BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF024F19

Length=433
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011084615.1|  PREDICTED: TOM1-like protein 2                     166   2e-46   
ref|XP_011075789.1|  PREDICTED: target of Myb protein 1                 166   3e-46   Sesamum indicum [beniseed]
ref|XP_009788191.1|  PREDICTED: TOM1-like protein 2                     165   5e-46   Nicotiana sylvestris
ref|XP_009608733.1|  PREDICTED: TOM1-like protein 2                     163   2e-45   Nicotiana tomentosiformis
ref|XP_006347578.1|  PREDICTED: TOM1-like protein 2-like isoform X1     160   2e-44   Solanum tuberosum [potatoes]
ref|XP_004235312.1|  PREDICTED: TOM1-like protein 2                     160   2e-44   Solanum lycopersicum
emb|CDP04931.1|  unnamed protein product                                159   6e-44   Coffea canephora [robusta coffee]
gb|EPS72882.1|  hypothetical protein M569_01871                         159   1e-43   Genlisea aurea
gb|EYU45379.1|  hypothetical protein MIMGU_mgv1a007671mg                157   3e-43   Erythranthe guttata [common monkey flower]
ref|XP_002520034.1|  protein transporter, putative                      150   2e-40   Ricinus communis
ref|XP_002285602.1|  PREDICTED: TOM1-like protein 2                     147   3e-39   
ref|XP_011006026.1|  PREDICTED: TOM1-like protein 2                     147   4e-39   Populus euphratica
emb|CAN70382.1|  hypothetical protein VITISV_020135                     147   4e-39   Vitis vinifera
ref|XP_007029586.1|  Target of Myb protein 1 isoform 1                  145   1e-38   
gb|KHG10261.1|  TOM1-like protein 2                                     141   3e-38   Gossypium arboreum [tree cotton]
gb|AGS41185.1|  MYB transcription factor 9                              144   4e-38   Tamarix hispida
ref|XP_010063284.1|  PREDICTED: TOM1-like protein 2                     142   2e-37   
ref|XP_011016801.1|  PREDICTED: TOM1-like protein 2                     139   2e-37   Populus euphratica
ref|XP_002275091.1|  PREDICTED: TOM1-like protein 2                     142   2e-37   Vitis vinifera
ref|XP_010671112.1|  PREDICTED: TOM1-like protein 2                     142   3e-37   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB18439.1|  hypothetical protein B456_003G052900                    141   4e-37   Gossypium raimondii
ref|XP_010558637.1|  PREDICTED: TOM1-like protein 2                     140   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_011007173.1|  PREDICTED: TOM1-like protein 2                     139   2e-36   Populus euphratica
ref|XP_006376006.1|  hypothetical protein POPTR_0013s07880g             139   3e-36   Populus trichocarpa [western balsam poplar]
ref|XP_008234559.1|  PREDICTED: target of Myb protein 1                 139   3e-36   Prunus mume [ume]
ref|XP_007218111.1|  hypothetical protein PRUPE_ppa006768mg             139   3e-36   Prunus persica
ref|XP_009361163.1|  PREDICTED: TOM1-like protein 2 isoform X2          139   4e-36   Pyrus x bretschneideri [bai li]
ref|XP_009361159.1|  PREDICTED: TOM1-like protein 2 isoform X1          139   4e-36   
ref|XP_004511421.1|  PREDICTED: TOM1-like protein 2-like                138   7e-36   Cicer arietinum [garbanzo]
ref|XP_007157069.1|  hypothetical protein PHAVU_002G040300g             138   7e-36   Phaseolus vulgaris [French bean]
ref|XP_004307860.1|  PREDICTED: target of Myb protein 1                 138   8e-36   Fragaria vesca subsp. vesca
ref|XP_009351819.1|  PREDICTED: TOM1-like protein 2                     137   1e-35   
ref|XP_008382040.1|  PREDICTED: TOM1-like protein 2                     137   1e-35   Malus domestica [apple tree]
ref|XP_008376920.1|  PREDICTED: TOM1-like protein 2 isoform X1          137   1e-35   Malus domestica [apple tree]
ref|XP_008376923.1|  PREDICTED: TOM1-like protein 2 isoform X2          137   1e-35   Malus domestica [apple tree]
ref|XP_010267653.1|  PREDICTED: TOM1-like protein 2                     137   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_006297827.1|  hypothetical protein CARUB_v10013862mg             136   3e-35   Capsella rubella
ref|NP_001239879.1|  uncharacterized protein LOC100793134               136   3e-35   Glycine max [soybeans]
gb|KJB82228.1|  hypothetical protein B456_013G183000                    136   3e-35   Gossypium raimondii
gb|KJB82229.1|  hypothetical protein B456_013G183000                    136   4e-35   Gossypium raimondii
ref|XP_010549833.1|  PREDICTED: TOM1-like protein 2                     135   5e-35   Tarenaya hassleriana [spider flower]
gb|KHF97708.1|  TOM1-like protein 2                                     135   5e-35   Gossypium arboreum [tree cotton]
ref|XP_004167394.1|  PREDICTED: TOM1-like protein 2-like                135   6e-35   
ref|XP_008452808.1|  PREDICTED: TOM1-like protein 2                     135   6e-35   Cucumis melo [Oriental melon]
ref|XP_004144724.1|  PREDICTED: TOM1-like protein 2-like                135   6e-35   Cucumis sativus [cucumbers]
ref|XP_010919989.1|  PREDICTED: TOM1-like protein 2                     135   7e-35   Elaeis guineensis
ref|XP_010453865.1|  PREDICTED: TOM1-like protein 2                     135   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009121426.1|  PREDICTED: TOM1-like protein 2                     134   1e-34   Brassica rapa
emb|CDX69412.1|  BnaA10g17610D                                          134   1e-34   
emb|CDY16971.1|  BnaC09g40980D                                          134   2e-34   Brassica napus [oilseed rape]
gb|ACJ85033.1|  unknown                                                 132   2e-34   Medicago truncatula
gb|KDO47246.1|  hypothetical protein CISIN_1g01611221mg                 131   3e-34   Citrus sinensis [apfelsine]
ref|NP_850834.1|  Target of Myb protein 1                               132   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010525051.1|  PREDICTED: TOM1-like protein 2                     132   7e-34   Tarenaya hassleriana [spider flower]
ref|XP_010087473.1|  TOM1-like protein 2                                132   8e-34   Morus notabilis
ref|XP_002871740.1|  VHS domain-containing protein                      132   8e-34   
ref|XP_006287873.1|  hypothetical protein CARUB_v10001100mg             132   9e-34   Capsella rubella
emb|CDX70725.1|  BnaC03g08090D                                          132   1e-33   
emb|CDX78717.1|  BnaA03g06290D                                          132   1e-33   
ref|XP_003610830.1|  Hepatocyte growth factor-regulated tyrosine ...    132   1e-33   Medicago truncatula
ref|XP_006408352.1|  hypothetical protein EUTSA_v10020862mg             132   1e-33   Eutrema salsugineum [saltwater cress]
gb|ABR28337.1|  MYB transcription factor MYB49                          132   1e-33   Medicago truncatula
ref|XP_009131569.1|  PREDICTED: TOM1-like protein 2                     132   1e-33   Brassica rapa
ref|XP_006400231.1|  hypothetical protein EUTSA_v10013718mg             132   1e-33   Eutrema salsugineum [saltwater cress]
gb|ABG66292.1|  VHS domain-containing protein, putative, expressed      127   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|NP_197190.1|  Target of Myb protein 1                               132   1e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KDP21763.1|  hypothetical protein JCGZ_00550                         132   1e-33   Jatropha curcas
ref|XP_008800065.1|  PREDICTED: TOM1-like protein 2                     131   2e-33   Phoenix dactylifera
ref|XP_006647730.1|  PREDICTED: TOM1-like protein 2-like                131   3e-33   Oryza brachyantha
ref|XP_010420395.1|  PREDICTED: TOM1-like protein 2                     131   3e-33   Camelina sativa [gold-of-pleasure]
ref|NP_001047818.1|  Os02g0697300                                       131   3e-33   
ref|XP_006443227.1|  hypothetical protein CICLE_v10020497mg             131   3e-33   Citrus clementina [clementine]
ref|NP_001065496.1|  Os10g0578000                                       127   4e-33   
ref|XP_010492622.1|  PREDICTED: TOM1-like protein 2                     131   4e-33   Camelina sativa [gold-of-pleasure]
gb|EMS54006.1|  TOM1-like protein 2                                     130   5e-33   Triticum urartu
ref|XP_002882268.1|  VHS domain-containing protein                      130   7e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_004983533.1|  PREDICTED: TOM1-like protein 2-like                129   1e-32   Setaria italica
gb|EMS45324.1|  TOM1-like protein 2                                     129   1e-32   Triticum urartu
gb|EMT15900.1|  TOM1-like protein 2                                     129   1e-32   
gb|KHG15259.1|  TOM1-like protein 2                                     129   1e-32   Gossypium arboreum [tree cotton]
ref|XP_006854075.1|  hypothetical protein AMTR_s00048p00118270          129   2e-32   
gb|KJB26742.1|  hypothetical protein B456_004G257100                    129   2e-32   Gossypium raimondii
gb|AFK35545.1|  unknown                                                 129   2e-32   Medicago truncatula
gb|AAL58181.1|AC027037_3  hepatocyte growth factor-regulated tyro...    129   2e-32   Oryza sativa Japonica Group [Japonica rice]
gb|EAY79641.1|  hypothetical protein OsI_34785                          128   2e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_008813149.1|  PREDICTED: TOM1-like protein 2                     127   4e-32   Phoenix dactylifera
ref|XP_003574387.1|  PREDICTED: TOM1-like protein 2                     127   5e-32   Brachypodium distachyon [annual false brome]
ref|XP_004953557.1|  PREDICTED: TOM1-like protein 2-like isoform X1     127   5e-32   
ref|XP_003570152.1|  PREDICTED: TOM1-like protein 2                     127   5e-32   Brachypodium distachyon [annual false brome]
gb|AFW72919.1|  putative VHS/GAT domain containing family protein       125   5e-32   
ref|XP_006662105.1|  PREDICTED: TOM1-like protein 2-like                127   6e-32   Oryza brachyantha
ref|XP_003580255.1|  PREDICTED: TOM1-like protein 2                     127   8e-32   Brachypodium distachyon [annual false brome]
gb|EMT04498.1|  TOM1-like protein 2                                     127   1e-31   
ref|NP_001132563.1|  putative VHS/GAT domain containing family pr...    126   2e-31   Zea mays [maize]
gb|AFW63470.1|  putative VHS/GAT domain containing family protein       126   2e-31   
dbj|BAJ86080.1|  predicted protein                                      125   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008643658.1|  PREDICTED: protein transporter isoform X1          125   3e-31   
ref|NP_001148639.1|  protein transporter                                125   3e-31   
ref|XP_010940789.1|  PREDICTED: TOM1-like protein 2                     124   7e-31   Elaeis guineensis
ref|XP_009388422.1|  PREDICTED: TOM1-like protein 2                     124   7e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399424.1|  PREDICTED: TOM1-like protein 2                     123   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW46173.1|  hypothetical protein EUGRSUZ_K00082                     122   4e-30   Eucalyptus grandis [rose gum]
ref|XP_010034944.1|  PREDICTED: TOM1-like protein 2                     122   5e-30   Eucalyptus grandis [rose gum]
gb|ABK24381.1|  unknown                                                 121   1e-29   Picea sitchensis
gb|EMT21212.1|  TOM1-like protein 2                                     120   2e-29   
ref|XP_006592014.1|  PREDICTED: TOM1-like protein 2-like                119   6e-29   
gb|EMS61071.1|  TOM1-like protein 2                                     119   8e-29   Triticum urartu
gb|KHN46460.1|  TOM1-like protein 2                                     118   1e-28   Glycine soja [wild soybean]
ref|XP_003607430.1|  Class E vacuolar protein-sorting machinery p...    115   9e-28   
ref|XP_007131520.1|  hypothetical protein PHAVU_011G019800g             115   1e-27   Phaseolus vulgaris [French bean]
gb|KEH30668.1|  protein transporter                                     116   1e-27   Medicago truncatula
ref|XP_010276808.1|  PREDICTED: TOM1-like protein 2                     114   3e-27   Nelumbo nucifera [Indian lotus]
ref|XP_009384136.1|  PREDICTED: TOM1-like protein 2                     110   6e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006591518.1|  PREDICTED: hepatocyte growth factor-regulate...    100   3e-23   
gb|ADE76488.1|  unknown                                                 100   2e-22   Picea sitchensis
gb|KJB18441.1|  hypothetical protein B456_003G052900                    100   2e-22   Gossypium raimondii
ref|XP_002964154.1|  hypothetical protein SELMODRAFT_82329            89.4    2e-18   
ref|XP_002993154.1|  hypothetical protein SELMODRAFT_136575           89.4    2e-18   
ref|XP_010935906.1|  PREDICTED: TOM1-like protein 2                   86.7    2e-17   Elaeis guineensis
ref|XP_008805226.1|  PREDICTED: TOM1-like protein 2                   86.7    2e-17   Phoenix dactylifera
ref|XP_007050288.1|  ENTH/VHS/GAT family protein                      85.5    5e-17   
ref|XP_002968515.1|  hypothetical protein SELMODRAFT_89807            85.9    6e-17   Selaginella moellendorffii
ref|XP_002975969.1|  hypothetical protein SELMODRAFT_232686           85.9    6e-17   Selaginella moellendorffii
ref|XP_004246945.1|  PREDICTED: TOM1-like protein 2                   85.9    6e-17   
ref|XP_006351672.1|  PREDICTED: target of Myb protein 1-like          85.5    6e-17   Solanum tuberosum [potatoes]
ref|XP_001757968.1|  predicted protein                                84.7    1e-16   
ref|XP_004493778.1|  PREDICTED: target of Myb protein 1-like          84.7    2e-16   Cicer arietinum [garbanzo]
ref|XP_009631518.1|  PREDICTED: TOM1-like protein 2                   84.3    2e-16   Nicotiana tomentosiformis
gb|KJB11326.1|  hypothetical protein B456_001G253900                  83.6    3e-16   Gossypium raimondii
ref|XP_009796852.1|  PREDICTED: TOM1-like protein 2                   83.6    3e-16   Nicotiana sylvestris
gb|KHG16514.1|  TOM1-like protein 2                                   83.6    3e-16   Gossypium arboreum [tree cotton]
gb|KHN02502.1|  Target of Myb protein 1                               83.6    4e-16   Glycine soja [wild soybean]
gb|ACU20982.1|  unknown                                               82.4    4e-16   Glycine max [soybeans]
ref|XP_002278050.1|  PREDICTED: TOM1-like protein 2                   82.4    7e-16   
ref|XP_008364318.1|  PREDICTED: TOM1-like protein 1                   82.8    1e-15   
gb|KHG07549.1|  TOM1-like protein 2                                   82.0    1e-15   Gossypium arboreum [tree cotton]
ref|XP_008235674.1|  PREDICTED: uncharacterized protein LOC103334474  82.0    2e-15   Prunus mume [ume]
ref|XP_007199901.1|  hypothetical protein PRUPE_ppa006710mg           82.0    2e-15   Prunus persica
emb|CBI37124.3|  unnamed protein product                              82.4    2e-15   Vitis vinifera
gb|KJB42271.1|  hypothetical protein B456_007G146500                  80.5    5e-15   Gossypium raimondii
ref|XP_007162547.1|  hypothetical protein PHAVU_001G161300g           79.7    1e-14   Phaseolus vulgaris [French bean]
ref|XP_011080045.1|  PREDICTED: TOM1-like protein 2                   79.3    1e-14   Sesamum indicum [beniseed]
gb|KDP26526.1|  hypothetical protein JCGZ_17684                       79.0    2e-14   Jatropha curcas
gb|AGV54699.1|  target of Myb protein 1-like protein                  79.3    2e-14   Phaseolus vulgaris [French bean]
gb|KDO60488.1|  hypothetical protein CISIN_1g0411492mg                77.4    2e-14   Citrus sinensis [apfelsine]
emb|CDP03748.1|  unnamed protein product                              77.4    6e-14   Coffea canephora [robusta coffee]
ref|XP_006479538.1|  PREDICTED: TOM1-like protein 1-like isoform X1   77.0    8e-14   Citrus sinensis [apfelsine]
gb|EYU46453.1|  hypothetical protein MIMGU_mgv1a023292mg              76.6    9e-14   Erythranthe guttata [common monkey flower]
ref|XP_010246780.1|  PREDICTED: TOM1-like protein 2                   76.6    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_001779411.1|  predicted protein                                76.6    1e-13   
ref|XP_010522149.1|  PREDICTED: target of Myb protein 1               76.3    2e-13   Tarenaya hassleriana [spider flower]
ref|NP_973770.1|  ENTH/VHS/GAT family protein                         74.3    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002973972.1|  hypothetical protein SELMODRAFT_57331            73.9    3e-13   
ref|XP_006383702.1|  hypothetical protein POPTR_0005s24650g           73.6    4e-13   
ref|XP_002969092.1|  hypothetical protein SELMODRAFT_67275            73.2    6e-13   
ref|XP_010485879.1|  PREDICTED: TOM1-like protein 2                   74.7    6e-13   Camelina sativa [gold-of-pleasure]
ref|NP_563762.1|  ENTH/VHS/GAT family protein                         74.7    6e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475349.1|  PREDICTED: target of Myb protein 1-like          74.3    7e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010457748.1|  PREDICTED: target of Myb protein 1-like          74.3    7e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002889591.1|  VHS domain-containing protein                    74.3    8e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_006857283.1|  hypothetical protein AMTR_s00067p00032430        73.9    8e-13   Amborella trichopoda
