.1| Conserved oligomeric Golgi complex subunit 7 [Acromyrmex echinatior]
Length=864

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 88/144 (61%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD + L+ + L+LR  + ++ Q++ K E  +A S+A L K+D 
Sbjct  180  ALEETSQSVLSSLPRILRDTLLLQQETLALREKMVAVKQEIAKIEKDTASSMAMLEKIDR  239

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + 
Sbjct  240  IKTELQTAKQGLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDK  299

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  PRL  A +
Sbjct  300  KLQLEGLKNRLEAIASPRLVQAFT  323



>ref|XP_394713.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Apis 
mellifera]
Length=733

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 50/144 (35%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D 
Sbjct  51   ALEETSQSVLSSLPRVLRDTQFLQQEALALREKMVAVKQEIEKVEKDTASSMATLEKIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   + L++ VE++F SGD+   A  L +M+  L+ +  V ++ + 
Sbjct  111  IKTDLQTAKQGLHEADNWSVLANDVEEIFESGDVEAIANKLFSMQKSLAMLVNVIDYEDK  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  P+L  A +
Sbjct  171  KLQLEGLKNRLEAIASPKLVQAFT  194



>ref|XP_003703617.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Megachile rotundata]
Length=764

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ +A++L   + ++ Q++ K E  +A S+ATL ++D 
Sbjct  79   ALEETSQSVLSSLPRVLRDTQLLQQEAIALSEKMVAVKQEIEKVEKDTASSMATLERIDK  138

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++AA + L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + 
Sbjct  139  IKTDLQAAKQGLHEADNWSVLANDVEEVFESGDIEAIANKLFSMQKSLAMLVNVVDYEDK  198

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL++M  P+L  A +
Sbjct  199  KFQLEGLKNRLEAMASPKLVQAFT  222



>ref|XP_006825808.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like, 
partial [Saccoglossus kowalevskii]
Length=207

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 84/144 (58%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL   PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  60   SLEETSQQALQNFPRVLRDVEAVRQEAAFLQEQMQMVKEDIKKVEQDTAQSMQMLLELDV  119

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K RM++A   L++A   T L + ++D+F S D+   A+ L  M+H LS +    ++   
Sbjct  120  IKSRMQSASSALKEADNWTTLMADIDDLFQSQDVHAIAKKLLAMQHSLSLLAHCGDYEER  179

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
             + LE L++RL+++V P+L  A +
Sbjct  180  AQYLETLKNRLETLVSPQLITAFN  203



>ref|XP_011159533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solenopsis 
invicta]
Length=735

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 88/144 (61%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+ATL ++D 
Sbjct  51   ALEETSQSVLSSLPRILRDTQLLQQETLALREKMVAVKQEIAKIEKDTASSMATLERIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + 
Sbjct  111  IKTELQTAKQGLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDK  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  PRL  A +
Sbjct  171  KLQLEGLKNRLEAIASPRLVQAFT  194



>ref|XP_004351649.1| hypothetical protein ACA1_397180 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR22872.1| hypothetical protein ACA1_397180 [Acanthamoeba castellanii str. 
Neff]
Length=699

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 85/144 (59%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL E SA +L  +P++ R +  +R +A +L++ ++S  + L K EG++  S+  LA +DT
Sbjct  29   SLREFSAKSLRNIPKSIRSIESVRKEASALQTQITSFAETLEKIEGNADNSLEVLAALDT  88

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK  ME     L +A  L +LS  V++VF + D  R A+ +  M+  L  + E+ +F + 
Sbjct  89   VKMSMEKCSSILVEAEKLKRLSEDVDNVFRTNDFRRIADHILGMKQSLDILKEIPQFQDN  148

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            ++QL + +DRL+ M +P L  A +
Sbjct  149  QRQLMLYQDRLEGMTRPHLLAAFN  172



>gb|EFZ22757.1| hypothetical protein SINV_01051 [Solenopsis invicta]
Length=780

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 88/144 (61%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+ATL ++D 
Sbjct  53   ALEETSQSVLSSLPRILRDTQLLQQETLALREKMVAVKQEIAKIEKDTASSMATLERIDR  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + 
Sbjct  113  IKTELQTAKQGLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDK  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  PRL  A +
Sbjct  173  KLQLEGLKNRLEAIASPRLVQAFT  196



>ref|XP_003397366.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus terrestris]
Length=735

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL ++D 
Sbjct  51   ALEETSQSVLSSLPRVLRDTQLLQQEALALREKMVAVKQEIEKVEKDTASSMATLERIDK  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + 
Sbjct  111  IKTDLQIAKQGLHEADNWSILANDVEEVFESGDIEAIANKLFSMQKSLAMLVNVIDYEDK  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  P+L  A +
Sbjct  171  KLQLEGLKNRLEAIASPKLVQAFT  194



>ref|XP_011340195.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Cerapachys biroi]
 gb|EZA53204.1| Conserved oligomeric Golgi complex subunit [Cerapachys biroi]
Length=735

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 87/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ + ++LR  + ++ Q++ K E  +A S+A L K+D 
Sbjct  51   ALEETSQSVLSSLPRILRDTQLLQQETVALREKMVAVKQEIAKVERDTASSMAMLEKIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + 
Sbjct  111  IKTELQTAKQGLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDK  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL++M  PRL  A +
Sbjct  171  KLQLEGLKNRLEAMASPRLVQAFT  194



>ref|XP_003490215.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus impatiens]
Length=783

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL ++D 
Sbjct  99   ALEETSQSVLSSLPRVLRDTQLLQQEALALREKMVAVKQEIEKVEKDTASSMATLERIDK  158

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + 
Sbjct  159  IKTDLQIAKQGLHEADNWSILANDVEEVFESGDIEAIANKLFSMQKSLAMLVNVIDYEDK  218

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  P+L  A +
Sbjct  219  KLQLEGLKNRLEAIASPKLVQAFT  242



>ref|XP_011340196.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Cerapachys biroi]
Length=705

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 87/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ + ++LR  + ++ Q++ K E  +A S+A L K+D 
Sbjct  21   ALEETSQSVLSSLPRILRDTQLLQQETVALREKMVAVKQEIAKVERDTASSMAMLEKIDR  80

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + 
Sbjct  81   IKTELQTAKQGLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDK  140

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL++M  PRL  A +
Sbjct  141  KLQLEGLKNRLEAMASPRLVQAFT  164



>gb|KDR16116.1| Conserved oligomeric Golgi complex subunit 7 [Zootermopsis nevadensis]
Length=742

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 84/144 (58%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE+ S   L  +PR  RD   L  +AL LR  + S+ Q++ K E  +A+S+ TL ++D 
Sbjct  51   ALEDTSQQVLQSLPRVMRDTEILHQEALLLRDKMHSVKQEIAKVEQDTAQSMKTLERIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++AA E L +A   T L++ +E+VF SGD+   +  L +M+  L  +  V ++ + 
Sbjct  111  IKTELQAAKEALHEADNWTVLATDLEEVFESGDIQSISAKLVSMQQSLRILANVPDYEDR  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
              QLE L++RL++M  P L  A +
Sbjct  171  HLQLEGLKNRLEAMASPLLVQAFT  194



>ref|XP_001701937.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
 gb|EDP06912.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
Length=758

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +L + SA A+ R+P A +++ RL+ D   ++  V  +   +++    +  SV  ++++  
Sbjct  54   TLSDNSAQAMRRIPFAIQEIYRLQGDIQGMQDQVQVLAGSVQRDATDARGSVEHISQLHL  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK  ME A  +L++A  L+ L   VE+VF++GDLP+ AE LA+MR  LS VG+V EF   
Sbjct  114  VKANMENACNSLKEATELSGLFVKVEEVFAAGDLPKVAEILASMRRSLSLVGDVPEFRAG  173

Query  363  RKQLEVLEDRLDSMVQ  410
            R++L  LEDRL + V 
Sbjct  174  RQKLRALEDRLQTQVH  189



>ref|XP_011264701.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Camponotus floridanus]
 gb|EFN62526.1| Conserved oligomeric Golgi complex subunit 7 [Camponotus floridanus]
Length=735

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 86/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D 
Sbjct  51   ALEETSQSVLSSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ +E+VF SGD+   +  L +M+  L  +  V ++ + 
Sbjct  111  IKTELQTAKQGLHEADNWTVLANDMEEVFESGDIEAISNKLFSMQKSLVMLANVVDYEDK  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  PRL  A +
Sbjct  171  KLQLEGLKNRLEAIASPRLVQAFT  194



>ref|XP_011264700.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camponotus floridanus]
Length=747

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 86/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D 
Sbjct  63   ALEETSQSVLSSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDR  122

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ +E+VF SGD+   +  L +M+  L  +  V ++ + 
Sbjct  123  IKTELQTAKQGLHEADNWTVLANDMEEVFESGDIEAISNKLFSMQKSLVMLANVVDYEDK  182

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  PRL  A +
Sbjct  183  KLQLEGLKNRLEAIASPRLVQAFT  206



>ref|XP_007513783.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16308.1| predicted protein [Bathycoccus prasinos]
Length=978

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 86/142 (61%), Gaps = 0/142 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  S   + R+P A  ++  L ++  SL ++V +I + L + E  S +S+  L K+D V
Sbjct  68   LERESQLGVKRIPTAIGEIEVLEENVESLTNTVKNISRSLDETEFPSKQSIERLRKIDEV  127