ref|XP_002532031.1|  protein transporter, putative                    73.9    1e-12   Ricinus communis
ref|XP_006417945.1|  hypothetical protein EUTSA_v10007923mg           73.9    1e-12   Eutrema salsugineum [saltwater cress]
emb|CDY15564.1|  BnaA08g28480D                                        72.8    2e-12   Brassica napus [oilseed rape]
ref|XP_002307649.2|  hypothetical protein POPTR_0005s24650g           73.6    2e-12   
ref|XP_011004048.1|  PREDICTED: TOM1-like protein 2 isoform X1        73.2    3e-12   Populus euphratica
ref|XP_011004050.1|  PREDICTED: TOM1-like protein 2 isoform X2        73.2    3e-12   Populus euphratica
emb|CDX86533.1|  BnaC08g01700D                                        72.4    3e-12   
ref|XP_006305076.1|  hypothetical protein CARUB_v10009444mg           72.8    3e-12   Capsella rubella
emb|CDY06201.1|  BnaA09g50020D                                        72.0    6e-12   
emb|CDY09983.1|  BnaC08g44680D                                        72.0    6e-12   Brassica napus [oilseed rape]
gb|KEH23932.1|  ENTH/VHS/GAT family protein                           72.0    7e-12   Medicago truncatula
ref|XP_009118551.1|  PREDICTED: target of Myb protein 1-like          71.6    7e-12   Brassica rapa
ref|XP_010667636.1|  PREDICTED: uncharacterized protein LOC104884649  69.7    8e-12   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY10185.1|  BnaC05g04280D                                        71.2    8e-12   Brassica napus [oilseed rape]
ref|XP_010679306.1|  PREDICTED: TOM1-like protein 2                   71.6    8e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004289949.1|  PREDICTED: TOM1-like protein 2                   69.7    3e-11   Fragaria vesca subsp. vesca
ref|XP_011013579.1|  PREDICTED: TOM1-like protein 2                   68.2    1e-10   Populus euphratica
ref|XP_011028806.1|  PREDICTED: TOM1-like protein 2                   68.2    1e-10   Populus euphratica
gb|EYU17922.1|  hypothetical protein MIMGU_mgv1a008118mg              67.0    3e-10   Erythranthe guttata [common monkey flower]
ref|XP_002300774.2|  hypothetical protein POPTR_0002s03910g           67.0    3e-10   
ref|XP_006371247.1|  hypothetical protein POPTR_0019s07670g           62.8    5e-10   
ref|XP_004498477.1|  PREDICTED: TOM1-like protein 1-like              57.8    7e-07   Cicer arietinum [garbanzo]
ref|XP_010100264.1|  Protein PEROXIN-4                                57.8    7e-07   
ref|XP_008220049.1|  PREDICTED: target of Myb protein 1               57.0    1e-06   Prunus mume [ume]
gb|EPS60910.1|  hypothetical protein M569_13891                       53.1    1e-06   Genlisea aurea
ref|XP_007225177.1|  hypothetical protein PRUPE_ppa002235mg           57.0    1e-06   Prunus persica
emb|CDY45016.1|  BnaA08g12030D                                        57.0    1e-06   Brassica napus [oilseed rape]
ref|XP_010526178.1|  PREDICTED: TOM1-like protein 2                   56.6    1e-06   Tarenaya hassleriana [spider flower]
emb|CDY49322.1|  BnaC03g66920D                                        56.6    1e-06   Brassica napus [oilseed rape]
ref|XP_009108832.1|  PREDICTED: TOM1-like protein 2 isoform X1        56.6    2e-06   Brassica rapa
ref|XP_003544671.1|  PREDICTED: TOM1-like protein 2-like              56.2    2e-06   Glycine max [soybeans]
ref|XP_002516559.1|  protein transporter, putative                    56.2    2e-06   Ricinus communis
ref|XP_008378101.1|  PREDICTED: TOM1-like protein 1                   56.2    2e-06   
ref|XP_009367903.1|  PREDICTED: target of Myb protein 1               56.2    2e-06   Pyrus x bretschneideri [bai li]
ref|NP_001237269.1|  VHS and GAT domain protein                       55.8    3e-06   Glycine max [soybeans]
gb|KEH40293.1|  ENTH/VHS/GAT family protein                           55.8    3e-06   Medicago truncatula
ref|NP_195002.2|  ENTH/VHS/GAT family protein                         55.8    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432670.1|  PREDICTED: TOM1-like protein 2 isoform X2        55.8    3e-06   Camelina sativa [gold-of-pleasure]
ref|NP_001190892.1|  ENTH/VHS/GAT family protein                      55.8    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284083.2|  PREDICTED: target of Myb protein 1               55.8    3e-06   Vitis vinifera
ref|XP_010437859.1|  PREDICTED: TOM1-like protein 2 isoform X2        55.8    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010432669.1|  PREDICTED: TOM1-like protein 2 isoform X1        55.8    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010447347.1|  PREDICTED: TOM1-like protein 2 isoform X2        55.8    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006412434.1|  hypothetical protein EUTSA_v10024602mg           55.8    3e-06   Eutrema salsugineum [saltwater cress]
ref|XP_010447346.1|  PREDICTED: TOM1-like protein 2 isoform X1        55.8    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010437858.1|  PREDICTED: TOM1-like protein 2 isoform X1        55.8    3e-06   Camelina sativa [gold-of-pleasure]
gb|KFK29873.1|  hypothetical protein AALP_AA7G190000                  55.5    3e-06   Arabis alpina [alpine rockcress]
ref|XP_002869247.1|  protein transporter                              55.5    3e-06   
gb|KFK29872.1|  hypothetical protein AALP_AA7G190000                  55.5    3e-06   Arabis alpina [alpine rockcress]
ref|XP_011459005.1|  PREDICTED: target of Myb protein 1               55.5    4e-06   Fragaria vesca subsp. vesca
emb|CDY13501.1|  BnaA03g52190D                                        55.1    4e-06   Brassica napus [oilseed rape]
gb|AEK78080.1|  VHS                                                   53.9    5e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009138141.1|  PREDICTED: TOM1-like protein 2 isoform X1        55.1    5e-06   Brassica rapa
ref|XP_009138142.1|  PREDICTED: TOM1-like protein 2 isoform X2        55.1    5e-06   Brassica rapa
ref|XP_006833334.1|  hypothetical protein AMTR_s00109p00078110        54.7    5e-06   
ref|XP_006450645.1|  hypothetical protein CICLE_v10007656mg           54.7    6e-06   Citrus clementina [clementine]
gb|KDP34202.1|  hypothetical protein JCGZ_07773                       54.7    6e-06   Jatropha curcas
gb|KDO79743.1|  hypothetical protein CISIN_1g005810mg                 54.7    6e-06   Citrus sinensis [apfelsine]
ref|XP_006283262.1|  hypothetical protein CARUB_v10004294mg           54.7    6e-06   Capsella rubella
ref|XP_006476080.1|  PREDICTED: ADP-ribosylation factor-binding p...  54.7    6e-06   Citrus sinensis [apfelsine]
gb|EYU20455.1|  hypothetical protein MIMGU_mgv1a002579mg              54.7    6e-06   Erythranthe guttata [common monkey flower]
gb|EYU29271.1|  hypothetical protein MIMGU_mgv1a004368mg              54.7    6e-06   Erythranthe guttata [common monkey flower]
emb|CDX72371.1|  BnaC07g43930D                                        54.7    6e-06   
ref|XP_011081815.1|  PREDICTED: TOM1-like protein 2                   54.7    7e-06   Sesamum indicum [beniseed]
emb|CDY47726.1|  BnaA10g04150D                                        53.9    7e-06   Brassica napus [oilseed rape]
gb|KDO79744.1|  hypothetical protein CISIN_1g005810mg                 54.3    7e-06   Citrus sinensis [apfelsine]
ref|XP_004965472.1|  PREDICTED: target of Myb protein 1-like          54.3    1e-05   Setaria italica
ref|XP_008337081.1|  PREDICTED: TOM1-like protein 1                   53.9    1e-05   
gb|AFW86617.1|  putative VHS/GAT domain containing family protein     53.5    1e-05   
ref|XP_002437041.1|  hypothetical protein SORBIDRAFT_10g019670        53.5    1e-05   
ref|XP_004172991.1|  PREDICTED: TOM1-like protein 2-like              53.1    1e-05   
gb|EMT01224.1|  TOM1-like protein 2                                   53.5    1e-05   
gb|AFW86618.1|  LOW QUALITY PROTEIN: putative VHS/GAT domain cont...  53.5    1e-05   
ref|NP_001151446.1|  VHS and GAT domain protein                       53.5    1e-05   Zea mays [maize]
ref|XP_007012073.1|  ENTH/VHS/GAT family protein                      53.1    2e-05   Theobroma cacao [chocolate]
ref|XP_006656045.1|  PREDICTED: target of Myb protein 1-like          53.1    2e-05   Oryza brachyantha
ref|XP_009768540.1|  PREDICTED: target of Myb protein 1-like isof...  53.1    2e-05   Nicotiana sylvestris
gb|KHG12147.1|  TOM1-like protein 2                                   53.1    2e-05   Gossypium arboreum [tree cotton]
gb|EMS50126.1|  TOM1-like protein 2                                   53.1    2e-05   Triticum urartu
gb|KJB07515.1|  hypothetical protein B456_001G027900                  53.1    2e-05   Gossypium raimondii
ref|NP_187491.1|  ENTH/VHS/GAT family protein                         53.1    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299627.1|  hypothetical protein CARUB_v10015806mg           53.1    2e-05   Capsella rubella
ref|XP_006366215.1|  PREDICTED: TOM1-like protein 2-like              53.1    2e-05   Solanum tuberosum [potatoes]
ref|XP_004245269.1|  PREDICTED: target of Myb protein 1               53.1    2e-05   Solanum lycopersicum
gb|KGN60332.1|  hypothetical protein Csa_3G895780                     53.1    2e-05   
ref|XP_008466043.1|  PREDICTED: target of Myb protein 1-like isof...  53.1    2e-05   
ref|XP_010465480.1|  PREDICTED: uncharacterized protein LOC104745...  53.5    2e-05   Camelina sativa [gold-of-pleasure]
gb|KJB07512.1|  hypothetical protein B456_001G027900                  53.1    2e-05   Gossypium raimondii
ref|XP_009631039.1|  PREDICTED: target of Myb protein 1-like          53.1    2e-05   Nicotiana tomentosiformis
ref|XP_004136216.1|  PREDICTED: uncharacterized protein LOC101216627  53.1    2e-05   Cucumis sativus [cucumbers]
dbj|BAK05686.1|  predicted protein                                    53.1    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002882583.1|  VHS domain-containing protein                    53.1    2e-05   Arabidopsis lyrata subsp. lyrata
gb|KJB07516.1|  hypothetical protein B456_001G027900                  53.1    2e-05   Gossypium raimondii
ref|XP_006407741.1|  hypothetical protein EUTSA_v10022036mg           53.1    2e-05   Eutrema salsugineum [saltwater cress]
gb|KFK38269.1|  hypothetical protein AALP_AA3G092500                  53.1    2e-05   Arabis alpina [alpine rockcress]
ref|XP_010464493.1|  PREDICTED: TOM1-like protein 2 isoform X1        53.1    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008367799.1|  PREDICTED: target of Myb protein 1-like          52.8    2e-05   
ref|XP_004208401.1|  PREDICTED: hepatocyte growth factor-regulate...  52.8    2e-05   
gb|EEC80523.1|  hypothetical protein OsI_22803                        53.1    2e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001057544.1|  Os06g0332400                                     53.1    2e-05   
ref|XP_008466046.1|  PREDICTED: probable ADP-ribosylation factor-...  52.8    2e-05   Cucumis melo [Oriental melon]
ref|XP_010048112.1|  PREDICTED: target of Myb protein 1-like          52.8    2e-05   Eucalyptus grandis [rose gum]
ref|XP_008800580.1|  PREDICTED: target of Myb protein 1-like isof...  52.8    3e-05   Phoenix dactylifera
ref|XP_001753543.1|  predicted protein                                49.7    3e-05   
dbj|BAJ93569.1|  predicted protein                                    52.8    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010925874.1|  PREDICTED: target of Myb protein 1-like isof...  52.4    3e-05   
ref|XP_010486425.1|  PREDICTED: TOM1-like protein 2                   52.4    3e-05   Camelina sativa [gold-of-pleasure]
gb|KJB07514.1|  hypothetical protein B456_001G027900                  52.4    3e-05   Gossypium raimondii
ref|XP_010925873.1|  PREDICTED: target of Myb protein 1-like isof...  52.4    3e-05   Elaeis guineensis
ref|XP_010249684.1|  PREDICTED: TOM1-like protein 2 isoform X1        52.4    3e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010249685.1|  PREDICTED: TOM1-like protein 2 isoform X2        52.4    3e-05   Nelumbo nucifera [Indian lotus]
gb|KJB09952.1|  hypothetical protein B456_001G177600                  51.6    3e-05   Gossypium raimondii
gb|EMS51268.1|  Target of Myb protein 1                               48.5    4e-05   Triticum urartu
ref|XP_008445032.1|  PREDICTED: ADP-ribosylation factor-binding p...  52.0    4e-05   Cucumis melo [Oriental melon]
ref|XP_004164262.1|  PREDICTED: ADP-ribosylation factor-binding p...  52.0    4e-05   
gb|KGN62829.1|  hypothetical protein Csa_2G375200                     52.0    4e-05   
ref|XP_004150282.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  52.0    5e-05   
dbj|BAJ99676.1|  predicted protein                                    48.5    5e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW78366.1|  putative VHS/GAT domain containing family protein     48.9    6e-05   
ref|XP_010668103.1|  PREDICTED: target of Myb protein 1 isoform X1    51.6    6e-05   
ref|XP_003636408.1|  Hepatocyte growth factor-regulated tyrosine ...  51.6    6e-05   
ref|XP_011019641.1|  PREDICTED: TOM1-like protein 2 isoform X2        51.6    7e-05   
ref|XP_011019640.1|  PREDICTED: TOM1-like protein 2 isoform X1        51.6    7e-05   
gb|AFW78358.1|  putative VHS/GAT domain containing family protein     48.5    8e-05   
ref|XP_002309556.2|  hypothetical protein POPTR_0006s25770g           51.2    8e-05   
gb|KEH36032.1|  ENTH/VHS/GAT family protein                           51.2    8e-05   
ref|XP_008775805.1|  PREDICTED: TOM1-like protein 1 isoform X1        51.2    8e-05   
ref|XP_010227670.1|  PREDICTED: TOM1-like protein 2 isoform X2        50.8    8e-05   
ref|XP_009123832.1|  PREDICTED: target of Myb protein 1 isoform X2    51.2    8e-05   
ref|XP_004501181.1|  PREDICTED: TOM1-like protein 2-like              51.2    8e-05   
ref|XP_009123827.1|  PREDICTED: TOM1-like protein 2 isoform X1        51.2    8e-05   
ref|XP_003522697.1|  PREDICTED: ADP-ribosylation factor-binding p...  51.2    9e-05   
ref|XP_003563837.1|  PREDICTED: ADP-ribosylation factor-binding p...  51.2    9e-05   
gb|KHN10222.1|  TOM1-like protein 2                                   51.2    9e-05   
gb|KJB27315.1|  hypothetical protein B456_004G290500                  50.8    1e-04   
emb|CDY58652.1|  BnaA01g32270D                                        50.8    1e-04   
emb|CDY22169.1|  BnaC01g39320D                                        50.8    1e-04   
ref|XP_006578216.1|  PREDICTED: ADP-ribosylation factor-binding p...  50.8    1e-04   
ref|XP_006578217.1|  PREDICTED: ADP-ribosylation factor-binding p...  50.4    1e-04   
ref|XP_001761602.1|  predicted protein                                47.8    1e-04   
ref|XP_010254072.1|  PREDICTED: target of Myb protein 1-like isof...  50.4    1e-04   
ref|XP_003526479.1|  PREDICTED: ADP-ribosylation factor-binding p...  50.4    2e-04   
gb|AFK38032.1|  unknown                                               48.9    2e-04   
ref|XP_009389963.1|  PREDICTED: target of Myb protein 1-like          50.1    2e-04   
ref|XP_002966385.1|  hypothetical protein SELMODRAFT_39145            47.0    2e-04   
ref|XP_010915838.1|  PREDICTED: TOM1-like protein 1 isoform X2        49.7    2e-04   
ref|XP_010541654.1|  PREDICTED: TOM1-like protein 2                   49.7    3e-04   
ref|XP_008649753.1|  PREDICTED: TOM1-like protein 2 isoform X3        48.9    3e-04   
ref|XP_008649754.1|  PREDICTED: TOM1-like protein 2 isoform X4        48.9    4e-04   
ref|XP_008649751.1|  PREDICTED: TOM1-like protein 2 isoform X1        48.9    4e-04   
ref|XP_008649752.1|  PREDICTED: TOM1-like protein 2 isoform X2        48.9    4e-04   
ref|XP_007137187.1|  hypothetical protein PHAVU_009G107100g           48.9    4e-04   
ref|XP_009796167.1|  PREDICTED: ADP-ribosylation factor-binding p...  48.9    4e-04   
gb|KHG18963.1|  TOM1-like protein 2                                   48.9    4e-04   
gb|AFW78365.1|  putative VHS/GAT domain containing family protein     48.9    4e-04   
ref|XP_009421202.1|  PREDICTED: TOM1-like protein 1                   48.9    5e-04   
ref|XP_009796168.1|  PREDICTED: ADP-ribosylation factor-binding p...  48.9    5e-04   
gb|KGN54491.1|  hypothetical protein Csa_4G338950                     47.8    6e-04   
ref|NP_001055830.1|  Os05g0475300                                     48.5    6e-04   
ref|XP_009399847.1|  PREDICTED: target of Myb protein 1-like          48.5    6e-04   
ref|XP_007137811.1|  hypothetical protein PHAVU_009G157500g           48.1    7e-04   
ref|NP_001151587.1|  protein transporter                              48.1    7e-04   
ref|XP_003568250.1|  PREDICTED: TOM1-like protein 2                   48.1    7e-04   
ref|XP_011026602.1|  PREDICTED: TOM1-like protein 2                   48.1    8e-04   
ref|XP_004952188.1|  PREDICTED: target of Myb protein 1-like          48.1    8e-04   
ref|XP_004961761.1|  PREDICTED: class E vacuolar protein-sorting ...  48.1    8e-04   
gb|KJB54840.1|  hypothetical protein B456_009G051300                  48.1    8e-04   
ref|XP_006340264.1|  PREDICTED: target of Myb protein 1-like isof...  48.1    9e-04   
ref|XP_004142659.1|  PREDICTED: target of Myb protein 1-like          47.8    0.001   
ref|XP_006655406.1|  PREDICTED: TOM1-like protein 2-like              47.8    0.001   
gb|ABR17546.1|  unknown                                               47.8    0.001   