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RME A +TL +AAGL +L  +V+ VF+  ++   A+ L  M+  L+ VG+V EFA+ R
Sbjct  128  KSRMERARDTLSEAAGLAELMHSVDSVFNGENVSNMADALVRMKRGLAIVGDVPEFADGR  187

Query  366  KQLEVLEDRLDSMVQPRLTDAL  431
             ++ VLE RL+S  +P L  AL
Sbjct  188  DRIAVLESRLESAARPALLRAL  209



>gb|EFA86654.1| oligomeric Golgi complex component [Polysphondylium pallidum 
PN500]
Length=785

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 44/143 (31%), Positives = 89/143 (62%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLE  ++ +L  VP+A R++ R+R +++SL+  V  I Q +     +++++VA ++ +DT
Sbjct  82   SLENKASDSLLYVPKAVREIDRVRKESVSLKQKVKHINQTIASMHANTSDTVARISSLDT  141

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            V++R++    +L +A  L   SS ++ +F S D  + A+TL  ++  L+ + ++ EF   
Sbjct  142  VRKRIDQCIISLNEAEKLLSFSSGLDKLFQSADYLKIADTLEGVKQSLAVLSDIPEFREQ  201

Query  363  RKQLEVLEDRLDSMVQPRLTDAL  431
            ++  +  +DRL+S+V+P+L  AL
Sbjct  202  QRHFQAHQDRLESLVRPQLIGAL  224



>ref|XP_005643872.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19328.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
Length=731

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 87/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE  S  AL R+P A ++V  +R D   L++ VS  L  +  A  ++  +VA + +++ 
Sbjct  55   ALEIDSTRALQRIPAAVQEVSHVRGDVTGLKADVSRGLGTVSAAASAATGNVALIVELER  114

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RMEAA  TL++A  L+   + VE VF+ GDL R A TLA++R  L+ VG+V EF   
Sbjct  115  VKNRMEAACSTLKEATELSAHFTQVEAVFAEGDLQRIAATLASIRQGLALVGDVPEFKGG  174

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
              +L+ LE+R    ++P ++ AL+
Sbjct  175  AARLQALEERFHQNIEPAVSSALA  198



>ref|XP_637633.1| oligomeric Golgi complex component [Dictyostelium discoideum 
AX4]
 sp|Q54LC8.1|COG7_DICDI RecName: Full=Conserved oligomeric Golgi complex subunit 7; Short=COG 
complex subunit 7; AltName: Full=Component of oligomeric 
Golgi complex 7 [Dictyostelium discoideum]
 gb|EAL64108.1| oligomeric Golgi complex component [Dictyostelium discoideum 
AX4]
Length=996

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 49/146 (34%), Positives = 87/146 (60%), Gaps = 3/146 (2%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLA---K  173
            SLE +++ +L  VP++ R+V R+R ++L L++ + SI  K+ +    S +S+ T++   K
Sbjct  79   SLESITSESLLIVPKSIREVDRIRKESLHLKNRIKSISSKIGEMNNDSPQSMETVSVIEK  138

Query  174  VDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEF  353
            +D VK RME +  +L++A  L   S TV+ +FSS D    ++ L  ++  LS + +V EF
Sbjct  139  LDQVKSRMEISIRSLKEAEKLLSFSKTVDQLFSSNDYLMISDKLEEVKQSLSVLSDVPEF  198

Query  354  ANIRKQLEVLEDRLDSMVQPRLTDAL  431
                K+  V +DRL+S ++  L  +L
Sbjct  199  REQSKKFNVYQDRLESQLKQPLQQSL  224



>ref|XP_009062761.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
 gb|ESO86524.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
Length=737

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 47/143 (33%), Positives = 85/143 (59%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LEE S  AL  +PR  R++  +R +A  L+  +  + + ++K E S+A+S+  L K+D +
Sbjct  53   LEEASQQALQNLPRVMREIDAVRQEASLLQDQMRMVKEDIQKVEQSTAQSMQVLLKLDGI  112

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM+   E L++A   T LS+ VE+VF S D+    + L  M+  L  + +  ++A+  
Sbjct  113  KGRMKTTAEALKEADNWTTLSADVEEVFHSNDIQAITDKLTGMQQSLQMLVDTPDYADRC  172

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            + LE L++RL++++ P+L  A +
Sbjct  173  QHLEKLKNRLEAILSPQLIAAFN  195



>ref|XP_011299070.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Fopius arisanus]
Length=750

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 87/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S S L  +PR  RD   L+ +AL+L+  ++++ Q++ K E  +A S+  L K+  
Sbjct  65   SLEETSQSVLSSLPRILRDTQLLQQEALALKDKMATVKQEIAKVEKDTALSMTALEKMAR  124

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK  ++ A ++L +A   + L++ +E+VF SGD+ +    + +M+  LS +    ++ + 
Sbjct  125  VKTELQVAKQSLHEADNWSVLANDLEEVFESGDIEKIGGKVFSMQKSLSMLANAVDYEDK  184

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL++M  P+L  A +
Sbjct  185  KLQLEGLKNRLEAMASPKLVQAFT  208



>ref|XP_011299078.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Fopius arisanus]
Length=736

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 87/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S S L  +PR  RD   L+ +AL+L+  ++++ Q++ K E  +A S+  L K+  
Sbjct  51   SLEETSQSVLSSLPRILRDTQLLQQEALALKDKMATVKQEIAKVEKDTALSMTALEKMAR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK  ++ A ++L +A   + L++ +E+VF SGD+ +    + +M+  LS +    ++ + 
Sbjct  111  VKTELQVAKQSLHEADNWSVLANDLEEVFESGDIEKIGGKVFSMQKSLSMLANAVDYEDK  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL++M  P+L  A +
Sbjct  171  KLQLEGLKNRLEAMASPKLVQAFT  194



>ref|XP_011299085.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Fopius arisanus]
Length=698

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 87/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S S L  +PR  RD   L+ +AL+L+  ++++ Q++ K E  +A S+  L K+  
Sbjct  13   SLEETSQSVLSSLPRILRDTQLLQQEALALKDKMATVKQEIAKVEKDTALSMTALEKMAR  72

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK  ++ A ++L +A   + L++ +E+VF SGD+ +    + +M+  LS +    ++ + 
Sbjct  73   VKTELQVAKQSLHEADNWSVLANDLEEVFESGDIEKIGGKVFSMQKSLSMLANAVDYEDK  132

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL++M  P+L  A +
Sbjct  133  KLQLEGLKNRLEAMASPKLVQAFT  156



>ref|XP_011431811.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Crassostrea gigas]
Length=754

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 86/143 (60%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            +EE S  A+  +PR  R++  ++ +A  L+  +  + Q ++K E  +A+S+ TL K+D +
Sbjct  53   IEETSQQAVQNLPRVIRELDAVKQEAALLQDQMKMVKQDIQKVEHDTAKSMQTLLKLDAI  112

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM +A E L++A   T LSS VE+VF S D+      L  M++ L  + +  ++A+  
Sbjct  113  KSRMTSAAEALREADNWTTLSSDVEEVFQSQDIKAITLKLKGMQNSLLMLVDTPDYADRC  172

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            + LE L++RL++++ P+L  A +
Sbjct  173  QHLETLKNRLEAVLSPQLVQAFT  195



>gb|EKC24157.1| Conserved oligomeric Golgi complex subunit 7 [Crassostrea gigas]
Length=774

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 86/143 (60%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            +EE S  A+  +PR  R++  ++ +A  L+  +  + Q ++K E  +A+S+ TL K+D +
Sbjct  73   IEETSQQAVQNLPRVIRELDAVKQEAALLQDQMKMVKQDIQKVEHDTAKSMQTLLKLDAI  132

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM +A E L++A   T LSS VE+VF S D+      L  M++ L  + +  ++A+  
Sbjct  133  KSRMTSAAEALREADNWTTLSSDVEEVFQSQDIKAITLKLKGMQNSLLMLVDTPDYADRC  192

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            + LE L++RL++++ P+L  A +
Sbjct  193  QHLETLKNRLEAVLSPQLVQAFT  215



>ref|XP_008559723.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Microplitis 
demolitor]
Length=771

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 43/144 (30%), Positives = 87/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++E+ S S L  +PR  R+   L+ +A+SL+  +S +  ++ K E  ++ S+ +LAK+D 
Sbjct  51   NIEDTSQSVLASLPRIFRETQLLQQEAVSLKDKMSVVKDEIAKIEKDTSLSINSLAKIDK  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  +E A ++L +A   + L++ VED F +GD+   ++ + +M+  LS +    ++   
Sbjct  111  IKCDLEKAKQSLHEADNWSVLANEVEDSFETGDIEMISKKIFSMQKSLSMLTNTIDYEEK  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  P+L  A +
Sbjct  171  KLQLEGLKNRLEAIASPQLVQAFT  194



>ref|XP_008474492.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Diaphorina citri]
Length=272