>ref|XP_011084615.1| PREDICTED: TOM1-like protein 2 [Sesamum indicum]
Length=389

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGGSEVGQKI+AGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEP+WA NLEL
Sbjct  12   LGERLKIGGSEVGQKISAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPDWALNLEL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINHDRVNS+ELIRG+KKRI
Sbjct  72   CDMINHDRVNSLELIRGMKKRI  93



>ref|XP_011075789.1| PREDICTED: target of Myb protein 1 [Sesamum indicum]
Length=395

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEP+WATNL+L
Sbjct  12   FGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPDWATNLQL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINHDR+NS+ELIR +KKRI
Sbjct  72   CDMINHDRINSIELIRAVKKRI  93



>ref|XP_009788191.1| PREDICTED: TOM1-like protein 2 [Nicotiana sylvestris]
Length=395

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEVGQKITAGMSSMSFKMKE FQGPNQADKLVEEATAETLDEP+WA NLEL
Sbjct  13   FGERLKIGGSEVGQKITAGMSSMSFKMKELFQGPNQADKLVEEATAETLDEPDWAMNLEL  72

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINHDR+NSVELIRG+KKRI
Sbjct  73   CDMINHDRINSVELIRGVKKRI  94



>ref|XP_009608733.1| PREDICTED: TOM1-like protein 2 [Nicotiana tomentosiformis]
Length=395

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGG+EVGQKITAGMSSMSFKMKE FQGPNQADKLVEEATAETLDEP+WA NLEL
Sbjct  13   FGERLKIGGTEVGQKITAGMSSMSFKMKELFQGPNQADKLVEEATAETLDEPDWAMNLEL  72

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINHDR+NSVELIRG+KKRI
Sbjct  73   CDMINHDRINSVELIRGVKKRI  94



>ref|XP_006347578.1| PREDICTED: TOM1-like protein 2-like isoform X1 [Solanum tuberosum]
 ref|XP_006347579.1| PREDICTED: TOM1-like protein 2-like isoform X2 [Solanum tuberosum]
Length=396

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGG+EVGQKITAGMSSMSFKMKE FQGPNQADKLVEEATAETLDEP+WA NLEL
Sbjct  13   FGERLKIGGTEVGQKITAGMSSMSFKMKELFQGPNQADKLVEEATAETLDEPDWAMNLEL  72

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH+R+NSVELIRG+KKR+
Sbjct  73   CDMINHERINSVELIRGVKKRL  94



>ref|XP_004235312.1| PREDICTED: TOM1-like protein 2 [Solanum lycopersicum]
 ref|XP_010318281.1| PREDICTED: TOM1-like protein 2 [Solanum lycopersicum]
Length=396

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGG+EVGQKITAGMSSMSFKMKE FQGPNQADKLVEEATAETLDEP+WA NLEL
Sbjct  13   FGERLKIGGTEVGQKITAGMSSMSFKMKELFQGPNQADKLVEEATAETLDEPDWAMNLEL  72

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH+R+NSVELIRG+KKR+
Sbjct  73   CDMINHERINSVELIRGVKKRL  94



>emb|CDP04931.1| unnamed protein product [Coffea canephora]
Length=395

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGGSEVGQKI+AG+SSMSFKMKEFFQGPNQADK+VEEAT+E LD+P+WA+NLE+
Sbjct  12   LGERLKIGGSEVGQKISAGVSSMSFKMKEFFQGPNQADKVVEEATSENLDDPDWASNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINHDRVNSVEL+RGIKKRI
Sbjct  72   CDMINHDRVNSVELVRGIKKRI  93



>gb|EPS72882.1| hypothetical protein M569_01871 [Genlisea aurea]
Length=392

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGGSEVGQKITAGMSS+SFK+KEFFQGPNQA+KLVEEATAET+D P+WATNLEL
Sbjct  12   LGERLKIGGSEVGQKITAGMSSVSFKVKEFFQGPNQAEKLVEEATAETMDGPDWATNLEL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+NH+RVNSV+LIRGIKKRI
Sbjct  72   CDMVNHERVNSVDLIRGIKKRI  93



>gb|EYU45379.1| hypothetical protein MIMGU_mgv1a007671mg [Erythranthe guttata]
 gb|EYU45380.1| hypothetical protein MIMGU_mgv1a007671mg [Erythranthe guttata]
Length=399

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEVGQKITAGM+SMSFKMKE FQGPNQ DK+VEEATAETLDEP+WATNLEL
Sbjct  12   FGERLKIGGSEVGQKITAGMTSMSFKMKELFQGPNQTDKIVEEATAETLDEPDWATNLEL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N D++NSVELIRGIKKRI
Sbjct  72   CDMVNTDKINSVELIRGIKKRI  93



>ref|XP_002520034.1| protein transporter, putative [Ricinus communis]
 gb|EEF42358.1| protein transporter, putative [Ricinus communis]
Length=395

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGG+EVG+K+TAGMSSMSFK+KE FQGPNQADKLVE+ATAETL+EP+WA NL++
Sbjct  12   FGERLKIGGAEVGRKMTAGMSSMSFKVKELFQGPNQADKLVEDATAETLEEPDWAMNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+INH+RVNSVELIRGIKKRI
Sbjct  72   CDIINHERVNSVELIRGIKKRI  93



>ref|XP_002285602.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
 ref|XP_010644084.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
 ref|XP_010644085.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
Length=395

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGG EVG+K++AGMSSMSFKM+E FQGPNQ +K+VEEATAETLDEP+WA NL+L
Sbjct  12   LGERLKIGGVEVGKKMSAGMSSMSFKMRELFQGPNQTEKIVEEATAETLDEPDWALNLDL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N+D++NSVELIRGIKKRI
Sbjct  72   CDMVNNDKINSVELIRGIKKRI  93



>ref|XP_011006026.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
 ref|XP_011006027.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
 ref|XP_011006029.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
Length=394

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGG+EVG+K++AGMSSMSFK+KE  QGPNQADKLVE+ATAETLDEP+WA NL++
Sbjct  12   FGERLKIGGAEVGRKMSAGMSSMSFKVKELLQGPNQADKLVEDATAETLDEPDWAMNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH++V+SVELIRGIKKRI
Sbjct  72   CDMINHEKVSSVELIRGIKKRI  93



>emb|CAN70382.1| hypothetical protein VITISV_020135 [Vitis vinifera]
Length=431

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGG EVG+K++AGMSSMSFKM+E FQGPNQ +K+VEEATAETLDEP+WA NL+L
Sbjct  12   LGERLKIGGVEVGKKMSAGMSSMSFKMRELFQGPNQTEKIVEEATAETLDEPDWALNLDL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N+D++NSVELIRGIKKRI
Sbjct  72   CDMVNNDKINSVELIRGIKKRI  93



>ref|XP_007029586.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007029587.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
 gb|EOY10088.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
 gb|EOY10089.1| Target of Myb protein 1 isoform 1 [Theobroma cacao]
Length=401

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKI G+EVG+K++AGMSSMSFK+KE FQGPNQADKLVE+AT+ETLDEP+WA NLE+
Sbjct  12   FGERLKIEGAEVGRKVSAGMSSMSFKVKELFQGPNQADKLVEDATSETLDEPDWALNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH++++SVELIRGIK+RI
Sbjct  72   CDMINHEKISSVELIRGIKRRI  93



>gb|KHG10261.1| TOM1-like protein 2 [Gossypium arboreum]
Length=267

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLK+ G+EVG+K++AGMSSMSFKMKE FQGPN AD+LVE+AT+E LDEP+WA NL++
Sbjct  12   FGERLKVEGAEVGRKVSAGMSSMSFKMKELFQGPNPADQLVEDATSEALDEPDWAVNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH+RVNSV+LIRGIK+R+
Sbjct  72   CDMINHERVNSVDLIRGIKRRL  93



>gb|AGS41185.1| MYB transcription factor 9 [Tamarix hispida]
Length=392

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            L ERLKI GSEV +K+TAGMSSMSFKMKE F GPNQADK+VEEATAETLDEP W+ NLE+
Sbjct  12   LSERLKISGSEVSRKVTAGMSSMSFKMKELFNGPNQADKIVEEATAETLDEPEWSMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +R NSVE+IRGIKKRI
Sbjct  72   CDMINQERANSVEVIRGIKKRI  93



>ref|XP_010063284.1| PREDICTED: TOM1-like protein 2 [Eucalyptus grandis]
 ref|XP_010063292.1| PREDICTED: TOM1-like protein 2 [Eucalyptus grandis]
 ref|XP_010063301.1| PREDICTED: TOM1-like protein 2 [Eucalyptus grandis]
 gb|KCW90948.1| hypothetical protein EUGRSUZ_A02971 [Eucalyptus grandis]
 gb|KCW90949.1| hypothetical protein EUGRSUZ_A02971 [Eucalyptus grandis]
Length=395

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGG+EV +K++AGMSS+SFK+KE FQGPNQADK VEEAT+E+L+EP+WA NLE+
Sbjct  12   LGERLKIGGAEVSRKMSAGMSSVSFKVKELFQGPNQADKFVEEATSESLEEPDWAMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH+R+ SV+LIRGIKKRI
Sbjct  72   CDMINHERITSVDLIRGIKKRI  93



>ref|XP_011016801.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
Length=268

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GE LK GG+EVG+K++AGMSSMSFK+KE  QGPNQ DKLVE+ATAETLDEP+WA NL++
Sbjct  12   FGELLKTGGAEVGRKMSAGMSSMSFKVKELLQGPNQEDKLVEDATAETLDEPDWAMNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH++V+SVELIRGIKKRI
Sbjct  72   CDMINHEKVSSVELIRGIKKRI  93



>ref|XP_002275091.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
 ref|XP_010662111.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
 emb|CAN66798.1| hypothetical protein VITISV_044233 [Vitis vinifera]
Length=395

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERL+IGG EVG+K++ GMSSMSFKMKE FQGPNQA+K+V+EATAETLDEP+WA NL+L
Sbjct  12   LGERLRIGGVEVGRKMSEGMSSMSFKMKELFQGPNQAEKIVDEATAETLDEPDWALNLDL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN+++VN+V+LIRGIKKRI
Sbjct  72   CDMINNEKVNTVDLIRGIKKRI  93



>ref|XP_010671112.1| PREDICTED: TOM1-like protein 2 [Beta vulgaris subsp. vulgaris]
Length=395

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERL+IGGSEV +K++AG+SSMS KMKE FQGPNQADK+VEEATAETL++P+WATNLE+
Sbjct  12   LGERLRIGGSEVSKKMSAGVSSMSDKMKELFQGPNQADKIVEEATAETLEDPDWATNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN ++V+S+ELIRGIKKRI
Sbjct  72   CDMINQEKVSSIELIRGIKKRI  93



>gb|KJB18439.1| hypothetical protein B456_003G052900 [Gossypium raimondii]
 gb|KJB18440.1| hypothetical protein B456_003G052900 [Gossypium raimondii]
 gb|KJB18442.1| hypothetical protein B456_003G052900 [Gossypium raimondii]
Length=401

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLK+ G+EVG+K++AGMSSMSFKMKE FQGPN AD+LVE+AT+E LDEP+WA NL++
Sbjct  12   FGERLKVEGAEVGRKVSAGMSSMSFKMKELFQGPNPADQLVEDATSEALDEPDWAVNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH+RVNSV+LIRGIK+R+
Sbjct  72   CDMINHERVNSVDLIRGIKRRL  93



>ref|XP_010558637.1| PREDICTED: TOM1-like protein 2 [Tarenaya hassleriana]
 ref|XP_010558638.1| PREDICTED: TOM1-like protein 2 [Tarenaya hassleriana]
Length=401

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGG+E+ +K++AGM+SMSFK+KE FQGPN ADKLVE+AT+E L+EP+WA NLEL
Sbjct  12   FGERLKIGGTEMSKKVSAGMTSMSFKVKELFQGPNPADKLVEDATSENLEEPDWALNLEL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH+++NSV+LIRGIKKRI
Sbjct  72   CDMINHEKINSVDLIRGIKKRI  93



>ref|XP_011007173.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
 ref|XP_011007174.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
Length=394