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 84/144 (58%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
             LEE++   +  +PR  RD   L  +A  L+  +S++ Q++   E ++  S+A+L ++D 
Sbjct  51   GLEEMNEQVVASLPRIMRDANVLSQEAEMLQQKMSAVKQEIIDVEKNTRASMASLERIDK  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  + +A ++L +A   T +++ +E++F  GD+   A  + +M+ CL+ +    ++ + 
Sbjct  111  IKSELLSAKQSLHEADNWTLMTTDIEEIFERGDIEGIAAKIVSMQQCLAVLTHTPDYEDK  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            R QLE L+++L+++  P L  A +
Sbjct  171  RLQLETLKNQLEAIASPHLVQAFT  194



>ref|XP_007903980.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Callorhinchus milii]
Length=687

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 86/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PRA RDV  L+ +A  L+  +  + + +RK E  +A+S+  L ++D 
Sbjct  53   AIEETSHQALQNMPRALRDVEALKQEASFLKDQMILVKEDIRKFEQETAQSMQVLVEIDE  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+AA + LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++  
Sbjct  113  VKSRMQAAADALQEADKWSTLSADIEETFKTQDVATISAKLTSMQSSLAMLADTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL+++  P++  A +
Sbjct  173  CVHLEALKNRLEALASPQIVAAFN  196



>ref|XP_007903979.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Callorhinchus milii]
Length=766

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 86/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PRA RDV  L+ +A  L+  +  + + +RK E  +A+S+  L ++D 
Sbjct  53   AIEETSHQALQNMPRALRDVEALKQEASFLKDQMILVKEDIRKFEQETAQSMQVLVEIDE  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+AA + LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++  
Sbjct  113  VKSRMQAAADALQEADKWSTLSADIEETFKTQDVATISAKLTSMQSSLAMLADTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL+++  P++  A +
Sbjct  173  CVHLEALKNRLEALASPQIVAAFN  196



>ref|NP_001264493.1| conserved oligomeric Golgi complex subunit 7 [Gallus gallus]
Length=769

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 84/143 (59%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            +EE S  ALH +PR  R+V  LR +A  LR  +  + + +R+ E  +A+S+  L ++D V
Sbjct  54   VEEASQQALHSMPRVLREVEALRQEAAFLREQMVLVKEDIRRFEEDTAQSMQVLVEIDRV  113

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM+ A E+LQ+A   T LS+ +E+   + D+   A  L +M+  L+ + +  +++   
Sbjct  114  KSRMQLAAESLQEADKWTTLSADIEETLKTQDVSAIAAKLTSMQSSLAMLVDTPDYSEKC  173

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
              LE L++RL++M  P++  A +
Sbjct  174  VHLEALKNRLEAMASPQIVAAFN  196



>ref|XP_005810284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Xiphophorus maculatus]
Length=769

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 83/139 (60%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  ALH +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALHNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL++M  P++
Sbjct  173  CVHLEALKNRLEAMASPQI  191



>ref|XP_010442640.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=681

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +3

Query  312  MRHCLSAVGEVAEFANIRKQLEVLEDRLDSMVQPRLTDALS  434
            MR+CLSAVGEVAEFAN+RKQLEVLEDRL+ MVQPRLTDAL+
Sbjct  1    MRNCLSAVGEVAEFANVRKQLEVLEDRLEKMVQPRLTDALT  41



>ref|XP_008202376.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X4 [Nasonia vitripennis]
Length=698

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/144 (29%), Positives = 81/144 (56%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S + L  +P+  RD   L+ +AL+L+  + ++ ++L   E  +  S+  L K+D 
Sbjct  13   SLEETSQNVLSNMPKVLRDTQLLQQEALALKEKMQTVKKELENVEKGTTSSIQMLEKLDK  72

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K       E  +++      ++ +ED+F SGD+ + A+TL  M+  LS +    ++ + 
Sbjct  73   IKTEYINKTEGQRESDNWAAATNEIEDIFESGDVEKIADTLCGMQKSLSVLINTPDYEDK  132

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  P+L  A +
Sbjct  133  KLQLEGLKNRLEALTSPKLVQAFT  156



>ref|XP_008202373.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Nasonia vitripennis]
Length=749

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/144 (29%), Positives = 81/144 (56%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S + L  +P+  RD   L+ +AL+L+  + ++ ++L   E  +  S+  L K+D 
Sbjct  64   SLEETSQNVLSNMPKVLRDTQLLQQEALALKEKMQTVKKELENVEKGTTSSIQMLEKLDK  123

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K       E  +++      ++ +ED+F SGD+ + A+TL  M+  LS +    ++ + 
Sbjct  124  IKTEYINKTEGQRESDNWAAATNEIEDIFESGDVEKIADTLCGMQKSLSVLINTPDYEDK  183

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  P+L  A +
Sbjct  184  KLQLEGLKNRLEALTSPKLVQAFT  207



>ref|XP_008202375.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Nasonia vitripennis]
Length=706

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/144 (29%), Positives = 81/144 (56%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S + L  +P+  RD   L+ +AL+L+  + ++ ++L   E  +  S+  L K+D 
Sbjct  21   SLEETSQNVLSNMPKVLRDTQLLQQEALALKEKMQTVKKELENVEKGTTSSIQMLEKLDK  80

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K       E  +++      ++ +ED+F SGD+ + A+TL  M+  LS +    ++ + 
Sbjct  81   IKTEYINKTEGQRESDNWAAATNEIEDIFESGDVEKIADTLCGMQKSLSVLINTPDYEDK  140

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  P+L  A +
Sbjct  141  KLQLEGLKNRLEALTSPKLVQAFT  164



>ref|XP_008202374.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Nasonia vitripennis]
Length=737

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/144 (29%), Positives = 81/144 (56%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S + L  +P+  RD   L+ +AL+L+  + ++ ++L   E  +  S+  L K+D 
Sbjct  52   SLEETSQNVLSNMPKVLRDTQLLQQEALALKEKMQTVKKELENVEKGTTSSIQMLEKLDK  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K       E  +++      ++ +ED+F SGD+ + A+TL  M+  LS +    ++ + 
Sbjct  112  IKTEYINKTEGQRESDNWAAATNEIEDIFESGDVEKIADTLCGMQKSLSVLINTPDYEDK  171

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  P+L  A +
Sbjct  172  KLQLEGLKNRLEALTSPKLVQAFT  195



>ref|XP_008299300.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Stegastes 
partitus]
Length=769

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 82/139 (59%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            S+EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   SIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M++ LS + +  +++  
Sbjct  113  VKGRMQLAAEALQEADKWSTLSADIEETFKTQDLAVISSKLTSMQNSLSMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL++M  P++
Sbjct  173  CVHLEALKNRLEAMASPQI  191



>ref|XP_010717801.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Meleagris 
gallopavo]
Length=769

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 84/143 (59%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            +EE S  ALH +PR  R+V  LR +A  LR  +  + + +R+ E  +A+S+  L ++D V
Sbjct  54   VEEASQQALHSMPRVLREVEALRQEAAFLREQMVLVKEDIRRFEEDTAQSMQVLVEIDRV  113

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM+ A E+LQ+A   T LS+ +E+   + D+   +  L +M+  L+ + +  +++   
Sbjct  114  KSRMQLAAESLQEADKWTTLSADIEETLKTQDVSAISAKLTSMQSSLAMLVDTPDYSEKC  173

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
              LE L++RL++M  P++  A +
Sbjct  174  VHLEALKNRLEAMASPQIVAAFN  196



>ref|XP_002128341.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ciona 
intestinalis]
Length=765

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 79/137 (58%), Gaps = 0/137 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE+S  A+  +PR  RDV  L+ +A  L   +  + +++R  E  ++ S+  L K+D+
Sbjct  51   SLEEISQQAVGNLPRVLRDVETLKKEATFLWQQMQQVKEEIRSVEQRTSHSMEVLVKIDS  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            V+ R+E A   L++A   + L+S +ED+F SGD+   A  L +M+  L  +    ++ + 
Sbjct  111  VRSRVEQASAALKEADNWSSLASAIEDIFRSGDIEAVAAQLQSMQASLVVLRNSPDYDDK  170

Query  363  RKQLEVLEDRLDSMVQP  413
               LE L++RL++ V P
Sbjct  171  VLHLEALKNRLETAVSP  187



>ref|NP_001015714.1| component of oligomeric golgi complex 7 [Xenopus (Silurana) tropicalis]
 gb|AAH89645.1| MGC107838 protein [Xenopus (Silurana) tropicalis]
Length=768

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 87/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            S+EE+S  AL  +PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  53   SVEEISHQALQNMPRVLRDVEAVRQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEMDK  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A ++LQ+A   + LS+ +E+ F + ++   +E L +M+  L+ + +  +++  
Sbjct  113  VKSRMQLAADSLQEADKWSTLSADIEETFKTQNITVISEKLTSMQVSLTMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL++M  P++  A +
Sbjct  173  CVYLEALKNRLEAMCSPQIVAAFN  196



>ref|XP_005748533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pundamilia nyererei]
Length=769

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 84/144 (58%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++ 
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDK  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL++M  P++  A +
Sbjct  173  CVHLEALKNRLEAMASPQIVAAFN  196



>gb|ELT88100.1| hypothetical protein CAPTEDRAFT_161050 [Capitella teleta]
Length=754

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 86/143 (60%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            +EE    +++ +PR  R++  L+ +A+ L+  +  I   ++K E  +++S+ TL K+DTV
Sbjct  51   IEESCLQSVNNLPRVMRELEALKQEAVLLQDQMKMIKFDIQKVEQDTSQSMLTLLKLDTV  110