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GE LK GG+EVG+K++AGMSSMSFK+KE  QGPNQ DKLVE+ATAETLDEP+WA NL++
Sbjct  12   FGELLKTGGAEVGRKMSAGMSSMSFKVKELLQGPNQEDKLVEDATAETLDEPDWAMNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH++V+SVELIRGIKKRI
Sbjct  72   CDMINHEKVSSVELIRGIKKRI  93



>ref|XP_006376006.1| hypothetical protein POPTR_0013s07880g [Populus trichocarpa]
 gb|ERP53803.1| hypothetical protein POPTR_0013s07880g [Populus trichocarpa]
Length=394

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GE LK GG+EVG+K++AGMSSMSFK+KE  QGPNQ DKLVE+ATAETLDEP+WA NL++
Sbjct  12   FGELLKTGGAEVGRKMSAGMSSMSFKVKELLQGPNQEDKLVEDATAETLDEPDWAMNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH++V+SVELIRGIKKRI
Sbjct  72   CDMINHEKVSSVELIRGIKKRI  93



>ref|XP_008234559.1| PREDICTED: target of Myb protein 1 [Prunus mume]
 ref|XP_008234560.1| PREDICTED: target of Myb protein 1 [Prunus mume]
 ref|XP_008234561.1| PREDICTED: target of Myb protein 1 [Prunus mume]
Length=396

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKI GSEVG+K++AG+SS+SFK+KE FQGPNQADK+VE+AT+E LDEP+WA NL++
Sbjct  12   FGERLKIEGSEVGRKMSAGLSSVSFKVKELFQGPNQADKIVEDATSEALDEPDWAMNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +RVNSVEL+RGIKKRI
Sbjct  72   CDMINTERVNSVELVRGIKKRI  93



>ref|XP_007218111.1| hypothetical protein PRUPE_ppa006768mg [Prunus persica]
 gb|EMJ19310.1| hypothetical protein PRUPE_ppa006768mg [Prunus persica]
Length=396

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKI GSEVG+K++AG+SS+SFK+KE FQGPNQADK+VE+AT+E LDEP+WA NL++
Sbjct  12   FGERLKIEGSEVGRKMSAGLSSVSFKVKELFQGPNQADKIVEDATSEALDEPDWAMNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +RVNSVEL+RGIKKRI
Sbjct  72   CDMINTERVNSVELVRGIKKRI  93



>ref|XP_009361163.1| PREDICTED: TOM1-like protein 2 isoform X2 [Pyrus x bretschneideri]
Length=396

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI GSEVG+K++AG SS+SFK+KE FQGPNQADK+VE+AT+E L+EP+WA NLE+
Sbjct  12   LGERLKIEGSEVGRKMSAGFSSVSFKVKELFQGPNQADKIVEDATSEALEEPDWAMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +RVNSVELIRG+KKRI
Sbjct  72   CDMINTERVNSVELIRGLKKRI  93



>ref|XP_009361159.1| PREDICTED: TOM1-like protein 2 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361160.1| PREDICTED: TOM1-like protein 2 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361161.1| PREDICTED: TOM1-like protein 2 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361162.1| PREDICTED: TOM1-like protein 2 isoform X1 [Pyrus x bretschneideri]
Length=397

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI GSEVG+K++AG SS+SFK+KE FQGPNQADK+VE+AT+E L+EP+WA NLE+
Sbjct  12   LGERLKIEGSEVGRKMSAGFSSVSFKVKELFQGPNQADKIVEDATSEALEEPDWAMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +RVNSVELIRG+KKRI
Sbjct  72   CDMINTERVNSVELIRGLKKRI  93



>ref|XP_004511421.1| PREDICTED: TOM1-like protein 2-like [Cicer arietinum]
Length=399

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGG EVG+K++ GMSSMSFK+KEFFQGPNQ DKLVE+AT+E+ +EP+WA NL+L
Sbjct  12   LGERLKIGGVEVGRKMSEGMSSMSFKVKEFFQGPNQVDKLVEDATSESHEEPDWAMNLDL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSVELIRGIKKRI
Sbjct  72   CDLINTEKVNSVELIRGIKKRI  93



>ref|XP_007157069.1| hypothetical protein PHAVU_002G040300g [Phaseolus vulgaris]
 gb|ESW29063.1| hypothetical protein PHAVU_002G040300g [Phaseolus vulgaris]
Length=403

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGG EVG+K+T GM+SMSFK++EFFQGPNQA+KLVE+AT+E LDEP+WA NL+L
Sbjct  12   LGERLKIGGVEVGRKMTEGMTSMSFKVREFFQGPNQAEKLVEDATSEALDEPDWALNLDL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN D+++ VELIRGIKKRI
Sbjct  72   CDLINTDKLSCVELIRGIKKRI  93



>ref|XP_004307860.1| PREDICTED: target of Myb protein 1 [Fragaria vesca subsp. vesca]
 ref|XP_011470127.1| PREDICTED: target of Myb protein 1 [Fragaria vesca subsp. vesca]
Length=395

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKI GSEVG+K++A +SS+SFK+KE FQGPNQ DK+VEEAT+E LDEP+WA NLE+
Sbjct  12   FGERLKIEGSEVGRKMSASLSSVSFKVKELFQGPNQGDKIVEEATSEALDEPDWALNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +RVNSVELIRGIKKRI
Sbjct  72   CDMINTERVNSVELIRGIKKRI  93



>ref|XP_009351819.1| PREDICTED: TOM1-like protein 2 [Pyrus x bretschneideri]
 ref|XP_009351820.1| PREDICTED: TOM1-like protein 2 [Pyrus x bretschneideri]
 ref|XP_009351821.1| PREDICTED: TOM1-like protein 2 [Pyrus x bretschneideri]
 ref|XP_009351822.1| PREDICTED: TOM1-like protein 2 [Pyrus x bretschneideri]
 ref|XP_009351823.1| PREDICTED: TOM1-like protein 2 [Pyrus x bretschneideri]
Length=396

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI G+EVG+K++AG SS+SFK+KE FQGPNQADK+VE+AT+E L+EP+WA NLE+
Sbjct  12   LGERLKIEGTEVGRKMSAGFSSVSFKVKELFQGPNQADKIVEDATSEALEEPDWAMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +RVNSVELIRG+KKRI
Sbjct  72   CDMINTERVNSVELIRGLKKRI  93



>ref|XP_008382040.1| PREDICTED: TOM1-like protein 2 [Malus domestica]
 ref|XP_008382046.1| PREDICTED: TOM1-like protein 2 [Malus domestica]
 ref|XP_008382053.1| PREDICTED: TOM1-like protein 2 [Malus domestica]
 ref|XP_008382062.1| PREDICTED: TOM1-like protein 2 [Malus domestica]
 ref|XP_008382070.1| PREDICTED: TOM1-like protein 2 [Malus domestica]
Length=396

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI G+EVG+K++AG SS+SFK+KE FQGPNQADK+VE+AT+E L+EP+WA NLE+
Sbjct  12   LGERLKIEGTEVGRKMSAGFSSVSFKVKELFQGPNQADKIVEDATSEALEEPDWAMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +RVNSVELIRG+KKRI
Sbjct  72   CDMINTERVNSVELIRGLKKRI  93



>ref|XP_008376920.1| PREDICTED: TOM1-like protein 2 isoform X1 [Malus domestica]
 ref|XP_008376921.1| PREDICTED: TOM1-like protein 2 isoform X1 [Malus domestica]
 ref|XP_008376922.1| PREDICTED: TOM1-like protein 2 isoform X1 [Malus domestica]
Length=397

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI G+EVG+K++AG SS+SFK+KE FQGPNQADK+VE+AT+E L+EP+WA NLE+
Sbjct  12   LGERLKIEGTEVGRKMSAGFSSVSFKVKELFQGPNQADKIVEDATSEALEEPDWAMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +RVNSVELIRG+KKRI
Sbjct  72   CDMINTERVNSVELIRGLKKRI  93



>ref|XP_008376923.1| PREDICTED: TOM1-like protein 2 isoform X2 [Malus domestica]
Length=396

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI G+EVG+K++AG SS+SFK+KE FQGPNQADK+VE+AT+E L+EP+WA NLE+
Sbjct  12   LGERLKIEGTEVGRKMSAGFSSVSFKVKELFQGPNQADKIVEDATSEALEEPDWAMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +RVNSVELIRG+KKRI
Sbjct  72   CDMINTERVNSVELIRGLKKRI  93



>ref|XP_010267653.1| PREDICTED: TOM1-like protein 2 [Nelumbo nucifera]
 ref|XP_010267655.1| PREDICTED: TOM1-like protein 2 [Nelumbo nucifera]
 ref|XP_010267656.1| PREDICTED: TOM1-like protein 2 [Nelumbo nucifera]
 ref|XP_010267657.1| PREDICTED: TOM1-like protein 2 [Nelumbo nucifera]
Length=393

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             G+RLKI G EVG+K++AGMSSMSFK+KE FQGPNQA+K+VE+ATAETLD P+WATNL++
Sbjct  12   FGQRLKIEGVEVGRKMSAGMSSMSFKVKELFQGPNQAEKVVEDATAETLDGPDWATNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N++++NS+ELIRGIKKRI
Sbjct  72   CDMVNNEKINSIELIRGIKKRI  93



>ref|XP_006297827.1| hypothetical protein CARUB_v10013862mg [Capsella rubella]
 gb|EOA30725.1| hypothetical protein CARUB_v10013862mg [Capsella rubella]
Length=402

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
              ERLKIGGSEV +K+TAG+SSMSFK+KE FQGPN  DKLVEEAT+E L EP+WA NLEL
Sbjct  12   FSERLKIGGSEVSKKVTAGVSSMSFKVKELFQGPNPTDKLVEEATSENLQEPDWAMNLEL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +++NSV+LIRGIKKRI
Sbjct  72   CDMINQEKINSVDLIRGIKKRI  93



>ref|NP_001239879.1| uncharacterized protein LOC100793134 [Glycine max]
 gb|ACU21048.1| unknown [Glycine max]
 gb|KHN34144.1| TOM1-like protein 2 [Glycine soja]
Length=405

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQ-GPNQADKLVEEATAETLDEPNWATNLE  364
            LGERLKIGG EVG+K++ GMSSMSFK+KEFFQ GPNQADKLVE+AT+E LDEP WA NL+
Sbjct  12   LGERLKIGGVEVGRKMSEGMSSMSFKLKEFFQPGPNQADKLVEDATSEALDEPEWALNLD  71

Query  365  LCDMINHDRVNSVELIRGIKKRI  433
            LCD++N D++N VEL+RGIKKRI
Sbjct  72   LCDLVNTDKLNCVELVRGIKKRI  94



>gb|KJB82228.1| hypothetical protein B456_013G183000 [Gossypium raimondii]
Length=416

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +2

Query  143  GFVKDERQFDG*SQLLGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEAT  322
            G +K E++        GER+K+ G+E+G+K++AGMSSMSFK+KE FQGPN  DKLVE+AT
Sbjct  12   GLLKMEKELMDKVGAFGERIKVEGAELGRKMSAGMSSMSFKVKELFQGPNPTDKLVEDAT  71

Query  323  AETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            +E LDEP+WA NL++CDM+NH++VNSVELIRGIK+RI
Sbjct  72   SEALDEPDWALNLDICDMVNHEKVNSVELIRGIKRRI  108



>gb|KJB82229.1| hypothetical protein B456_013G183000 [Gossypium raimondii]
 gb|KJB82230.1| hypothetical protein B456_013G183000 [Gossypium raimondii]
Length=401

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GER+K+ G+E+G+K++AGMSSMSFK+KE FQGPN  DKLVE+AT+E LDEP+WA NL++
Sbjct  12   FGERIKVEGAELGRKMSAGMSSMSFKVKELFQGPNPTDKLVEDATSEALDEPDWALNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+NH++VNSVELIRGIK+RI
Sbjct  72   CDMVNHEKVNSVELIRGIKRRI  93



>ref|XP_010549833.1| PREDICTED: TOM1-like protein 2 [Tarenaya hassleriana]
 ref|XP_010549834.1| PREDICTED: TOM1-like protein 2 [Tarenaya hassleriana]
Length=393

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERL IGG+E+ +K++AGMSSMSFK+KEFFQGPN AD+LVE+AT+E L+EP+W  NLE+
Sbjct  12   FGERLMIGGTEMSKKVSAGMSSMSFKVKEFFQGPNPADQLVEDATSENLEEPDWDMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH+++NSV+LIRGIKKRI
Sbjct  72   CDMINHEKINSVDLIRGIKKRI  93



>gb|KHF97708.1| TOM1-like protein 2 [Gossypium arboreum]
Length=401

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GER+K+ G+E+G+K++AGMSSMSFK+KE FQGPN  DKLVE+AT+E LDEP+WA NL++
Sbjct  12   FGERIKVEGAELGRKMSAGMSSMSFKVKELFQGPNPIDKLVEDATSEALDEPDWALNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+NH++VNSVELIRGIK+RI
Sbjct  72   CDMVNHEKVNSVELIRGIKRRI  93



>ref|XP_004167394.1| PREDICTED: TOM1-like protein 2-like [Cucumis sativus]
Length=396

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI G+E+ +K++AG+SSMSFKMKE FQGPNQ DKL E+ATAETL+EP+WA NLE+
Sbjct  12   LGERLKISGTEMSRKMSAGVSSMSFKMKELFQGPNQGDKLAEDATAETLEEPDWALNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N +++NS++LIRGIKKRI
Sbjct  72   CDMVNSEKINSIDLIRGIKKRI  93



>ref|XP_008452808.1| PREDICTED: TOM1-like protein 2 [Cucumis melo]
 ref|XP_008452814.1| PREDICTED: TOM1-like protein 2 [Cucumis melo]
Length=396

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI G+E+ +K++AG+SSMSFKMKE FQGPNQ DKL E+ATAETL+EP+WA NLE+
Sbjct  12   LGERLKISGTEMSRKMSAGVSSMSFKMKELFQGPNQGDKLAEDATAETLEEPDWALNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N +++NS++LIRGIKKRI
Sbjct  72   CDMVNSEKINSIDLIRGIKKRI  93



>ref|XP_004144724.1| PREDICTED: TOM1-like protein 2-like [Cucumis sativus]
 gb|KGN61050.1| hypothetical protein Csa_2G035500 [Cucumis sativus]
Length=396

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI G+E+ +K++AG+SSMSFKMKE FQGPNQ DKL E+ATAETL+EP+WA NLE+
Sbjct  12   LGERLKISGTEMSRKMSAGVSSMSFKMKELFQGPNQGDKLAEDATAETLEEPDWALNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N +++NS++LIRGIKKRI
Sbjct  72   CDMVNSEKINSIDLIRGIKKRI  93



>ref|XP_010919989.1| PREDICTED: TOM1-like protein 2 [Elaeis guineensis]
 ref|XP_010919990.1| PREDICTED: TOM1-like protein 2 [Elaeis guineensis]
 ref|XP_010919991.1| PREDICTED: TOM1-like protein 2 [Elaeis guineensis]
Length=387

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GE LK  G+EVG+K++AGMSSMSFKMKEFFQG NQA+K+VEEAT+E LDEP+W+TNLE+
Sbjct  7    FGELLKNSGAEVGRKMSAGMSSMSFKMKEFFQGQNQAEKIVEEATSENLDEPDWSTNLEI  66

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +++NSVEL+RGIKKRI
Sbjct  67   CDMINSEKINSVELVRGIKKRI  88



>ref|XP_010453865.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
Length=406

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEV  KI+AG+SSMSFK+KE FQGPN  DK+VE+AT E L+EP+W  NLE+
Sbjct  12   FGERLKIGGSEVSNKISAGVSSMSFKVKELFQGPNPTDKIVEDATTENLEEPDWDMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH+ +NS+ELIRGIKKRI
Sbjct  72   CDMINHETINSIELIRGIKKRI  93



>ref|XP_009121426.1| PREDICTED: TOM1-like protein 2 [Brassica rapa]
Length=409

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEV  KITAGMSSMSFK+KE FQGPN  DK+VE+AT+E L+EP+W  NLE+
Sbjct  12   FGERLKIGGSEVSNKITAGMSSMSFKVKELFQGPNPTDKIVEDATSENLEEPDWDMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN + +NSV+LIRGIKKRI
Sbjct  72   CDMINQETINSVDLIRGIKKRI  93