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM+ A E LQ+A   T L S ++D++ SG++   A  L  ++  L  + +V ++    
Sbjct  111  KTRMKDASEALQEADNWTSLLSGLDDIYESGNVNEIAAKLVGLQQSLLILTDVPDYEERC  170

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            + LE L++RL++++ P++  A S
Sbjct  171  QYLETLKNRLEALLSPQVVAAFS  193



>ref|XP_006892752.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elephantulus 
edwardii]
Length=770

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 85/144 (59%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S  AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  54   ALEETSHQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQ  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L+ M++ L  + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDIILISNKLSGMQNSLMMLVDTPDYSEK  173

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL+++  P +  AL+
Sbjct  174  CVHLEALKNRLEALASPHIIAALT  197



>ref|XP_007233023.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Astyanax mexicanus]
Length=545

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 84/144 (58%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            S+EE S  AL  +PR  RD+  L+ +A  L+  ++ + + ++K E  + +S+  L ++D 
Sbjct  53   SIEESSIQALQNMPRVLRDIEALKQEASFLKDQMTMVKEDIKKFEQDTLQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D+   +  LA M+  L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDVAVISSKLAAMQSSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
              QLE L++RL+++  P++    +
Sbjct  173  CVQLEALKNRLEALASPQIVSTFN  196



>ref|XP_004080382.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oryzias 
latipes]
Length=769

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 81/139 (58%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEAFFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDK  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDFALISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL++M  P++
Sbjct  173  CVHLEALKNRLEAMASPQI  191



>ref|XP_011372750.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Pteropus 
vampyrus]
Length=834

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 85/144 (59%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  LR +A  LR  +  + + +RK E  +++S+  L  +D 
Sbjct  81   AVEETSLQALQNMPRVLRDVEALRQEASFLREQMVLVKEDIRKFEQDTSQSMQVLVDIDQ  140

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A ++LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + + A+++  
Sbjct  141  VKSRMQLAAQSLQEADKWSTLSADIEETFKTQDVAVISAKLTGMQNSLAMLVDTADYSEK  200

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL+++  P++  A +
Sbjct  201  CVYLEALKNRLEALASPQIVAAFT  224



>ref|XP_004571418.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Maylandia zebra]
Length=769

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 82/139 (59%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++ 
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL++M  P++
Sbjct  173  CVHLEALKNRLEAMASPQI  191



>ref|XP_006808092.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Neolamprologus brichardi]
Length=769

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 82/139 (59%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++ 
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL++M  P++
Sbjct  173  CVHLEALKNRLEAMASPQI  191



>ref|XP_002711891.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oryctolagus 
cuniculus]
Length=847

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 85/144 (59%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D 
Sbjct  131  AVEETSHQALQNMPRVLRDVEALKQEASFLKEQMILVKEDIRKFEQDTSQSMQVLVEIDQ  190

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++  
Sbjct  191  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLAMLVDTPDYSEK  250

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL+++  P++  A +
Sbjct  251  CVHLEALKNRLEALASPQIVAAFT  274



>ref|XP_003438511.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oreochromis 
niloticus]
Length=769

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 82/139 (59%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++ 
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL++M  P++
Sbjct  173  CVHLEALKNRLEAMASPQI  191



>ref|XP_010621761.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Fukomys 
damarensis]
 gb|KFO33512.1| Conserved oligomeric Golgi complex subunit 7 [Fukomys damarensis]
Length=770

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 86/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE+S  AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D 
Sbjct  54   AVEEMSHQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQ  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLTMLVDTPDYSEK  173

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL+++  P++  A +
Sbjct  174  CVHLEALKNRLEALASPQIVAAFT  197



>ref|XP_008434639.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Poecilia 
reticulata]
Length=769

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 82/139 (59%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL++M  P++
Sbjct  173  CVHLEALKNRLEAMASPQI  191



>ref|NP_001085832.1| component of oligomeric golgi complex 7 [Xenopus laevis]
 gb|AAH73403.1| MGC80865 protein [Xenopus laevis]
Length=768

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 86/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            S+EE+S  AL  +PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  53   SVEEISHQALQNMPRVLRDVEAVRQEASFLKEQMILVKEDIKKFEQDTAQSMHVLVEMDK  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+   + ++   +E L +M+  L+ + +  +++  
Sbjct  113  VKSRMQLAAESLQEADKWSTLSADIEETLKTQNISVISEKLTSMQVSLTMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL++M  P++  A +
Sbjct  173  CVYLEALKNRLEAMCSPQIVAAFN  196



>ref|XP_007571524.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 82/139 (59%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL++M  P++
Sbjct  173  CVHLEALKNRLEAMASPQI  191



>ref|XP_007571519.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 82/139 (59%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL++M  P++
Sbjct  173  CVHLEALKNRLEAMASPQI  191



>ref|XP_007058642.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chelonia 
mydas]
 gb|EMP36935.1| Conserved oligomeric Golgi complex subunit 7 [Chelonia mydas]
Length=770

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 84/139 (60%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  54   AVEETSHQALQNMPRVLRDVEALKQEATFLKEQMVLVKEDIKKFEEDTAQSMQVLVELDR  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L +M++ L+ + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDVSVISAKLTSMQNSLAMLVDTPDYSEK  173

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL++M  P++
Sbjct  174  CVHLEALKNRLEAMASPQI  192



>ref|XP_005288959.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysemys 
picta bellii]
Length=770

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 83/139 (60%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  54   AVEETSHQALQNMPRVLRDVEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVELDR  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDVSVISAKLTGMQNSLAMLVDTPDYSEK  173

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL++M  P++
Sbjct  174  CVHLEALKNRLEAMASPQI  192



>ref|XP_004604166.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sorex 
araneus]
Length=770

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 85/144 (59%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +P+  RDV  L+ +A  L+  ++ + + +RK E  +++S+  L ++D 
Sbjct  54   AVEETSHQALQNMPKVLRDVEALKQEASFLKEQMTLVKEDIRKFEQDTSQSMKVLVEIDQ  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDIAVISAKLIGMQNSLAMLVDTPDYSEK  173

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL++   P++  A +
Sbjct  174  CVHLEALKNRLEAFASPQIIAAFN  197



>emb|CAG04322.1| unnamed protein product [Tetraodon nigroviridis]
Length=470

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 82/144 (57%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +P+  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D 
Sbjct  53   AIEETSNQALQNMPKVLRDVESLKQEASFLKDQMVLVKEDIRKFEQDTVQSMQVLVEIDK  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M+  L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDLALISSKLTSMQSSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL+++  P++    +
Sbjct  173  CVHLEALKNRLEALASPQIVGTFN  196



>ref|XP_003961343.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Takifugu rubripes]
Length=769

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 81/139 (58%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D 
Sbjct  53   AIEETSNQALQNMPRVLRDVESLKQEASFLKDQMVLVKEDIRKFEQDTVQSMQVLVEIDK  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M+  L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDLAIISSKLTSMQSSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL+++  P++
Sbjct  173  CVHLEALKNRLEALASPQI  191



>emb|CBN81326.1| Conserved oligomeric Golgi complex subunit 7 [Dicentrarchus labrax]
Length=445

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 82/139 (59%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++  
Sbjct  113  VKGRMQLAAEALQEADKWSTLSADIEETFKTQDLAVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL+++  P++
Sbjct  173  CVHLEALKNRLEALASPQI  191



>ref|XP_007516677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Erinaceus 
europaeus]
Length=759

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 84/144 (58%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +P+  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D 
Sbjct  53   AVEETSHQALQNMPKVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTSQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++  
Sbjct  113  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDIGVISAKLTGMQNSLAMLVDTPQYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL+++  P +  A +
Sbjct  173  CVHLEALKNRLEALASPHIVAAFA  196



>ref|XP_005935571.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Haplochromis burtoni]
Length=769

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 81/139 (58%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D    +  L +M+  L+ + +  ++++ 
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQSSLAMLVDTPDYSDK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL++M  P++
Sbjct  173  CVHLEALKNRLEAMASPQI  191



>ref|XP_007951381.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orycteropus 
afer afer]
Length=731

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 83/144 (58%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  54   AVEETSHLALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTAQSMQVLVEIDQ  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + DL   +  L  M++ L  + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDLAVISAKLTGMQNSLMMLVDTPDYSEK  173

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL+++  P++    S
Sbjct  174  CVHLEALKNRLEALASPQIVAVFS  197



>ref|XP_004360949.1| oligomeric Golgi complex component [Dictyostelium fasciculatum]
 gb|EGG23098.1| oligomeric Golgi complex component [Dictyostelium fasciculatum]
Length=861

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 41/145 (28%), Positives = 84/145 (58%), Gaps = 1/145 (1%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAES-VATLAKVD  179
            SLE  S+ +L  VP+A R++ ++R ++L L++ + SI Q +     +S  + V T+A +D
Sbjct  78   SLENRSSESLLYVPKAVREIDKVRKESLQLKTRIKSITQSIDSMYSNSLHTAVDTIASLD  137

Query  180  TVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFAN  359
            TV+ R+++   +L +A  L   S+ ++ +F++ +    A+ L  ++  L  + ++ EF  
Sbjct  138  TVRTRIDSCIRSLNEAEKLLHFSAQLDQLFAAAEYLAIAQRLDEIKTSLQLLSDIPEFRE  197