>emb|CDX69412.1| BnaA10g17610D [Brassica napus]
Length=409

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEV  KITAGMSSMSFK+KE FQGPN  DK+VE+AT+E L+EP+W  NLE+
Sbjct  12   FGERLKIGGSEVSNKITAGMSSMSFKVKELFQGPNPTDKIVEDATSENLEEPDWDMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN + +NSV+LIRGIKKRI
Sbjct  72   CDMINQETINSVDLIRGIKKRI  93



>emb|CDY16971.1| BnaC09g40980D [Brassica napus]
Length=409

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEV  KITAGMSSMSFK+KE FQGPN  DK+VE+AT+E L+EP+W  NLE+
Sbjct  12   FGERLKIGGSEVSNKITAGMSSMSFKVKELFQGPNPTDKIVEDATSENLEEPDWDMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN + +NSV+LIRGIKKRI
Sbjct  72   CDMINQETINSVDLIRGIKKRI  93



>gb|ACJ85033.1| unknown [Medicago truncatula]
Length=315

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GE+LKIGG EVG+K+T GMSSMSFK+KEFF GPNQ DKLVE+AT+E  +EP+WA NL+L
Sbjct  12   FGEKLKIGGVEVGRKVTEGMSSMSFKVKEFFNGPNQVDKLVEDATSEAHEEPDWAMNLDL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSVELIR IKKRI
Sbjct  72   CDLINTEKVNSVELIRAIKKRI  93



>gb|KDO47246.1| hypothetical protein CISIN_1g01611221mg, partial [Citrus sinensis]
Length=255

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGG+EVG+K++ GMS MSFKMKE FQGPN  +KLVE+AT+E L+EP+WA NL+L
Sbjct  12   FGERLKIGGAEVGRKMSEGMSQMSFKMKELFQGPNPVEKLVEDATSEALEEPDWAMNLDL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN ++++SV+LIRGIKKRI
Sbjct  72   CDMINTEKISSVDLIRGIKKRI  93



>ref|NP_850834.1| Target of Myb protein 1 [Arabidopsis thaliana]
 gb|AED92352.1| Target of Myb protein 1 [Arabidopsis thaliana]
Length=297

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEV  KI+AG+SSMSFK+KE FQGPN  DK+VE+AT E L+EP+W  NLE+
Sbjct  12   FGERLKIGGSEVSNKISAGVSSMSFKVKELFQGPNPTDKIVEDATTENLEEPDWDMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN + +NSVELIRGIKKRI
Sbjct  72   CDMINQETINSVELIRGIKKRI  93



>ref|XP_010525051.1| PREDICTED: TOM1-like protein 2 [Tarenaya hassleriana]
Length=404

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGG+E+ +K++AG+SSMSFK+KE FQGPN ADK+VE+AT+E L+EP+WA NLE+
Sbjct  12   FGERLKIGGTEMSKKVSAGVSSMSFKVKELFQGPNPADKIVEDATSENLEEPDWAMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +++NSV+LIRGIKKR+
Sbjct  72   CDMINQEKINSVDLIRGIKKRM  93



>ref|XP_010087473.1| TOM1-like protein 2 [Morus notabilis]
 gb|EXB29154.1| TOM1-like protein 2 [Morus notabilis]
Length=400

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKI G+EVG+K++AG+SSMS KMKE FQGPNQADKL E+AT+E L+EP+WA NL++
Sbjct  12   FGERLKIEGTEVGKKMSAGISSMSVKMKELFQGPNQADKLAEDATSEALEEPDWALNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +++NSVELIRGIK+RI
Sbjct  72   CDMINTEKLNSVELIRGIKRRI  93



>ref|XP_002871740.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47999.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=406

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEV  KI+AG+SSMSFK+KE FQGPN  DK+VE+AT E L+EP+W  NLE+
Sbjct  12   FGERLKIGGSEVSNKISAGVSSMSFKLKELFQGPNPTDKIVEDATTENLEEPDWDMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN + +NSVELIRGIKKRI
Sbjct  72   CDMINQETINSVELIRGIKKRI  93



>ref|XP_006287873.1| hypothetical protein CARUB_v10001100mg [Capsella rubella]
 gb|EOA20771.1| hypothetical protein CARUB_v10001100mg [Capsella rubella]
Length=406

 Score =   132 bits (333),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEV  KI+AG+SSMSFK+KE FQGPN  DK+VE+AT E L+EP+W  NLE+
Sbjct  12   FGERLKIGGSEVSNKISAGVSSMSFKVKELFQGPNPTDKIVEDATTENLEEPDWDMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN + +NSVELIRGIKKRI
Sbjct  72   CDMINQETINSVELIRGIKKRI  93



>emb|CDX70725.1| BnaC03g08090D [Brassica napus]
Length=405

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEV  KITAG+SSMS KMKE FQGPN  DK+VE+AT+E L+EP+W  NLE+
Sbjct  13   FGERLKIGGSEVSNKITAGVSSMSLKMKELFQGPNPTDKIVEDATSENLEEPDWDMNLEI  72

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN + +NSV+LIRGIKKRI
Sbjct  73   CDMINQETINSVDLIRGIKKRI  94



>emb|CDX78717.1| BnaA03g06290D [Brassica napus]
Length=406

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEV  KITAG+SSMS KMKE FQGPN  DK+VE+AT+E L+EP+W  NLE+
Sbjct  13   FGERLKIGGSEVSNKITAGVSSMSLKMKELFQGPNPTDKIVEDATSENLEEPDWDMNLEI  72

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN + +NSV+LIRGIKKRI
Sbjct  73   CDMINQETINSVDLIRGIKKRI  94



>ref|XP_003610830.1| Hepatocyte growth factor-regulated tyrosine kinase substrate 
[Medicago truncatula]
 gb|AES93788.1| protein transporter [Medicago truncatula]
Length=399

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GE+LKIGG EVG+K+T GMSSMSFK+KEFF GPNQ DKLVE+AT+E  +EP+WA NL+L
Sbjct  12   FGEKLKIGGVEVGRKVTEGMSSMSFKVKEFFNGPNQVDKLVEDATSEAHEEPDWAMNLDL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSVELIR IKKRI
Sbjct  72   CDLINTEKVNSVELIRAIKKRI  93



>ref|XP_006408352.1| hypothetical protein EUTSA_v10020862mg [Eutrema salsugineum]
 gb|ESQ49805.1| hypothetical protein EUTSA_v10020862mg [Eutrema salsugineum]
Length=401

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
              ERLKIGGSEV +K++AG+SSMSFK+KE FQGPN  DKL E+AT+E L+EP+WA NLE+
Sbjct  12   FSERLKIGGSEVSKKVSAGVSSMSFKVKELFQGPNPTDKLAEDATSENLEEPDWAMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +++NSV+LIRGIKKRI
Sbjct  72   CDMINQEKINSVDLIRGIKKRI  93



>gb|ABR28337.1| MYB transcription factor MYB49 [Medicago truncatula]
Length=399

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GE+LKIGG EVG+K+T GMSSMSFK+KEFF GPNQ DKLVE+AT+E  +EP+WA NL+L
Sbjct  12   FGEKLKIGGVEVGRKVTEGMSSMSFKVKEFFNGPNQVDKLVEDATSEAHEEPDWAMNLDL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSVELIR IKKRI
Sbjct  72   CDLINTEKVNSVELIRAIKKRI  93



>ref|XP_009131569.1| PREDICTED: TOM1-like protein 2 [Brassica rapa]
Length=406

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEV  KITAG+SSMS KMKE FQGPN  DK+VE+AT+E L+EP+W  NLE+
Sbjct  13   FGERLKIGGSEVSNKITAGVSSMSLKMKELFQGPNPTDKIVEDATSENLEEPDWDMNLEI  72

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN + +NSV+LIRGIKKRI
Sbjct  73   CDMINQETINSVDLIRGIKKRI  94



>ref|XP_006400231.1| hypothetical protein EUTSA_v10013718mg [Eutrema salsugineum]
 gb|ESQ41684.1| hypothetical protein EUTSA_v10013718mg [Eutrema salsugineum]
Length=402

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGGSEV  KI+AG+SSMSFK+KE FQGPN  DK+VE+AT E L+EP+W  NLE+
Sbjct  12   LGERLKIGGSEVSNKISAGVSSMSFKVKELFQGPNPTDKIVEDATTENLEEPDWDMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN + +NSV+LIRGIKKRI
Sbjct  72   CDMINQETINSVDLIRGIKKRI  93



>gb|ABG66292.1| VHS domain-containing protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=193

 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLK+ G+EV +K++AG+S+MSFKMKEFFQG N ADK+V+EAT ET+D P+WATNLE+
Sbjct  12   LGERLKVSGAEVSRKMSAGVSNMSFKMKEFFQGQNMADKIVDEATLETMDAPDWATNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N   VNS+ELIR IK+RI
Sbjct  72   CDMVNTGNVNSIELIRAIKRRI  93



>ref|NP_197190.1| Target of Myb protein 1 [Arabidopsis thaliana]
 ref|NP_850833.1| Target of Myb protein 1 [Arabidopsis thaliana]
 emb|CAC01701.1| TOM (target of myb1)-like protein [Arabidopsis thaliana]
 gb|AAL10477.1| AT5g16880/F2K13_30 [Arabidopsis thaliana]
 gb|AAL32718.1| TOM (target of myb1)-like protein [Arabidopsis thaliana]
 gb|AAM61693.1| TOM (target of myb1)-like protein [Arabidopsis thaliana]
 gb|AAO00913.1| TOM (target of myb1)-like protein [Arabidopsis thaliana]
 gb|AED92353.1| Target of Myb protein 1 [Arabidopsis thaliana]
 gb|AED92354.1| Target of Myb protein 1 [Arabidopsis thaliana]
Length=407

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEV  KI+AG+SSMSFK+KE FQGPN  DK+VE+AT E L+EP+W  NLE+
Sbjct  12   FGERLKIGGSEVSNKISAGVSSMSFKVKELFQGPNPTDKIVEDATTENLEEPDWDMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN + +NSVELIRGIKKRI
Sbjct  72   CDMINQETINSVELIRGIKKRI  93



>gb|KDP21763.1| hypothetical protein JCGZ_00550 [Jatropha curcas]
Length=395

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGG+EVG+K+TAGMSSMSFKMKE FQGPNQADKLVEEATAETL+EP+WA NL++
Sbjct  12   FGERLKIGGAEVGRKMTAGMSSMSFKMKELFQGPNQADKLVEEATAETLEEPDWALNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH++V+SVELIRGIKKRI
Sbjct  72   CDMINHEKVSSVELIRGIKKRI  93



>ref|XP_008800065.1| PREDICTED: TOM1-like protein 2 [Phoenix dactylifera]
Length=392

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GE LK  G+EV +K++AGMSSMSFKMKE FQG NQA+K+VEEAT+E LDEP+W+TNLE+
Sbjct  12   FGELLKNSGAEVSRKMSAGMSSMSFKMKELFQGQNQAEKIVEEATSENLDEPDWSTNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +++NSVELIRGIKKRI
Sbjct  72   CDMINSEKINSVELIRGIKKRI  93



>ref|XP_006647730.1| PREDICTED: TOM1-like protein 2-like [Oryza brachyantha]
Length=392

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKI GSEV +K+TAGMSSMSFKMKE FQG   ADK+VEEAT+E LD P+W+ NLE+
Sbjct  12   FGERLKITGSEVSKKMTAGMSSMSFKMKELFQGQTPADKIVEEATSENLDGPDWSANLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSVELIRGIKKRI
Sbjct  72   CDLINTEKVNSVELIRGIKKRI  93



>ref|XP_010420395.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
 ref|XP_010420396.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
Length=406

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEV  KI+AG+SSMSFK+KE FQGPN  DK+VE+AT E L+EP+W  NLE+
Sbjct  12   FGERLKIGGSEVSNKISAGVSSMSFKVKELFQGPNPTDKIVEDATTENLEEPDWDMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN + +NS+ELIRGIKKRI
Sbjct  72   CDMINQETINSIELIRGIKKRI  93



>ref|NP_001047818.1| Os02g0697300 [Oryza sativa Japonica Group]
 dbj|BAD07858.1| putative target of myb1 [Oryza sativa Japonica Group]
 dbj|BAD08174.1| putative target of myb1 [Oryza sativa Japonica Group]
 emb|CAD44613.1| TOM1 protein [Oryza sativa Japonica Group]
 dbj|BAF09732.1| Os02g0697300 [Oryza sativa Japonica Group]
 gb|ACF60469.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAG89776.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73834.1| hypothetical protein OsI_08568 [Oryza sativa Indica Group]
 gb|EEE57625.1| hypothetical protein OsJ_08026 [Oryza sativa Japonica Group]
Length=392

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKI GSEV +K+TAGMSSMSFKMKE FQG   ADK+VEEAT+E LD P+W+ NLE+
Sbjct  12   FGERLKITGSEVSKKMTAGMSSMSFKMKEIFQGQTPADKIVEEATSENLDGPDWSANLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSVELIRGIKKRI
Sbjct  72   CDLINTEKVNSVELIRGIKKRI  93



>ref|XP_006443227.1| hypothetical protein CICLE_v10020497mg [Citrus clementina]
 ref|XP_006478931.1| PREDICTED: TOM1-like protein 2-like isoform X1 [Citrus sinensis]
 ref|XP_006478932.1| PREDICTED: TOM1-like protein 2-like isoform X2 [Citrus sinensis]
 gb|ESR56467.1| hypothetical protein CICLE_v10020497mg [Citrus clementina]
Length=395

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGG+EVG+K++ GMS MSFKMKE FQGPN  +KLVE+AT+E L+EP+WA NL+L
Sbjct  12   FGERLKIGGAEVGRKMSEGMSQMSFKMKELFQGPNPVEKLVEDATSEALEEPDWAMNLDL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN ++++SV+LIRGIKKRI
Sbjct  72   CDMINTEKISSVDLIRGIKKRI  93



>ref|NP_001065496.1| Os10g0578000 [Oryza sativa Japonica Group]
 dbj|BAF27333.1| Os10g0578000 [Oryza sativa Japonica Group]
Length=241

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLK+ G+EV +K++AG+S+MSFKMKEFFQG N ADK+V+EAT ET+D P+WATNLE+
Sbjct  12   LGERLKVSGAEVSRKMSAGVSNMSFKMKEFFQGQNMADKIVDEATLETMDAPDWATNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N   VNS+ELIR IK+RI
Sbjct  72   CDMVNTGNVNSIELIRAIKRRI  93



>ref|XP_010492622.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
Length=425

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEV  KI+AG+SSMSFK+KE FQGPN  DK+VE+AT E L+EP+W  NLE+
Sbjct  12   FGERLKIGGSEVSNKISAGVSSMSFKVKELFQGPNPTDKIVEDATTENLEEPDWDMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN + +NS+ELIRGIKKRI
Sbjct  72   CDMINQETINSIELIRGIKKRI  93



>gb|EMS54006.1| TOM1-like protein 2 [Triticum urartu]
Length=397

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI G+EV +K++ G++SMSFKMKEFFQG N ADK+V+EAT ET+D P+WATNLE+
Sbjct  12   LGERLKISGAEVSRKMSTGVTSMSFKMKEFFQGQNMADKIVDEATLETMDGPDWATNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM N +RVNSVELIR IK+RI
Sbjct  72   CDMANTERVNSVELIRAIKRRI  93



>ref|XP_002882268.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58527.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=416

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
              ERLKIGGSEV +K+TAG+SSMSFK+KE FQGPN  DKLVE+AT+E L++P+WA NLE+
Sbjct  12   FSERLKIGGSEVSKKVTAGVSSMSFKVKELFQGPNPTDKLVEDATSENLEQPDWAMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN +++ SV+LIRGIKKRI
Sbjct  72   CDMINQEKIISVDLIRGIKKRI  93



>ref|XP_004983533.1| PREDICTED: TOM1-like protein 2-like [Setaria italica]
Length=396

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI G+EV +K++ G+S+MSFKMKEFFQG N ADK+V+EAT ET+D P+WATNLE+
Sbjct  12   LGERLKISGAEVSRKMSVGVSNMSFKMKEFFQGQNMADKIVDEATLETMDAPDWATNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N +R NSVE+IR IK+RI
Sbjct  72   CDMVNTERANSVEVIRAIKRRI  93



>gb|EMS45324.1| TOM1-like protein 2 [Triticum urartu]
Length=391

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI GSEVG+++ AGMSSMSFKMKE FQ    ADK+VE+ATAETL+ P+WA NLE+
Sbjct  12   LGERLKITGSEVGKQMQAGMSSMSFKMKELFQAQTPADKIVEDATAETLEGPDWAANLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSV+LIRGIKKRI
Sbjct  72   CDLINTEKVNSVDLIRGIKKRI  93



>gb|EMT15900.1| TOM1-like protein 2 [Aegilops tauschii]
Length=434

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI G+EV +K++ G++SMSFKMKEFFQG N ADK+V+EAT ET+D P+WATNLE+
Sbjct  12   LGERLKISGAEVSRKMSTGVTSMSFKMKEFFQGQNMADKIVDEATLETMDGPDWATNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM N +RVNSVELIR IK+RI
Sbjct  72   CDMANTERVNSVELIRAIKRRI  93



>gb|KHG15259.1| TOM1-like protein 2 [Gossypium arboreum]
Length=401

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GE LK  G+EVG+K++AGMSS+SFK+KE FQGPN ADKLV++AT+E LDEP+WA NL++
Sbjct  12   FGELLKTEGAEVGRKMSAGMSSVSFKVKELFQGPNPADKLVDDATSEALDEPDWALNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH++++SVELIRGIK++I
Sbjct  72   CDMINHEKISSVELIRGIKRKI  93



>ref|XP_006854075.1| hypothetical protein AMTR_s00048p00118270 [Amborella trichopoda]
 gb|ERN15542.1| hypothetical protein AMTR_s00048p00118270 [Amborella trichopoda]
Length=400

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGGSEVG+K++AGMSSMSFKMKE FQG NQA+K+VEEATAET+D P+W++NLE+
Sbjct  13   FGERLKIGGSEVGRKMSAGMSSMSFKMKELFQGQNQAEKIVEEATAETMDGPDWSSNLEI  72

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N ++++S ++IR +KKRI
Sbjct  73   CDMVNGEKISSQDVIRALKKRI  94



>gb|KJB26742.1| hypothetical protein B456_004G257100 [Gossypium raimondii]
 gb|KJB26743.1| hypothetical protein B456_004G257100 [Gossypium raimondii]
 gb|KJB26744.1| hypothetical protein B456_004G257100 [Gossypium raimondii]
Length=401

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GE LK  G+EVG+K++AGMSS+SFK+KE FQGPN ADKLV++AT+E LDEP+WA NL++
Sbjct  12   FGELLKTEGAEVGRKMSAGMSSVSFKVKELFQGPNPADKLVDDATSEALDEPDWALNLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH++++SVELIRGIK++I
Sbjct  72   CDMINHEKISSVELIRGIKRKI  93



>gb|AFK35545.1| unknown [Medicago truncatula]
Length=399

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GE+LKIGG EVG+K+T GMSSMSFK+KEFF GPNQ DKLVE+AT+E  +EP+WA NL+L
Sbjct  12   FGEKLKIGGVEVGRKVTEGMSSMSFKVKEFFNGPNQVDKLVEDATSEAHEEPDWAMNLDL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++V+SVELIR IK+RI
Sbjct  72   CDLINTEKVDSVELIRAIKERI  93



>gb|AAL58181.1|AC027037_3 hepatocyte growth factor-regulated tyrosine kinase substrate-like 
protein [Oryza sativa Japonica Group]
 gb|AAP55166.1| VHS domain-containing protein, putative, expressed [Oryza sativa 
Japonica Group]
 emb|CAD44616.1| TOM2 protein [Oryza sativa Japonica Group]
 gb|ABB48032.2| VHS domain-containing protein, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ17090.1| hypothetical protein OsJ_32588 [Oryza sativa Japonica Group]
Length=387

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLK+ G+EV +K++AG+S+MSFKMKEFFQG N ADK+V+EAT ET+D P+WATNLE+
Sbjct  12   LGERLKVSGAEVSRKMSAGVSNMSFKMKEFFQGQNMADKIVDEATLETMDAPDWATNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N   VNS+ELIR IK+RI
Sbjct  72   CDMVNTGNVNSIELIRAIKRRI  93



>gb|EAY79641.1| hypothetical protein OsI_34785 [Oryza sativa Indica Group]
Length=387

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLK+ G+EV +K++AG+S+MSFKMKEFFQG N ADK+V+EAT ET+D P+WATNLE+
Sbjct  12   LGERLKVSGAEVSRKMSAGVSNMSFKMKEFFQGQNMADKIVDEATLETMDAPDWATNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N   VNS+ELIR IK+RI
Sbjct  72   CDMVNTGNVNSIELIRAIKRRI  93



>ref|XP_008813149.1| PREDICTED: TOM1-like protein 2 [Phoenix dactylifera]
 ref|XP_008813150.1| PREDICTED: TOM1-like protein 2 [Phoenix dactylifera]
Length=390

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERL+IGG+EVGQK+  GMSSMS KMKE FQG NQA+K+VEEATAETL+ P+W+ NLE+
Sbjct  12   FGERLRIGGAEVGQKMKTGMSSMSLKMKELFQGQNQAEKIVEEATAETLEGPDWSNNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSVELIR IK RI
Sbjct  72   CDLINGEKVNSVELIRAIKNRI  93



>ref|XP_003574387.1| PREDICTED: TOM1-like protein 2 [Brachypodium distachyon]
 ref|XP_010235041.1| PREDICTED: TOM1-like protein 2 [Brachypodium distachyon]
Length=398

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI G+EV +K++ G++SMSFKMKEFFQG N ADK+V+EAT ET+D P+WATNLE+
Sbjct  12   LGERLKISGAEVSRKMSTGVTSMSFKMKEFFQGQNMADKIVDEATPETMDGPDWATNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM N  +VNSVELIR IK+RI
Sbjct  72   CDMANTGKVNSVELIRAIKRRI  93



>ref|XP_004953557.1| PREDICTED: TOM1-like protein 2-like isoform X1 [Setaria italica]
 ref|XP_004953558.1| PREDICTED: TOM1-like protein 2-like isoform X2 [Setaria italica]
 ref|XP_004953559.1| PREDICTED: TOM1-like protein 2-like isoform X3 [Setaria italica]
Length=391

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKI G+EV +K+TAGMSSMSFKMKE FQG   ADK+VE+AT+E LD P+W +NLE+
Sbjct  12   FGERLKITGTEVSKKMTAGMSSMSFKMKELFQGQTPADKIVEDATSENLDGPDWNSNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD++N ++VNSVELIRGIKKRI
Sbjct  72   CDLVNTEKVNSVELIRGIKKRI  93



>ref|XP_003570152.1| PREDICTED: TOM1-like protein 2 [Brachypodium distachyon]
Length=391

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI GSEV +++ AGMSSMSFKMKE FQ P  ADK+VE+ATAE L+ P+W+ NLE+
Sbjct  12   LGERLKITGSEVSKQMAAGMSSMSFKMKELFQAPTPADKIVEDATAENLEGPDWSANLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSV+LIRGIKKRI
Sbjct  72   CDLINTEKVNSVDLIRGIKKRI  93



>gb|AFW72919.1| putative VHS/GAT domain containing family protein [Zea mays]
Length=261

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKI G+EV +K+TAGMSSMSFKMKE FQG   ADK+VE AT+E LD P+W +NLE+
Sbjct  12   FGERLKITGTEVSKKMTAGMSSMSFKMKELFQGQTPADKIVEGATSEDLDGPDWNSNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN ++V+SVELIRGIKKRI
Sbjct  72   CDMINTEKVDSVELIRGIKKRI  93



>ref|XP_006662105.1| PREDICTED: TOM1-like protein 2-like [Oryza brachyantha]
Length=388

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI G+EV +K++AG+S+MSFKMKEFFQG N ADK+V+EAT ET+D P+W TNLE+
Sbjct  13   LGERLKISGAEVSRKMSAGVSNMSFKMKEFFQGQNMADKIVDEATLETMDAPDWPTNLEI  72

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N   VNS+ELIR IK+RI
Sbjct  73   CDMVNTGNVNSIELIRAIKRRI  94



>ref|XP_003580255.1| PREDICTED: TOM1-like protein 2 [Brachypodium distachyon]
Length=392

 Score =   127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            L ERLKI GSEV +K+TAGMSSMSFKMKE FQ    ADK VEEAT+E LD P+W+ NLE+
Sbjct  12   LSERLKITGSEVSKKMTAGMSSMSFKMKELFQAQTPADKFVEEATSENLDGPDWSANLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSV+LIRGIKKRI
Sbjct  72   CDLINSEKVNSVDLIRGIKKRI  93



>gb|EMT04498.1| TOM1-like protein 2 [Aegilops tauschii]
Length=411

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI GSEVG+++ AGMSSMSFKMKE FQ    ADK+VE+ATAE L+ P+WA NLE+
Sbjct  12   LGERLKITGSEVGKQMQAGMSSMSFKMKELFQAQTPADKIVEDATAENLEGPDWAANLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSV+LIRGIKKRI
Sbjct  72   CDLINTEKVNSVDLIRGIKKRI  93



>ref|NP_001132563.1| putative VHS/GAT domain containing family protein [Zea mays]
 ref|XP_008676614.1| PREDICTED: putative VHS/GAT domain containing family protein 
isoform X1 [Zea mays]
 gb|ACF81454.1| unknown [Zea mays]
 gb|ACG34295.1| protein transporter [Zea mays]
 gb|AFW63471.1| putative VHS/GAT domain containing family protein [Zea mays]
Length=391

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKI G+EV +K+TAGMSSMSFKMKE FQG   ADK+VE+AT+E LD P+W +NLE+
Sbjct  12   FGERLKITGTEVSKKMTAGMSSMSFKMKELFQGQTPADKIVEDATSENLDGPDWNSNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSVELI GIKKRI
Sbjct  72   CDLINTEKVNSVELIHGIKKRI  93



>gb|AFW63470.1| putative VHS/GAT domain containing family protein [Zea mays]
Length=399

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKI G+EV +K+TAGMSSMSFKMKE FQG   ADK+VE+AT+E LD P+W +NLE+
Sbjct  20   FGERLKITGTEVSKKMTAGMSSMSFKMKELFQGQTPADKIVEDATSENLDGPDWNSNLEI  79

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSVELI GIKKRI
Sbjct  80   CDLINTEKVNSVELIHGIKKRI  101



>dbj|BAJ86080.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI GSEV +++ AGMSSMSFKMKE FQ    ADK+VE+ATAE+L+ P+WA NLE+
Sbjct  12   LGERLKITGSEVSKQMQAGMSSMSFKMKELFQAQTPADKIVEDATAESLEGPDWAANLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSV+LIRGIKKRI
Sbjct  72   CDLINTEQVNSVDLIRGIKKRI  93



>ref|XP_008643658.1| PREDICTED: protein transporter isoform X1 [Zea mays]
 gb|ACF87126.1| unknown [Zea mays]
 gb|ACN35180.1| unknown [Zea mays]
 gb|AFW72916.1| putative VHS/GAT domain containing family protein isoform 1 [Zea 
mays]
 gb|AFW72917.1| putative VHS/GAT domain containing family protein isoform 2 [Zea 
mays]
 gb|AFW72918.1| putative VHS/GAT domain containing family protein isoform 3 [Zea 
mays]
Length=392

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKI G+EV +K+TAGMSSMSFKMKE FQG   ADK+VE AT+E LD P+W +NLE+
Sbjct  12   FGERLKITGTEVSKKMTAGMSSMSFKMKELFQGQTPADKIVEGATSEDLDGPDWNSNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN ++V+SVELIRGIKKRI
Sbjct  72   CDMINTEKVDSVELIRGIKKRI  93



>ref|NP_001148639.1| protein transporter [Zea mays]
 gb|ACG32336.1| protein transporter [Zea mays]
Length=391

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKI G+EV +K+TAGMSSMSFKMKE FQG   ADK+VE AT+E LD P+W +NLE+
Sbjct  12   FGERLKITGTEVSKKMTAGMSSMSFKMKELFQGQTPADKIVEGATSEDLDGPDWNSNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN ++V+SVELIRGIKKRI
Sbjct  72   CDMINTEKVDSVELIRGIKKRI  93



>ref|XP_010940789.1| PREDICTED: TOM1-like protein 2 [Elaeis guineensis]
Length=387

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERL+I G+EVGQK+  GMSSMS KMKE FQG NQA+K+VEEATAETL+ P+W+ NLE+
Sbjct  12   FGERLRISGAEVGQKMKTGMSSMSLKMKELFQGQNQAEKMVEEATAETLEGPDWSINLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN ++VNSVELIR IK +I
Sbjct  72   CDLINGEKVNSVELIRAIKNQI  93



>ref|XP_009388422.1| PREDICTED: TOM1-like protein 2 [Musa acuminata subsp. malaccensis]
Length=394

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIGG+EV +K+  G+SSMSFKMKE FQG NQA+K+VEEAT+E L+ P+W+ NLE+
Sbjct  12   FGERLKIGGAEVSRKMKDGVSSMSFKMKELFQGQNQAEKIVEEATSENLEGPDWSANLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN ++ NS+E IRGIKKRI
Sbjct  72   CDMINSEKYNSIEFIRGIKKRI  93



>ref|XP_009399424.1| PREDICTED: TOM1-like protein 2 [Musa acuminata subsp. malaccensis]
Length=394

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKI GSEV +K+TAGMSSMS KMK+FFQ  NQ +K+VE+AT+E LD PNW+ NLE+
Sbjct  12   FGERLKISGSEVSRKMTAGMSSMSSKMKDFFQVQNQVEKIVEDATSENLDGPNWSANLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMIN ++ +SVE IRGIKKRI
Sbjct  72   CDMINSEKFHSVEFIRGIKKRI  93



>gb|KCW46173.1| hypothetical protein EUGRSUZ_K00082 [Eucalyptus grandis]
Length=354

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI G+EVG+K++AGMSSMSFK+KE  QGP Q DKLVE+AT+E+L+ P+WA NL++
Sbjct  13   LGERLKISGAEVGRKMSAGMSSMSFKVKELIQGPTQGDKLVEDATSESLNGPDWALNLQV  72

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH+  +  E+IRGIK+R+
Sbjct  73   CDMINHESFDRGEVIRGIKRRL  94



>ref|XP_010034944.1| PREDICTED: TOM1-like protein 2 [Eucalyptus grandis]
Length=364

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKI G+EVG+K++AGMSSMSFK+KE  QGP Q DKLVE+AT+E+L+ P+WA NL++
Sbjct  13   LGERLKISGAEVGRKMSAGMSSMSFKVKELIQGPTQGDKLVEDATSESLNGPDWALNLQV  72

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDMINH+  +  E+IRGIK+R+
Sbjct  73   CDMINHESFDRGEVIRGIKRRL  94



>gb|ABK24381.1| unknown [Picea sitchensis]
Length=405

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLK+GG+EV +K++AGMSSMS KMKE FQ   QADK+VEEAT+E L+EP+WA NLE+
Sbjct  13   LGERLKVGGAEVSRKMSAGMSSMSDKMKELFQVQTQADKIVEEATSENLEEPDWALNLEI  72

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N +RV S +L+R +KKRI
Sbjct  73   CDMVNGERVGSQDLVRAVKKRI  94



>gb|EMT21212.1| TOM1-like protein 2 [Aegilops tauschii]
Length=399

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            L E+LKI G+EVG+K+TAGMSSMSFKM+E F G   ADK+VE+AT+ETL+ P+WA NLE+
Sbjct  12   LSEQLKITGTEVGKKMTAGMSSMSFKMRELFLGQTPADKIVEDATSETLEGPDWAMNLEI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN  +VNSV+L+RG+KKR+
Sbjct  72   CDLINAGKVNSVDLVRGVKKRL  93



>ref|XP_006592014.1| PREDICTED: TOM1-like protein 2-like [Glycine max]
Length=418

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGG+EVG+K++AGMSS+SFK+KEFFQ  + A KLV EAT+E L EP+WAT L +
Sbjct  12   LGERLKIGGAEVGRKMSAGMSSVSFKVKEFFQDSSHAGKLVGEATSEALHEPDWATILHI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN D++N+ EL+R IKKR+
Sbjct  72   CDLINADQLNTAELVRAIKKRV  93