Query  360  IRKQLEVLEDRLDSMVQPRLTDALS  434
              KQ  +  DRL++ ++P L  +L+
Sbjct  198  QSKQFAIYTDRLETSIKPLLVQSLN  222



>ref|XP_006637161.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Lepisosteus oculatus]
Length=728

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 80/139 (58%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M   L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDLSVISSKLTSMTSSLAMLADTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL+++  P++
Sbjct  173  CVHLEALKNRLEALASPQI  191



>ref|XP_010791235.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Notothenia 
coriiceps]
Length=769

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 82/139 (59%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D+   +  L +M++ L+ + +  +++  
Sbjct  113  VKGRMQLAAEALQEADKWSTLSADIEETFKTQDMAVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL+++  P++
Sbjct  173  CVHLEALKNRLEALASPQI  191



>ref|XP_004706118.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Echinops 
telfairi]
Length=770

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 82/139 (59%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  54   AVEETSHQALQNMPRVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQ  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEK  173

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL+++  P++
Sbjct  174  CVHLEALKNRLEALASPQI  192



>gb|KFO84349.1| Conserved oligomeric Golgi complex subunit 7, partial [Buceros 
rhinoceros silvestris]
Length=697

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 82/141 (58%), Gaps = 0/141 (0%)
 Frame = +3

Query  12   ELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKR  191
            E S  AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK 
Sbjct  5    ETSHQALQNMPRVLREVEVLKQEATFLKEQMVLVKEDIKKFEEDTAQSMQVLVEIDRVKS  64

Query  192  RMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQ  371
            RM+ A E+LQ+A   + LS+ +E+   + D+P  +  L +M+  L+ + +  +++     
Sbjct  65   RMQLAAESLQEADKWSTLSADIEETLKTQDVPVISAKLTSMQSSLAMLVDTPDYSEKCVH  124

Query  372  LEVLEDRLDSMVQPRLTDALS  434
            LE L++RL++M  P++  A +
Sbjct  125  LEALKNRLEAMASPQIVAAFN  145



>ref|XP_005351192.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Microtus 
ochrogaster]
Length=770

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 84/144 (58%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +P+  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D 
Sbjct  54   AVEETSLQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIRKFEQDTSQSMQVLVEIDQ  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDVAVISAKLTGMQNSLVMLVDTPDYSEK  173

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL+++  P++  A +
Sbjct  174  CVHLEALKNRLEALASPQIVAAFT  197



>ref|XP_003285944.1| hypothetical protein DICPUDRAFT_15317 [Dictyostelium purpureum]
 gb|EGC37553.1| hypothetical protein DICPUDRAFT_15317 [Dictyostelium purpureum]
Length=919

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/134 (31%), Positives = 75/134 (56%), Gaps = 3/134 (2%)
 Frame = +3

Query  39   VPRATRDVIRLRDDALSLRSS---VSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  209
            VP+A R++ R+R + +++++    +SS + +L      S + V+ + K D +K RME++ 
Sbjct  109  VPKAIREIDRIRKEIINIKNKMKLISSKIDELNAQSPQSTQVVSLIQKYDQIKSRMESSM  168

Query  210  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLED  389
             +LQ+A  L   SS V+ +FS+ D    +  L   +  LS + +V EF    K+    +D
Sbjct  169  RSLQEAEKLLSFSSQVDQLFSTNDFLVISNKLEEAKQSLSVLSDVPEFREQSKKFNEYQD  228

Query  390  RLDSMVQPRLTDAL  431
            RL+S ++P L  +L
Sbjct  229  RLESQLRPLLQSSL  242



>ref|XP_006027196.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Alligator 
sinensis]
Length=769

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 83/139 (60%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RD+  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  53   AVEETSHQALQNMPRVLRDMEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDR  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++  
Sbjct  113  VKSRMQLASESLQEADKWSTLSADIEETFKTQDVSVISAKLTSMQSSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL+++  P++
Sbjct  173  CVHLEALKNRLEALASPQI  191



>ref|XP_006268482.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Alligator mississippiensis]
Length=771

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 83/139 (60%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RD+  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  53   AVEETSHQALQNMPRVLRDMEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDR  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++  
Sbjct  113  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDVSVISAKLTSMQSSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL+++  P++
Sbjct  173  CVHLEALKNRLEALASPQI  191



>ref|XP_010731365.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Larimichthys crocea]
Length=769

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 81/139 (58%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM  A + LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++  
Sbjct  113  VKSRMHLAADALQEADKWSTLSADIEETFKTQDLAVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL+++  P++
Sbjct  173  CVHLEALKNRLEALASPQI  191



>ref|XP_010903275.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903283.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903290.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
Length=768

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 80/139 (58%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D 
Sbjct  52   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVELDQ  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM  A + LQ+A   + LS+ +E+ F + DL   +  L  M++ L+ + +  +++  
Sbjct  112  VKSRMHLAADALQEADKWSTLSADIEETFKTQDLAVISSKLTAMQNSLAMLVDTPDYSEK  171

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL+++  P++
Sbjct  172  CVHLEALKNRLEALASPQI  190



>ref|XP_005105726.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Aplysia californica]
Length=750

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 84/143 (59%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LEE S  AL  +PR  R++  ++ ++  L+  +  + Q ++K E  +++S+ +L K+D +
Sbjct  53   LEEASQQALQNLPRVVRELDAIKQESSLLQDQMRIVKQDIQKVEQDTSQSMQSLLKLDRI  112

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM+   + L++A   T LS+ +++VF S ++      L+ M+  L  + +  ++ +  
Sbjct  113  KSRMKTTADALKEADNWTTLSADMDEVFQSQNVDDITAKLSGMQQSLHMLADTPDYVDKC  172

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            + LE L++RL++++ P+L  A +
Sbjct  173  QHLEKLKNRLEALLSPQLIAAFN  195



>ref|XP_004586873.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ochotona 
princeps]
Length=771

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/144 (28%), Positives = 83/144 (58%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +P+   D+  L+ +A  L+  +  + + ++K E  +++S+  L ++D 
Sbjct  55   AVEETSHQALQNMPKVLCDIEALKQEASFLKEQMILVKEDIQKFEQDTSQSMQVLVEIDQ  114

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +ED F + D+   +  L  M++ L  + +  +++  
Sbjct  115  VKSRMQLAAESLQEADKWSTLSADIEDTFKTQDVAVISAKLTGMQNSLVMLVDTPDYSEK  174

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL+++  P++  A +
Sbjct  175  CVHLEALKNRLEALASPQIIAAFT  198



>emb|CDQ66102.1| unnamed protein product [Oncorhynchus mykiss]
Length=768

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 80/139 (58%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D 
Sbjct  52   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVELDQ  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM  A + LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++  
Sbjct  112  VKSRMHLASDALQEADKWSTLSADIEETFKTQDMAVISSKLTAMQNSLAMLVDTPDYSEK  171

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL+++  P++
Sbjct  172  CVHLEALKNRLEALASPQI  190



>ref|NP_001070861.1| conserved oligomeric Golgi complex subunit 7 [Danio rerio]
 gb|AAI24681.1| Component of oligomeric golgi complex 7 [Danio rerio]
 gb|AAI24605.1| Component of oligomeric golgi complex 7 [Danio rerio]
Length=767

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 81/144 (56%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            S+EE S  AL  +PR  RD+  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   SIEESSNQALQNMPRVLRDIEALKQEASFLKDQMILVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D+   +  L  M+  L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDVAVISSKLTAMQGSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
              QLE L++RL+++   ++    +
Sbjct  173  CVQLEALKNRLEALTSTQIVSTFN  196



>ref|XP_008312851.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cynoglossus 
semilaevis]
Length=769

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 81/144 (56%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  ++ +A  L+  +  + + ++K E  +  S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVDAVKQEASFLKEQMVLVKEDIQKFEQDTVRSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K RM+ A + LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  +++  
Sbjct  113  IKSRMQVAADALQEADKWSTLSADIEETFKTQDFAVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
               LE L++RL+++  P++    +
Sbjct  173  CVHLEALKNRLEALASPQIVGTFN  196



>ref|XP_005825555.1| oligomeric Golgi complex subunit 7 [Guillardia theta CCMP2712]
 gb|EKX38575.1| oligomeric Golgi complex subunit 7 [Guillardia theta CCMP2712]
Length=842

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 78/143 (55%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            S+++ +   L  +P+A  D+ R+  DA  L   ++ +L K+ + E S  ++VA LA +D 
Sbjct  86   SIDDSAVKLLSELPKAMIDIQRVGSDAELLAHQMAQVLDKVSEVERSGQQTVAALATLDA  145

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K RME     L +A  LT+  + +E +F   +L + A  L ++R  L A+G + EF+  
Sbjct  146  IKTRMEECAHALGEADNLTRTLAQIEPLFQVDELKQIAARLGSLRRSLQAMGNLEEFSEA  205

Query  363  RKQLEVLEDRLDSMVQPRLTDAL  431
               L+  EDRL+  +  +L + +
Sbjct  206  ANTLKSYEDRLEKRMSSKLKEGI  228



>ref|XP_006125865.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Pelodiscus sinensis]
Length=700

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = +3

Query  39   VPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETL  218
            +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A E+L
Sbjct  1    MPRVLRDVEALKQEATFLKEQMILVKEDIKKFEEDTAQSMKVLVELDQVKSRMQLAAESL  60