>gb|EMS61071.1| TOM1-like protein 2 [Triticum urartu]
Length=400

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            L E+LKI G+EVG+K+TAGMSSMSFKM+E F G   ADK+VE+AT+E+L+ P+WA NLE+
Sbjct  13   LSEQLKITGTEVGKKMTAGMSSMSFKMRELFLGQTPADKVVEDATSESLEGPDWAMNLEI  72

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN  +VNSV+L+RG+KKR+
Sbjct  73   CDLINAGKVNSVDLVRGVKKRL  94



>gb|KHN46460.1| TOM1-like protein 2 [Glycine soja]
Length=418

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGG+EVG+K++AGMSS+SFK+KEFFQ    A KLV EAT+E L EP+WAT L +
Sbjct  12   LGERLKIGGAEVGRKMSAGMSSVSFKVKEFFQDSGHAGKLVGEATSEALHEPDWATILHI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN D++N+ EL+R IKKR+
Sbjct  72   CDLINADQLNTAELVRAIKKRV  93



>ref|XP_003607430.1| Class E vacuolar protein-sorting machinery protein HSE1 [Medicago 
truncatula]
 ref|XP_003607439.1| Class E vacuolar protein-sorting machinery protein HSE1 [Medicago 
truncatula]
 gb|AES89627.1| protein transporter [Medicago truncatula]
Length=414

 Score =   115 bits (289),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            +GERLKI G+E+G+K++AG+ +MSFKMKEFFQ PNQA+KLV EAT+E+LDEPNW   L +
Sbjct  12   IGERLKINGAEMGRKMSAGIGTMSFKMKEFFQEPNQAEKLVYEATSESLDEPNWDMILNI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N +++ + +++R IKKRI
Sbjct  72   CDMVNAEKLYTCDVVRAIKKRI  93



>ref|XP_007131520.1| hypothetical protein PHAVU_011G019800g [Phaseolus vulgaris]
 gb|ESW03514.1| hypothetical protein PHAVU_011G019800g [Phaseolus vulgaris]
Length=424

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGG+EVG+K++AGMSS+SFK+KEFFQ  + ADKLV EAT+E L  P+W   L L
Sbjct  12   LGERLKIGGAEVGRKMSAGMSSVSFKVKEFFQDSSHADKLVGEATSEALHHPHWPIILHL  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN D++N+ E++R IKKR+
Sbjct  72   CDLINGDQLNTAEVVRAIKKRV  93



>gb|KEH30668.1| protein transporter [Medicago truncatula]
Length=441

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            +GERLKI G+E+G+K++AG+ +MSFKMKEFFQ PNQA+KLV EAT+E+LDEPNW   L +
Sbjct  39   IGERLKINGAEMGRKMSAGIGTMSFKMKEFFQEPNQAEKLVYEATSESLDEPNWDMILNI  98

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N +++ + +++R IKKRI
Sbjct  99   CDMVNAEKLYTCDVVRAIKKRI  120



>ref|XP_010276808.1| PREDICTED: TOM1-like protein 2 [Nelumbo nucifera]
 ref|XP_010276809.1| PREDICTED: TOM1-like protein 2 [Nelumbo nucifera]
Length=396

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             G+RLK  G+EVG+K++AGMSSMSFKMKE FQGPNQA+K+VEEATAETL+EP+WAT L++
Sbjct  12   FGQRLKTEGAEVGRKMSAGMSSMSFKMKELFQGPNQAEKVVEEATAETLEEPDWATYLDI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+IN++++NS +LIRGIKKRI
Sbjct  72   CDLINNEKINSADLIRGIKKRI  93



>ref|XP_009384136.1| PREDICTED: TOM1-like protein 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009384137.1| PREDICTED: TOM1-like protein 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009384138.1| PREDICTED: TOM1-like protein 2 [Musa acuminata subsp. malaccensis]
Length=394

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLKIG +EV +K+   MSSMSFKMKE F   NQ +K+VEEAT+E LD P+W+ NL +
Sbjct  12   FGERLKIGRAEVSRKMKDRMSSMSFKMKELFHSQNQPEKIVEEATSENLDGPDWSANLMI  71

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N D  N +E IRGIKKRI
Sbjct  72   CDMVNGDNYNGIEFIRGIKKRI  93



>ref|XP_006591518.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like [Glycine max]
Length=178

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 56/61 (92%), Gaps = 1/61 (2%)
 Frame = +2

Query  254  MSFKMKEFFQG-PNQADKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKR  430
            MSFK+K+FF G PNQADKLVE+AT+E LDEP+WA NL+LCD+IN D+++SVEL+RGIKKR
Sbjct  1    MSFKVKDFFNGGPNQADKLVEDATSEALDEPDWALNLDLCDLINADKLSSVELVRGIKKR  60

Query  431  I  433
            I
Sbjct  61   I  61



>gb|ADE76488.1| unknown [Picea sitchensis]
Length=398

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GER+ +GG+EVG+K++AGMSS++ KMK   Q   QADK+VEEAT++   EP+WA NL +
Sbjct  7    FGERIMVGGAEVGRKMSAGMSSVTGKMKGLLQVQTQADKIVEEATSQNFQEPDWAANLRI  66

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+N  +++  +++RGIKKRI
Sbjct  67   CDMLNSGKLSGQDVVRGIKKRI  88



>gb|KJB18441.1| hypothetical protein B456_003G052900 [Gossypium raimondii]
Length=364

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  266  MKEFFQGPNQADKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            MKE FQGPN AD+LVE+AT+E LDEP+WA NL++CDMINH+RVNSV+LIRGIK+R+
Sbjct  1    MKELFQGPNPADQLVEDATSEALDEPDWAVNLDICDMINHERVNSVDLIRGIKRRL  56



>ref|XP_002964154.1| hypothetical protein SELMODRAFT_82329 [Selaginella moellendorffii]
 gb|EFJ34487.1| hypothetical protein SELMODRAFT_82329 [Selaginella moellendorffii]
Length=355

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            +G +LKIGG+EVG+K++A M+ +  ++KE FQ P+ +++++EEATA  L  P+W   +E+
Sbjct  14   MGSKLKIGGAEVGRKVSAQMTVVGGRVKELFQPPSPSERMIEEATAANLRSPDWGRFMEI  73

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+   RV+  ++ RGIKKRI
Sbjct  74   CDMLGDGRVSGQDVARGIKKRI  95



>ref|XP_002993154.1| hypothetical protein SELMODRAFT_136575 [Selaginella moellendorffii]
 gb|EFJ05794.1| hypothetical protein SELMODRAFT_136575 [Selaginella moellendorffii]
Length=355

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            +G +LKIGG+EVG+K++A M+ +  ++KE FQ P+ +++++EEATA  L  P+W   +E+
Sbjct  14   MGSKLKIGGAEVGRKVSARMTVVGGRVKELFQPPSPSERMIEEATAANLRSPDWGRFMEI  73

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CDM+   RV+  ++ RGIKKRI
Sbjct  74   CDMLGDGRVSGQDVARGIKKRI  95



>ref|XP_010935906.1| PREDICTED: TOM1-like protein 2 [Elaeis guineensis]
Length=351

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (73%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GERLK+GG+E+G+K++        KMKE  QG +Q  K+V+EAT+++L+EPNW  NL++C
Sbjct  17   GERLKMGGAEMGRKVSG-------KMKEILQGQSQEAKMVDEATSDSLEEPNWGLNLKIC  69

Query  371  DMINHDRVNSVELIRGIKKRI  433
             ++N D  N  E++R IKK+I
Sbjct  70   GLLNSDEFNGSEVVRAIKKKI  90



>ref|XP_008805226.1| PREDICTED: TOM1-like protein 2 [Phoenix dactylifera]
 ref|XP_008805227.1| PREDICTED: TOM1-like protein 2 [Phoenix dactylifera]
 ref|XP_008805228.1| PREDICTED: TOM1-like protein 2 [Phoenix dactylifera]
Length=379

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 58/81 (72%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GERLK+GG+E+G+K++        KMKE  QG +Q  K+V+EAT+++L+EPNW  NL +C
Sbjct  17   GERLKMGGAEMGRKVSG-------KMKEILQGQSQEAKMVDEATSDSLEEPNWGLNLRIC  69

Query  371  DMINHDRVNSVELIRGIKKRI  433
             ++N D  N  E++R IKK+I
Sbjct  70   GLLNSDEFNGSEVVRAIKKKI  90



>ref|XP_007050288.1| ENTH/VHS/GAT family protein [Theobroma cacao]
 gb|EOX94445.1| ENTH/VHS/GAT family protein [Theobroma cacao]
Length=368

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GERLK GG+++G+ ++        KMKE  QGP    K+V+EAT ETL+EPNW  N+ +C
Sbjct  10   GERLKTGGAQMGRMVSG-------KMKEILQGPTPESKMVDEATLETLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN +  N  E++R IKK+I
Sbjct  63   AMINSEEFNGTEIVRAIKKKI  83



>ref|XP_002968515.1| hypothetical protein SELMODRAFT_89807 [Selaginella moellendorffii]
 gb|EFJ30769.1| hypothetical protein SELMODRAFT_89807 [Selaginella moellendorffii]
Length=397

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQA-DKLVEEATAETLDEPNWATNLE  364
            LGERLKIGG+EVG+K++  M ++S +++E FQ  N A D+LVEEAT     +P+W   +E
Sbjct  12   LGERLKIGGAEVGRKVSERMGNVSERVREMFQASNAAVDRLVEEATGLQGFDPDWGQFME  71

Query  365  LCDMINHDRVNSVELIRGIKKRI  433
            +CDM+N D++   +L R IKKR+
Sbjct  72   ICDMVNADKITGQDLARAIKKRM  94



>ref|XP_002975969.1| hypothetical protein SELMODRAFT_232686 [Selaginella moellendorffii]
 gb|EFJ22874.1| hypothetical protein SELMODRAFT_232686 [Selaginella moellendorffii]
Length=397

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQA-DKLVEEATAETLDEPNWATNLE  364
            LGERLKIGG+EVG+K++  M ++S +++E FQ  N A D+LVEEAT     +P+W   +E
Sbjct  12   LGERLKIGGAEVGRKVSERMGNVSERVREMFQASNAAVDRLVEEATGLQGFDPDWGQFME  71

Query  365  LCDMINHDRVNSVELIRGIKKRI  433
            +CDM+N D++   +L R IKKR+
Sbjct  72   ICDMVNADKITGQDLARAIKKRM  94



>ref|XP_004246945.1| PREDICTED: TOM1-like protein 2 [Solanum lycopersicum]
Length=383

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 7/85 (8%)
 Frame = +2

Query  179  SQLLGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATN  358
            S  LGERLK GG+++ + ++A       KMKE  QGP    K+V+EAT ET++EPNW+ N
Sbjct  10   SSSLGERLKTGGAQMSRMVSA-------KMKEILQGPTPESKMVDEATLETMEEPNWSLN  62

Query  359  LELCDMINHDRVNSVELIRGIKKRI  433
            L +C MIN +  N  E+++ IKK++
Sbjct  63   LRICGMINSEEFNGTEIVKAIKKKL  87



>ref|XP_006351672.1| PREDICTED: target of Myb protein 1-like [Solanum tuberosum]
Length=383

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 7/85 (8%)
 Frame = +2

Query  179  SQLLGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATN  358
            S  LGERLK GG+++ + ++A       KMKE  QGP    K+V+EAT ET++EPNW+ N
Sbjct  10   SSSLGERLKTGGAQMSRMVSA-------KMKEILQGPTPESKMVDEATLETMEEPNWSLN  62

Query  359  LELCDMINHDRVNSVELIRGIKKRI  433
            L +C MIN +  N  E+++ IKK++
Sbjct  63   LRICGMINSEEFNGTEIVKAIKKKL  87



>ref|XP_001757968.1| predicted protein [Physcomitrella patens]
 gb|EDQ77210.1| predicted protein [Physcomitrella patens]
Length=402

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GE++K G  E+ +K++  MS++S KMKE FQ P  ADKLVE+AT E ++  +W  NLE+
Sbjct  13   FGEKVKTGSGELSRKMSERMSTVSDKMKELFQVPTHADKLVEDATGENMELADWEKNLEI  72

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            CD+I+ ++V+  +  R +KKRI
Sbjct  73   CDLISMEKVSGQDAARAVKKRI  94



>ref|XP_004493778.1| PREDICTED: target of Myb protein 1-like [Cicer arietinum]
Length=402

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 7/82 (9%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLK GG+++G +I +G      KMKE  Q P    K+VEEAT+ETL+EPNW  NL +
Sbjct  9    FGERLKTGGAQMG-RIVSG------KMKEILQTPTPESKMVEEATSETLEEPNWGMNLRI  61

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C +IN +  N  E+++GIK+RI
Sbjct  62   CGLINAEEFNGSEVVKGIKRRI  83



>ref|XP_009631518.1| PREDICTED: TOM1-like protein 2 [Nicotiana tomentosiformis]
Length=382

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 57/85 (67%), Gaps = 7/85 (8%)
 Frame = +2

Query  179  SQLLGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATN  358
            S  LGERLK GG+++ + ++A       KMKE  QGP    K+V+EAT +T++EPNW+ N
Sbjct  11   SSSLGERLKTGGAQMSRMVSA-------KMKEILQGPTPESKMVDEATLDTMEEPNWSLN  63

Query  359  LELCDMINHDRVNSVELIRGIKKRI  433
            L +C MIN +  N  E+++ IKK++
Sbjct  64   LRICGMINSEEFNGTEIVKAIKKKL  88



>gb|KJB11326.1| hypothetical protein B456_001G253900 [Gossypium raimondii]
 gb|KJB11327.1| hypothetical protein B456_001G253900 [Gossypium raimondii]
 gb|KJB11328.1| hypothetical protein B456_001G253900 [Gossypium raimondii]
 gb|KJB11329.1| hypothetical protein B456_001G253900 [Gossypium raimondii]
Length=375

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + ++        KMKE  QGP    KLV+EAT ETL+EPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRMVSG-------KMKEILQGPTPESKLVDEATLETLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN +  N  E++R IKK+I
Sbjct  63   SMINSEEFNGTEIVRAIKKKI  83



>ref|XP_009796852.1| PREDICTED: TOM1-like protein 2 [Nicotiana sylvestris]
Length=381

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 56/85 (66%), Gaps = 7/85 (8%)
 Frame = +2

Query  179  SQLLGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATN  358
            S  LGERLK GG+++ + ++A       KMKE  QGP    K+V+EAT +T++EPNW  N
Sbjct  11   SSSLGERLKTGGAQMSRMVSA-------KMKEILQGPTPESKMVDEATLDTMEEPNWGLN  63

Query  359  LELCDMINHDRVNSVELIRGIKKRI  433
            L +C MIN +  N  E+++ IKK++
Sbjct  64   LRICGMINSEEFNGTEIVKAIKKKL  88



>gb|KHG16514.1| TOM1-like protein 2 [Gossypium arboreum]
Length=375

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + ++        KMKE  QGP    KLV+EAT ETL+EPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRMVSG-------KMKEILQGPTPESKLVDEATLETLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN +  N  E++R IKK+I
Sbjct  63   SMINSEEFNGTEIVRAIKKKI  83



>gb|KHN02502.1| Target of Myb protein 1 [Glycine soja]
Length=397

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%), Gaps = 7/82 (9%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLK+GG+++G+ ++        K+KE  Q P    K+V+EAT ET++EPNW  NL +
Sbjct  9    LGERLKMGGAQMGRMVSG-------KVKEMLQAPTPESKMVDEATLETMEEPNWGMNLRI  61

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C MIN D+ N  E+++ IK++I
Sbjct  62   CSMINSDQFNGSEVVKAIKRKI  83



>gb|ACU20982.1| unknown [Glycine max]
Length=302

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 7/82 (9%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLK GG+++G+ ++        K+KE  Q P    K+V+EAT ET++EPNW  NL +
Sbjct  9    LGERLKTGGAQMGRMVSG-------KVKEMLQAPTPESKMVDEATLETMEEPNWGMNLRI  61

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C MIN D+ N  E+++ IK++I
Sbjct  62   CGMINSDQFNGSEVVKAIKRKI  83



>ref|XP_002278050.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
 ref|XP_010652371.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
 ref|XP_010652372.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
 ref|XP_010652373.1| PREDICTED: TOM1-like protein 2 [Vitis vinifera]
Length=359