Query  219  QDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRLD  398
            Q+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE L++RL+
Sbjct  61   QEADKWSTLSADIEETFKTQDVSVISAKLTGMQNSLAMLVDTPDYSEKCVHLEALKNRLE  120

Query  399  SMVQPRL  419
            +M  P++
Sbjct  121  AMASPQI  127



>ref|XP_010144199.1| PREDICTED: conserved oligomeric Golgi complex subunit 7, partial 
[Buceros rhinoceros silvestris]
Length=703

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 78/132 (59%), Gaps = 0/132 (0%)
 Frame = +3

Query  39   VPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETL  218
            +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A E+L
Sbjct  1    MPRVLREVEVLKQEATFLKEQMVLVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLAAESL  60

Query  219  QDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRLD  398
            Q+A   + LS+ +E+   + D+P  +  L +M+  L+ + +  +++     LE L++RL+
Sbjct  61   QEADKWSTLSADIEETLKTQDVPVISAKLTSMQSSLAMLVDTPDYSEKCVHLEALKNRLE  120

Query  399  SMVQPRLTDALS  434
            +M  P++  A +
Sbjct  121  AMASPQIVAAFN  132



>ref|XP_974190.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tribolium 
castaneum]
Length=726

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 37/144 (26%), Positives = 80/144 (56%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE+ S   L  +P+  RD   L  +A  L+  ++++  ++ K E  + +S+ T+ K+DT
Sbjct  51   ALEDTSQQILMSLPKIIRDTKNLNQEAAILKEKMAAVRSEIVKIEQDTGKSINTIEKLDT  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  +  A + L ++   T L + +E+VF S ++   +  +  M+  L  +  V+++ + 
Sbjct  111  IKNELNMAKQGLHESDNWTILVNDLEEVFDSKNIENISAKIIGMQRSLQLLVNVSDYEDR  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  P +  A +
Sbjct  171  KLQLEGLKNRLEAIASPAIVQAFT  194



>ref|XP_002407978.1| conserved oligomeric golgi complex subunit, putative [Ixodes 
scapularis]
 gb|EEC12391.1| conserved oligomeric golgi complex subunit, putative [Ixodes 
scapularis]
Length=749

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 84/144 (58%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE+ +      +P+  RDV  ++ +A  L+  ++++ + + K E  S+ S+ TL ++DT
Sbjct  51   ALEDTAQQVQQNLPKVLRDVETMQQEAALLKLQMAAVQKDIAKVEQDSSTSMKTLLELDT  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K RM  A + L++A   T LS+ V+ VF SGD+      L  ++  L  + +V +F + 
Sbjct  111  IKLRMLEANQALREADNWTTLSADVDQVFQSGDVQAITARLVGLQTSLEILVDVPDFEHR  170

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
             ++LE L+++L++M+  +L  A +
Sbjct  171  LQRLESLKNQLEAMLSTQLVQAFT  194



>ref|XP_011502446.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ceratosolen 
solmsi marchali]
Length=734

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/144 (27%), Positives = 81/144 (56%), Gaps = 1/144 (1%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE + + L  +P+  RD   L+ +A +L++ + ++  +L   +  ++ S+  L K+D 
Sbjct  51   SLEETNQNVLSNMPKVLRDTQLLQQEAQALKNKMQTVRMELENVKKDTS-SIYVLMKLDK  109

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K +  +    + +    + L   ++ VF S +    A+TL +M+  LS++ +  +F N 
Sbjct  110  LKAQTISNATCINEDNTWSILIHDIDSVFESENEETIAKTLYSMKQSLSSLNDSTDFKNK  169

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+ M++P+L  A +
Sbjct  170  KSQLEELKNRLEIMIRPKLMQAFT  193



>gb|EXX54575.1| hypothetical protein RirG_233350 [Rhizophagus irregularis DAOM 
197198w]
Length=994

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 41/143 (29%), Positives = 73/143 (51%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE         +PR   D+  +++DA  L+S VS +  +L   E  + +++  L  +D V
Sbjct  107  LERTVEDVTKSMPRIITDLQVMQEDATKLKSGVSLVKSQLNNVEEGTEKALDRLKYLDLV  166

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RMEA+ + L++A   + L     ++F+S D  +A+  L      L       E+   R
Sbjct  167  KTRMEASRDVLKEAENWSNLEQEASNIFASQDYQKASARLMEAEKSLVIFQNTPEYEERR  226

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            K L  L+++L++ V P+L +AL+
Sbjct  227  KLLTELQNQLEATVSPQLVNALN  249



>gb|ESA17025.1| hypothetical protein GLOINDRAFT_345271 [Rhizophagus irregularis 
DAOM 181602]
Length=925

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 41/143 (29%), Positives = 73/143 (51%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE         +PR   D+  +++DA  L+S VS +  +L   E  + +++  L  +D V
Sbjct  107  LERTVEDVTKSMPRIITDLQVMQEDATKLKSGVSLVKSQLNNVEEGTEKALDRLKYLDLV  166

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RMEA+ + L++A   + L     ++F+S D  +A+  L      L       E+   R
Sbjct  167  KTRMEASRDVLKEAENWSNLEQEASNIFASQDYQKASARLMEAEKSLVIFQNTPEYEERR  226

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
            K L  L+++L++ V P+L +AL+
Sbjct  227  KLLTELQNQLEATVSPQLVNALN  249



>dbj|GAM17697.1| hypothetical protein SAMD00019534_008720 [Acytostelium subglobosum 
LB1]
Length=735

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/98 (33%), Positives = 62/98 (63%), Gaps = 0/98 (0%)
 Frame = +3

Query  141  SSAESVATLAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRH  320
            S++ +VA ++ +DTV++R++    +L +A  L   SS+++ +F S D  + AETL  ++ 
Sbjct  4    STSATVANVSALDTVRKRIDLCIRSLNEAEKLLTFSSSIDQLFQSTDYLKIAETLEGVKQ  63

Query  321  CLSAVGEVAEFANIRKQLEVLEDRLDSMVQPRLTDALS  434
             LS + ++ EF    K  +  +DRL+ +++P+LT AL+
Sbjct  64   SLSVLSDIPEFREQAKHFQQHQDRLEQLIRPQLTAALT  101



>ref|XP_010731364.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Larimichthys crocea]
Length=705

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = +3

Query  39   VPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETL  218
            +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM  A + L
Sbjct  1    MPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMHLAADAL  60

Query  219  QDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRLD  398
            Q+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++     LE L++RL+
Sbjct  61   QEADKWSTLSADIEETFKTQDLAVISSKLTSMQNSLAMLVDTPDYSEKCVHLEALKNRLE  120

Query  399  SMVQPRL  419
            ++  P++
Sbjct  121  ALASPQI  127



>gb|KFM79728.1| Conserved oligomeric Golgi complex subunit 7, partial [Stegodyphus 
mimosarum]
Length=159

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 64/108 (59%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLE+ +      +PR  R++  ++++A  L+  +SS+   + K E  +++++ TL K+D 
Sbjct  51   SLEKTAEQVNQNIPRIAREIEVMQNEAKLLQHQMSSVKGDVMKVEHDASQAMQTLLKIDH  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCL  326
            VK  M+ A + L++A   T LS+ VE++F SGD+   A  L  M++ L
Sbjct  111  VKSCMQEASKALREADNWTTLSADVEEIFDSGDINAIAMKLVGMQNSL  158



>gb|ERL93874.1| hypothetical protein D910_11160 [Dendroctonus ponderosae]
Length=663

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 37/144 (26%), Positives = 79/144 (55%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLE  S   L  +P+   D   L+ +AL L+  +  + +++ + E  + +S+ T+ K+D 
Sbjct  17   SLENSSQQVLASLPKIMHDAKILQQEALVLKEKMGQVKEEIVQIEQDTRKSINTIEKLDE  76

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K ++  A + L ++   T L + +E++F S ++   +  +  M+  L  +  VA+F + 
Sbjct  77   MKNQLTIAKQGLHESDNWTVLVNDLEEIFDSKNIEAISSKILGMQSSLKLLVNVADFEDR  136

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  P +  A +
Sbjct  137  KLQLEGLKNRLEAIASPVIVQAFT  160



>gb|KJE94721.1| hypothetical protein CAOG_009840 [Capsaspora owczarzaki ATCC 
30864]
Length=1209

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 81/178 (46%), Gaps = 34/178 (19%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLE+     +  +PR  RD+  +R +A++LR  + ++   L+  E  +  S+  L +VD 
Sbjct  432  SLEDAGQRVIQAMPRTLRDIDTIRVEAIALRERMGTVASDLQAVESGTYASMKVLLEVDA  491

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVG--------  338
            V+ RMEAA  +L+ A     L++ V+ + +SGD+    + L  MR CLS++G        
Sbjct  492  VRDRMEAATVSLRQAGTWATLAAEVDTMLTSGDVAAVRQHLHEMRLCLSSMGADKSWQTA  551

Query  339  --------------------------EVAEFANIRKQLEVLEDRLDSMVQPRLTDALS  434
                                      + AE    R  +   EDR ++ + PRL  AL+
Sbjct  552  SGATAGSSAATPSKPAAAAAEKQDAAQKAELDGKRALMRSCEDRFEARIAPRLFQALN  609



>ref|XP_004347003.2| hypothetical protein CAOG_05318 [Capsaspora owczarzaki ATCC 30864]
Length=1021

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 81/178 (46%), Gaps = 34/178 (19%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLE+     +  +PR  RD+  +R +A++LR  + ++   L+  E  +  S+  L +VD 
Sbjct  97   SLEDAGQRVIQAMPRTLRDIDTIRVEAIALRERMGTVASDLQAVESGTYASMKVLLEVDA  156

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVG--------  338
            V+ RMEAA  +L+ A     L++ V+ + +SGD+    + L  MR CLS++G        
Sbjct  157  VRDRMEAATVSLRQAGTWATLAAEVDTMLTSGDVAAVRQHLHEMRLCLSSMGADKSWQTA  216

Query  339  --------------------------EVAEFANIRKQLEVLEDRLDSMVQPRLTDALS  434
                                      + AE    R  +   EDR ++ + PRL  AL+
Sbjct  217  SGATAGSSAATPSKPAAAAAEKQDAAQKAELDGKRALMRSCEDRFEARIAPRLFQALN  274



>ref|XP_006003103.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Latimeria chalumnae]
 ref|XP_006003104.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Latimeria chalumnae]
 ref|XP_006003105.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Latimeria chalumnae]
Length=769

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 83/139 (60%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMILVEEDIKKFEQDTAQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+AA E LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++  
Sbjct  113  VKARMQAAAEALQEADKWSTLSAEIEETFKTQDIALISTRLTSMQSSLAMLVDTPDYSEK  172

Query  363  RKQLEVLEDRLDSMVQPRL  419
               LE L++RL++M  P++
Sbjct  173  CVHLEALKNRLEAMASPQI  191



>ref|XP_002058398.1| GJ14333 [Drosophila virilis]
 gb|EDW58366.1| GJ14333 [Drosophila virilis]
Length=751

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 80/144 (56%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +PR  ++   L+ D  +L+  +S++ Q++   +  + + +ATL +++T
Sbjct  57   AVEESSQQVVASMPRIAKEATTLQCDVAALQQKMSAMRQEVAAVQEETGDCMATLERLNT  116

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            ++ +++AA E+LQ++ G   L + +ED F   D+    + L  ++  L A  ++   A  
Sbjct  117  LQTKLQAAKESLQESDGWGNLLAELEDCFERNDMKGVCDKLTALQKSLQAQEQLPGHAER  176

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + Q+E  ++RL++M  P L    +
Sbjct  177  QTQVEDFKNRLEAMASPSLVQCFA  200



>gb|EHJ78638.1| putative component of oligomeric golgi complex 7 [Danaus plexippus]
Length=668

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 80/151 (53%), Gaps = 8/151 (5%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E +   +  +PR  ++   L+ +A  L+  + S+ Q ++  E  +  S+ +L K+D 
Sbjct  56   SLDETATQIVSSIPRTLQEASSLQLEAALLQEQLKSLEQNVQGVEEQTGHSIKSLQKIDQ  115

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLAN-------MRHCLSAVGE  341
            +K R+E A  +L++A     L+ ++ED   SG +P   E LA        M   L A+ +
Sbjct  116  LKTRLENAASSLREADKWVALAQSLEDTLDSG-VPTNKEKLATLAEQVHAMTTSLEALSD  174

Query  342  VAEFANIRKQLEVLEDRLDSMVQPRLTDALS  434
             AE+ + R QL  L +RL++ + P   +AL+
Sbjct  175  SAEYESKRLQLTTLYNRLEAAISPPFMEALT  205



>gb|EEZ99445.1| hypothetical protein TcasGA2_TC030721, partial [Tribolium castaneum]
Length=695

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 36/144 (25%), Positives = 78/144 (54%), Gaps = 3/144 (2%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE+ S   L  +P+  RD   L  +A  L+  ++++  ++ K E  + +S+ T+ K+DT
Sbjct  41   ALEDTSQQILMSLPKIIRDTKNLNQEAAILKEKMAAVRSEIVKIEQDTGKSINTIEKLDT  100

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  +  A + L ++   T L    ++VF S ++   +  +  M+  L  +  V+++ + 
Sbjct  101  IKNELNMAKQGLHESDNWTILG---KEVFDSKNIENISAKIIGMQRSLQLLVNVSDYEDR  157

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + QLE L++RL+++  P +  A +
Sbjct  158  KLQLEGLKNRLEAIASPAIVQAFT  181



>ref|XP_001993908.1| GH22206 [Drosophila grimshawi]
 gb|EDV94644.1| GH22206 [Drosophila grimshawi]
Length=766

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/144 (26%), Positives = 79/144 (55%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +PR +++   L+ D   L+  +S++ Q++   +  +   +ATL +++T
Sbjct  65   AVEESSQQVVASMPRISKEAATLQSDVAMLQQKMSAMRQEVAAVQEETGGCMATLERLNT  124

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            ++ +++AA E+LQ++ G   L + +ED F   DL    + L  ++  L A  ++   A  
Sbjct  125  LQSKLQAAKESLQESDGWGNLLAELEDCFERNDLKGVCDKLTALQKSLQAQEQLPGHAER  184

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + Q+E  ++RL++M  P L    +
Sbjct  185  QTQVEDFKNRLEAMASPSLVQCFA  208



>ref|XP_001357618.1| GA15960 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002020468.1| GL13495 [Drosophila persimilis]
 gb|EAL26752.1| GA15960 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW39280.1| GL13495 [Drosophila persimilis]
Length=742

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/144 (26%), Positives = 77/144 (53%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +PR  ++   L  D   L+  +S++ Q++   +  + E +ATL +++T
Sbjct  56   AVEESSRQVVSSMPRIAKESTTLHSDVSQLQEKMSAMRQEVAAVQNETGECMATLERLNT  115

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            ++ +++AA E+LQ++ G   L + +ED F   DL    E L  ++  L A  ++   A  
Sbjct  116  LQTKLQAAKESLQESDGWGNLLAELEDGFERNDLKGVCEKLIALQKSLHAQEQLPGHAER  175

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
              Q+E  ++RL+++  P +    +
Sbjct  176  LTQVEDFKNRLEALASPSVVQCFA  199



>ref|XP_002109935.1| hypothetical protein TRIADDRAFT_53345 [Trichoplax adhaerens]
 gb|EDV28101.1| hypothetical protein TRIADDRAFT_53345 [Trichoplax adhaerens]
Length=710

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 77/144 (53%), Gaps = 12/144 (8%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S   +  +PR  R++  +  +   L+  ++S+   + K E  ++ES+  L ++D+
Sbjct  58   TLEEESQQMVQNLPRVLREIEGVYKETTLLKDQMNSVKNDIEKVEIETSESMKMLVELDS  117

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K RM+AA   +Q+A   + L S V+ +   GD+   AE L            + ++   
Sbjct  118  IKSRMQAASNVIQEADNWSVLVSDVDGICKRGDI--DAEVL----------NYLPDYEKR  165

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            ++ LE L+D+L+++V P+L  A +
Sbjct  166  KQTLEKLKDKLEALVSPKLIAAFN  189



>ref|XP_002073360.1| GK14089 [Drosophila willistoni]
 gb|EDW84346.1| GK14089 [Drosophila willistoni]
Length=736

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/144 (26%), Positives = 78/144 (54%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +PR  ++   L+ D   L+  + ++ Q++   +  + E +ATL +++T
Sbjct  58   AVEESSQQVVSSMPRIAKEAATLQRDVQELQEKMLAMRQEVAAVQDETGECMATLERLNT  117

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            ++ +++AA E+LQ++ G   L + +ED F   DL    E L  ++  L A  ++A  A  
Sbjct  118  LQSKLQAAKESLQESDGWGNLLAELEDGFERNDLKGICEKLTALQKSLQAQEQLAGHAER  177

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
              Q+E  ++RL+++  P +    +
Sbjct  178  LTQVEDFKNRLEALASPNVVQCFA  201



>ref|XP_005188405.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Musca 
domestica]
Length=751

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 77/144 (53%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +P+  +DV  L  D  SL+  +  + Q++   +  + E +ATL K+++
Sbjct  63   AVEESSQQLVANLPKIVKDVKSLHADVRSLQGRMLEMRQEVAAVQEETGECMATLEKLNS  122

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
             + +++ A E+LQ++ G   L S +ED F   DL    + ++ ++  L+A  ++      
Sbjct  123  KQIKLQTAKESLQESDGWGNLLSQLEDSFEKNDLKSVCDKISALQKSLAAQEQLPGHEER  182

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + Q+E  ++RL+++  P L    +
Sbjct  183  KSQVEDFKNRLEALASPSLVQCFA  206



>ref|XP_009024750.1| hypothetical protein HELRODRAFT_178406 [Helobdella robusta]
 gb|ESN97278.1| hypothetical protein HELRODRAFT_178406 [Helobdella robusta]
Length=573

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 73/133 (55%), Gaps = 12/133 (9%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            +E+    A++ +PR T+++  +R +A  L+  +      ++K E  +A S+  L  +D V
Sbjct  51   IEDGCQQAINNLPRVTKELEAVRQEASLLQEQMKMAKYDIQKVEHDTANSMQNLMMLDQV  110

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM+ A + L++A   T LSS V++VF S DL   A  L N          V ++ +  
Sbjct  111  KSRMKLASDALKEADNWTTLSSDVDEVFDSQDL--EAHILTN----------VPDYTDRC  158

Query  366  KQLEVLEDRLDSM  404
            + LE+L++RL++M
Sbjct  159  QYLEMLKNRLEAM  171



>ref|XP_002001440.1| GI21972 [Drosophila mojavensis]
 gb|EDW16901.1| GI21972 [Drosophila mojavensis]
Length=754

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 78/144 (54%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +PR  ++   L+ D   L+  +S++ Q++   +  + + +ATL ++++
Sbjct  58   AVEESSQQVVASMPRIAKEAATLQCDVALLQQKMSAMRQEVAAVQEETGDCMATLERLNS  117

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            ++ +++AA E+LQ++ G   L S +ED F   D+    + L  ++  L A  ++      
Sbjct  118  LQSKLQAAKESLQESDGWGNLLSELEDCFERNDMKGVCDKLRALQKSLQAQEQLPGHTER  177

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + Q+E  ++RL++M  P L    +
Sbjct  178  QTQVEDFKNRLEAMASPSLVQCFA  201



>ref|XP_011207193.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Bactrocera 
dorsalis]
Length=754

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/144 (21%), Positives = 77/144 (53%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE     +  +PR  ++ + L+ +   L+  + ++ +++   +  + + +ATL +++T
Sbjct  67   AVEETGQKLVSGMPRVIKESLLLQAEVEELKKRMQAMRKEMTDVQEETGDCMATLERLNT  126

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            ++ +++ A E+LQ++ G   L S +ED F   ++  A E L +++  L    ++   A  
Sbjct  127  IQSKLQKAKESLQESDGWGNLISELEDCFEHNNMKGAFEKLLSLQKSLQVQEQLPGHAER  186

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
              Q+E  ++RL+++  P +    +
Sbjct  187  LTQVEDFKNRLEALASPNVVQCFA  210



>gb|KGB34884.1| Conserved oligomeric Golgi complex subunit 7 [Schistosoma haematobium]
Length=413

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 77/143 (54%), Gaps = 1/143 (1%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +L+     A+  +PR  R++  +R DAL+L + + + LQ   + + +S   V +L ++D 
Sbjct  78   TLDHTCQEAIVSIPRVLREIDAVRIDALTLEADLKT-LQDDNQLDDNSQNIVNSLVELDR  136

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
             +R  ++A + L++      L   ++++F  GDL +   ++  M  CL++   + ++   
Sbjct  137  TRRNAQSAADALRETDRWINLMQCIDELFEVGDLDQLCSSIEGMSQCLASFIHLNDYDER  196

Query  363  RKQLEVLEDRLDSMVQPRLTDAL  431
             KQ++  ++ L++++ P+L  + 
Sbjct  197  VKQVDQYKNNLETLIAPKLIQSF  219



>ref|XP_002431030.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB18292.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=731

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/143 (22%), Positives = 73/143 (51%), Gaps = 0/143 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
             E  +   +H +P+  +D  +L +DA  L+  ++++  ++ K + ++  ++++L K+D V
Sbjct  52   FESTARDVIHHLPKINKDAGKLSEDAGDLQDKMNAVRDEIDKIKKNTDMTISSLEKIDRV  111

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K  +    E L +A   T LS+ ++      D+      +  M+  LS +    ++ + +
Sbjct  112  KMELMKYKEALHEADKWTMLSNDIKAALDVRDIDTVTCKVLTMQQSLSILTNAHDYEDKK  171

Query  366  KQLEVLEDRLDSMVQPRLTDALS  434
             +LE  +++L++M  P L  A +
Sbjct  172  LELESFKNQLEAMASPLLLQAFT  194



>ref|XP_006912615.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Pteropus 
alecto]
Length=755

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = +3

Query  12   ELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKR  191
            E S  AL  +PR  RDV  LR +A  LR  +  I + +RK E  +++S+  L  +D VK 
Sbjct  51   ETSLQALQNMPRVLRDVEALRQEASFLREQMVLIKEDIRKFEQDTSQSMQVLVDIDQVKS  110

Query  192  RMEAAYETLQDAAGLTQLSSTVEDVFSS  275
            RM+ A ++LQ+A   + LS+ +E+ F +
Sbjct  111  RMQLAAQSLQEADKWSTLSADIEETFKT  138



>gb|ENN72950.1| hypothetical protein YQE_10421, partial [Dendroctonus ponderosae]
Length=176

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 70/122 (57%), Gaps = 0/122 (0%)
 Frame = +3

Query  69   LRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETLQDAAGLTQLS  248
            L+ +AL L+  +  + +++ + E  + +S+ T+ K+D +K ++  A + L ++   T L 
Sbjct  7    LQQEALVLKEKMGQVKEEIVQIEQDTRKSINTIEKLDEMKNQLTIAKQGLHESDNWTVLV  66

Query  249  STVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRLDSMVQPRLTDA  428
            + +E++F S ++   +  +  M+  L  +  VA+F + + QLE L++RL+++  P +  A
Sbjct  67   NDLEEIFDSKNIVAISSKILGMQSSLKLLVNVADFDDRKLQLEGLKNRLEAIASPVIVQA  126

Query  429  LS  434
             +
Sbjct  127  FT  128



>emb|CCD80953.1| putative protein arginine n-methyltransferase, partial [Schistosoma 
mansoni]
Length=1047

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 68/130 (52%), Gaps = 1/130 (1%)
 Frame = +3

Query  42   PRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETLQ  221
            P   R++  +R DAL+L S + + LQ   + + +S   V +L ++D  +R  ++A + L+
Sbjct  56   PSVLREIDAVRIDALALESDLKT-LQDDNQLDDNSQNIVNSLVELDRTRRNAQSAADALR  114

Query  222  DAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVLEDRLDS  401
            +      L   ++++F  GD+ +    +  M  CL +   + ++    KQ++  ++ L+S
Sbjct  115  ETDRWINLMQCIDELFEVGDIDQLCSNIEGMSQCLGSFIHLNDYDERVKQVDKYKNNLES  174

Query  402  MVQPRLTDAL  431
            ++ P+L  + 
Sbjct  175  LIAPKLIQSF  184



>ref|XP_001955508.1| GF16218 [Drosophila ananassae]
 gb|EDV44069.1| GF16218 [Drosophila ananassae]
Length=742

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 74/144 (51%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +PR  ++   L  D   L+  +S++  ++   +  + E +ATL +++ 
Sbjct  57   AVEESSRQVVASMPRIAKESAALHADVRRLQDKMSAMRLEVAAVQNETGECMATLERLNN  116

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
              +R++ A E+LQ++ G   L + +ED F   DL    E L  ++  L A  ++A  A  
Sbjct  117  KSQRLQVAKESLQESDGWGNLLAELEDGFERNDLKGVCEKLIALQKSLFAQEQLAGHAER  176

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
              Q+E  ++RL+++  P +    +
Sbjct  177  VTQVEDFKNRLEALASPSVVQCFA  200



>ref|XP_002037280.1| GM12202 [Drosophila sechellia]
 gb|EDW53439.1| GM12202 [Drosophila sechellia]
Length=652

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/144 (24%), Positives = 76/144 (53%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +PR  ++   L+ D   L+  +S++  ++   +  + E +ATL +++T
Sbjct  57   AVEESSRQVVASMPRIAKESAALQADVHRLQEKMSAMRLEVAAVQSETGECMATLERLNT  116

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
              ++++ A E+LQ++ G   L + +ED F   DL    + L  ++  L A  ++   A  
Sbjct  117  KSQKLQVAKESLQESDGWGNLLAELEDGFERNDLKGVCDKLIALQKSLHAQEQLPGHAER  176

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + Q+E  ++RL+++  P +    +
Sbjct  177  QTQVEDFKNRLEALASPSVVQCFA  200



>gb|ELK12106.1| Conserved oligomeric Golgi complex subunit 7 [Pteropus alecto]
Length=660

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +3

Query  39   VPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETL  218
            +PR  RDV  LR +A  LR  +  I + +RK E  +++S+  L  +D VK RM+ A ++L
Sbjct  1    MPRVLRDVEALRQEASFLREQMVLIKEDIRKFEQDTSQSMQVLVDIDQVKSRMQLAAQSL  60

Query  219  QDAAGLTQLSSTVEDVFSS  275
            Q+A   + LS+ +E+ F +
Sbjct  61   QEADKWSTLSADIEETFKT  79



>ref|XP_002105431.1| GD17535 [Drosophila simulans]
 gb|EDX14934.1| GD17535 [Drosophila simulans]
Length=742

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/144 (24%), Positives = 76/144 (53%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +PR  ++   L+ D   L+  +S++  ++   +  + E +ATL +++T
Sbjct  57   AVEESSRQVVASMPRIAKESAALQADVHRLQEKMSAMRLEVAAVQSETGECMATLERLNT  116

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
              ++++ A E+LQ++ G   L + +ED F   DL    + L  ++  L A  ++   A  
Sbjct  117  KSQKLQVAKESLQESDGWGNLLAELEDGFERNDLKGVCDKLIALQKSLHAQEQLPGHAER  176

Query  363  RKQLEVLEDRLDSMVQPRLTDALS  434
            + Q+E  ++RL+++  P +    +
Sbjct  177  QTQVEDFKNRLEALASPSVVQCFA  200



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564667271820