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 7/82 (9%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLK GG+++G+ ++        K+KE  Q P Q  K+V+EAT+E+L +PNW  NL +
Sbjct  9    LGERLKTGGAQMGRMVSG-------KVKEILQTPTQESKMVDEATSESLSDPNWGMNLRI  61

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C MIN +  +  E++R IKK+I
Sbjct  62   CAMINSEEFSGAEIVRAIKKKI  83



>ref|XP_008364318.1| PREDICTED: TOM1-like protein 1 [Malus domestica]
Length=434

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%), Gaps = 4/82 (5%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGG+++G+ ++  M     +MKE  Q P    K+++EAT ET++EPNW  NL +
Sbjct  9    LGERLKIGGAQMGRMVSGKMK----EMKEILQAPTPESKMIDEATLETMEEPNWGMNLRI  64

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C MIN +  +  E+++ IKK+I
Sbjct  65   CAMINSEEFSGSEVVKAIKKKI  86



>gb|KHG07549.1| TOM1-like protein 2 [Gossypium arboreum]
Length=376

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+L+ GG+++ + +       S KMKE  QGP    K+V+EAT+ETL+EPNW  N+++C
Sbjct  10   GEKLRTGGAQMSRMV-------SGKMKEILQGPTPESKVVDEATSETLEEPNWGLNMKIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN +  N  E++R IKK+I
Sbjct  63   AMINSEEFNGTEIVRAIKKKI  83



>ref|XP_008235674.1| PREDICTED: uncharacterized protein LOC103334474 [Prunus mume]
Length=399

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 7/82 (9%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGG+++G+ +       S K+KE  Q P    K+++EAT ETL+EPNW  NL +
Sbjct  9    LGERLKIGGAQMGRMV-------SGKVKEILQTPTPESKMIDEATLETLEEPNWGMNLRI  61

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C MIN +  +  E++R IKK+I
Sbjct  62   CAMINSEEFSGSEVVRAIKKKI  83



>ref|XP_007199901.1| hypothetical protein PRUPE_ppa006710mg [Prunus persica]
 gb|EMJ01100.1| hypothetical protein PRUPE_ppa006710mg [Prunus persica]
Length=399

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 55/82 (67%), Gaps = 7/82 (9%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLKIGG+++G+ ++        K+KE  Q P    K+++EAT ETL+EPNW  NL +
Sbjct  9    LGERLKIGGAQMGRMVSG-------KVKEILQTPTPESKMIDEATLETLEEPNWGMNLRI  61

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C MIN +  +  E++R IKK+I
Sbjct  62   CAMINSEEFSGSEVVRAIKKKI  83



>emb|CBI37124.3| unnamed protein product [Vitis vinifera]
Length=503

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 7/82 (9%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLK GG+++G+ ++        K+KE  Q P Q  K+V+EAT+E+L +PNW  NL +
Sbjct  153  LGERLKTGGAQMGRMVSG-------KVKEILQTPTQESKMVDEATSESLSDPNWGMNLRI  205

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C MIN +  +  E++R IKK+I
Sbjct  206  CAMINSEEFSGAEIVRAIKKKI  227



>gb|KJB42271.1| hypothetical protein B456_007G146500 [Gossypium raimondii]
 gb|KJB42272.1| hypothetical protein B456_007G146500 [Gossypium raimondii]
Length=376

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+L+ GG+++ + +       S KMKE  QGP    K+V+EAT+ETL+EPNW  N+++C
Sbjct  10   GEKLRTGGAQMSRMV-------SGKMKEILQGPTSEWKVVDEATSETLEEPNWGLNMKIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN +  N  E++R IKK+I
Sbjct  63   AMINSEEFNGTEIVRAIKKKI  83



>ref|XP_007162547.1| hypothetical protein PHAVU_001G161300g [Phaseolus vulgaris]
 gb|ESW34541.1| hypothetical protein PHAVU_001G161300g [Phaseolus vulgaris]
Length=401

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 7/82 (9%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLK GG+++G+ ++        K+KE  Q P    K+V+EAT ET++ PNW  NL +
Sbjct  9    LGERLKTGGAQMGRMVSG-------KVKEMLQAPTPESKMVDEATLETMEAPNWGINLRI  61

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C MIN D+ N  E+++ IK++I
Sbjct  62   CAMINADQFNGSEVVKAIKRKI  83



>ref|XP_011080045.1| PREDICTED: TOM1-like protein 2 [Sesamum indicum]
Length=377

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 55/85 (65%), Gaps = 7/85 (8%)
 Frame = +2

Query  179  SQLLGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATN  358
            S  LGER+K  G+++G+ I++       KMKE  Q P    K+V+EATAE+++EPNW  N
Sbjct  13   SSSLGERIKTSGAQMGRTISS-------KMKEILQSPTPESKVVDEATAESMEEPNWGLN  65

Query  359  LELCDMINHDRVNSVELIRGIKKRI  433
            L +C MI+    +  E++R IKK++
Sbjct  66   LRICAMISRGEYDGTEIVRAIKKKL  90



>gb|KDP26526.1| hypothetical protein JCGZ_17684 [Jatropha curcas]
Length=368

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GERLK GG+++ + ++        KMKE  Q P    K+V+EAT+E L+EPNW  NL +C
Sbjct  10   GERLKTGGAQMSRLVSG-------KMKEMLQTPTPESKMVDEATSEMLEEPNWGMNLRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN +  N  E++R IKK+I
Sbjct  63   AMINGEEFNGTEIVRAIKKKI  83



>gb|AGV54699.1| target of Myb protein 1-like protein [Phaseolus vulgaris]
Length=420

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 7/82 (9%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLK GG+++G+ ++        K+KE  Q P    K+V+EAT ET++ PNW  NL +
Sbjct  9    LGERLKTGGAQMGRMVSG-------KVKEMLQAPTPESKMVDEATLETMEAPNWGINLRI  61

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C MIN D+ N  E+++ IK++I
Sbjct  62   CAMINADQFNGSEVVKAIKRKI  83



>gb|KDO60488.1| hypothetical protein CISIN_1g0411492mg, partial [Citrus sinensis]
Length=255

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 7/82 (9%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGER+K GG+++G +I +G      K+KE  Q P    K+V+EAT ETL+EPNW  N+ +
Sbjct  9    LGERIKTGGAQMG-RIVSG------KVKEMLQAPTPESKMVDEATLETLEEPNWGMNMRI  61

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C +IN +  +  E+++ IKK+I
Sbjct  62   CALINSEEFSGSEIVKAIKKKI  83



>emb|CDP03748.1| unnamed protein product [Coffea canephora]
Length=388

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = +2

Query  179  SQLLGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATN  358
            S   GERLK GG+++ + +++       KMKE  Q P    K+V+EAT ET++EPNW  N
Sbjct  11   SSSFGERLKTGGAQMSRIVSS-------KMKEILQAPTPESKMVDEATLETMEEPNWGLN  63

Query  359  LELCDMINHDRVNSVELIRGIKKRI  433
            L +C +IN +  N  E+++ IKK++
Sbjct  64   LRICALINSEEFNGTEVVKAIKKKM  88



>ref|XP_006479538.1| PREDICTED: TOM1-like protein 1-like isoform X1 [Citrus sinensis]
 ref|XP_006479539.1| PREDICTED: TOM1-like protein 1-like isoform X2 [Citrus sinensis]
 ref|XP_006479540.1| PREDICTED: TOM1-like protein 1-like isoform X3 [Citrus sinensis]
Length=389

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 7/82 (9%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGER+K GG+++G +I +G      K+KE  Q P    K+V+EAT ETL+EPNW  N+ +
Sbjct  9    LGERIKTGGAQMG-RIVSG------KVKEMLQAPTPESKMVDEATLETLEEPNWGMNMRI  61

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C +IN +  +  E+++ IKK+I
Sbjct  62   CALINSEEFSGSEIVKAIKKKI  83



>gb|EYU46453.1| hypothetical protein MIMGU_mgv1a023292mg, partial [Erythranthe 
guttata]
Length=357

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 7/85 (8%)
 Frame = +2

Query  179  SQLLGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATN  358
            S  +GER+K  G++VG+ I++       KMKE    P    K+V+EATAETL EPNW  N
Sbjct  13   SSSIGERIKTSGAQVGRTISS-------KMKEILAAPTPESKIVDEATAETLAEPNWGLN  65

Query  359  LELCDMINHDRVNSVELIRGIKKRI  433
            L +C MI+    +  E++R I++++
Sbjct  66   LRICAMISRGEYDGAEIVRAIRRKL  90



>ref|XP_010246780.1| PREDICTED: TOM1-like protein 2 [Nelumbo nucifera]
Length=395

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 7/82 (9%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGERLK  G+++G+ ++        KMKE  Q      K+VEEAT+++L+EPNW  NL +
Sbjct  9    LGERLKSSGAQMGRLVSG-------KMKEILQSQTPESKMVEEATSDSLEEPNWGLNLRI  61

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C M+N +  + +E++R IKKRI
Sbjct  62   CAMLNSEEFSGMEVVRAIKKRI  83



>ref|XP_001779411.1| predicted protein [Physcomitrella patens]
 gb|EDQ55801.1| predicted protein [Physcomitrella patens]
Length=376

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  245  MSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIK  424
            MS+MS KMKE FQ   QADKLVE+AT E ++ P+W  NLE+CD+IN ++++  +  R IK
Sbjct  5    MSTMSDKMKELFQVSTQADKLVEDATGEDMEGPDWQKNLEICDLINLEKLSGQDTARAIK  64

Query  425  KRI  433
            KRI
Sbjct  65   KRI  67



>ref|XP_010522149.1| PREDICTED: target of Myb protein 1 [Tarenaya hassleriana]
Length=377

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + ++        K+KE  Q P    K+V+EAT ET+DEPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRMVSG-------KVKEMLQAPTLESKMVDEATLETMDEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN +  N  E+++ IKK++
Sbjct  63   SMINSEEFNGTEIVKAIKKKL  83



>ref|NP_973770.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
 gb|AEE27959.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
Length=279

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + +       S K+K+  Q P    K+V+EAT ETL+EPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRMV-------SEKVKDMLQAPTLESKMVDEATLETLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
              IN+D  N  E++R IK++I
Sbjct  63   AQINNDEFNGTEIVRAIKRKI  83



>ref|XP_002973972.1| hypothetical protein SELMODRAFT_57331, partial [Selaginella moellendorffii]
 gb|EFJ24927.1| hypothetical protein SELMODRAFT_57331, partial [Selaginella moellendorffii]
Length=252

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +2

Query  221  VGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLD-EPNWATNLELCDMINHDRVN  397
            +G +++  M+S+  KMKE FQG +QADK VEEAT+E     P+W  NL++CDM+N + + 
Sbjct  1    LGGRMSQRMNSLGDKMKEVFQGSSQADKFVEEATSEKNGFSPDWGKNLQICDMVNAEGLT  60

Query  398  SVELIRGIKKRI  433
              +++RG+KKR+
Sbjct  61   GQDVVRGVKKRL  72



>ref|XP_006383702.1| hypothetical protein POPTR_0005s24650g [Populus trichocarpa]
 gb|ERP61499.1| hypothetical protein POPTR_0005s24650g [Populus trichocarpa]
Length=267

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GERLK GG+++ + +       S K+KE  Q P    K+V+EAT ET++EPNW  NL +C
Sbjct  10   GERLKTGGAQMSRLV-------SDKVKEILQTPTPESKMVDEATLETMEEPNWGLNLRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN    +  E+++ IK++I
Sbjct  63   SMINSQEFSGTEIVKAIKRKI  83



>ref|XP_002969092.1| hypothetical protein SELMODRAFT_67275, partial [Selaginella moellendorffii]
 gb|EFJ30208.1| hypothetical protein SELMODRAFT_67275, partial [Selaginella moellendorffii]
Length=252

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +2

Query  221  VGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLD-EPNWATNLELCDMINHDRVN  397
            +G +++  M+S+  KMKE FQG +QADK VEEAT+E     P+W  NL++CDM+N + + 
Sbjct  1    LGGRMSQRMNSLGDKMKEVFQGSSQADKFVEEATSEKNGFSPDWGKNLQICDMVNAEGLT  60

Query  398  SVELIRGIKKRI  433
              +++RG+KKR+
Sbjct  61   GQDVMRGVKKRL  72



>ref|XP_010485879.1| PREDICTED: TOM1-like protein 2 [Camelina sativa]
Length=381

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + +       S K+K+  Q P    K+V+EAT ETL+EPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRMV-------SEKVKDMLQAPTLESKMVDEATLETLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
              IN+D  N  E++R IK++I
Sbjct  63   AQINNDEFNGTEIVRAIKRKI  83



>ref|NP_563762.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
 gb|AAF80218.1|AC025290_7 Contains similarity to an ADP-ribosylation factor binding protein 
GGA1 from Homo sapiens gb|AF190862 and contains a VHS PF|00790 
domain. EST gb|BE037588 comes from this gene [Arabidopsis 
thaliana]
 gb|AAK96627.1| At1g06210/F9P14_4 [Arabidopsis thaliana]
 gb|AAN18147.1| At1g06210/F9P14_4 [Arabidopsis thaliana]
 gb|AEE27960.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
Length=383

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + +       S K+K+  Q P    K+V+EAT ETL+EPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRMV-------SEKVKDMLQAPTLESKMVDEATLETLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
              IN+D  N  E++R IK++I
Sbjct  63   AQINNDEFNGTEIVRAIKRKI  83



>ref|XP_010475349.1| PREDICTED: target of Myb protein 1-like [Camelina sativa]
Length=381

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + +       S K+K+  Q P    K+V+EAT ETL+EPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRMV-------SEKVKDMLQAPTLESKMVDEATLETLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
              IN+D  N  E++R IK++I
Sbjct  63   AQINNDEFNGTEIVRAIKRKI  83



>ref|XP_010457748.1| PREDICTED: target of Myb protein 1-like [Camelina sativa]
Length=381

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + +       S K+K+  Q P    K+V+EAT ETL+EPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRMV-------SEKVKDMLQAPTLESKMVDEATLETLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
              IN+D  N  E++R IK++I
Sbjct  63   AQINNDEFNGTEIVRAIKRKI  83



>ref|XP_002889591.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65850.1| VHS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + +       S K+K+  Q P    K+V+EAT ETL+EPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRMV-------SEKVKDMLQAPTLESKMVDEATLETLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
              IN+D  N  E++R IK++I
Sbjct  63   AQINNDEFNGTEIVRAIKRKI  83



>ref|XP_006857283.1| hypothetical protein AMTR_s00067p00032430 [Amborella trichopoda]
 gb|ERN18750.1| hypothetical protein AMTR_s00067p00032430 [Amborella trichopoda]
Length=369

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 56/81 (69%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GERL+ GG++  +K++        K+KE  QGP  A K+V+EAT++ L+EPNW+ NL +C
Sbjct  10   GERLRTGGAQNWRKVSG-------KVKEILQGPTLAGKMVDEATSDHLEEPNWSINLRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             ++N + ++  +++R IKK+I
Sbjct  63   SLLNGEELSGQDVVRAIKKKI  83



>ref|XP_002532031.1| protein transporter, putative [Ricinus communis]
 gb|EEF30347.1| protein transporter, putative [Ricinus communis]
Length=378

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GERLK GG+++ + +       S K+KE  Q P    ++V+EAT+E L+EPNW  NL +C
Sbjct  10   GERLKTGGAQMSRMV-------SDKVKEMLQTPTPESRIVDEATSEMLEEPNWGMNLRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN +  +  E++R IK++I
Sbjct  63   AMINSEEFSGTEIVRAIKRKI  83



>ref|XP_006417945.1| hypothetical protein EUTSA_v10007923mg [Eutrema salsugineum]
 gb|ESQ36298.1| hypothetical protein EUTSA_v10007923mg [Eutrema salsugineum]
Length=381

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + ++        K+KE  Q P    K+V+EAT ETL+EPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRMVSG-------KVKEMLQAPTLESKMVDEATLETLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
              IN++  N  E++R IK++I
Sbjct  63   AQINNEEFNGTEIVRAIKRKI  83



>emb|CDY15564.1| BnaA08g28480D [Brassica napus]
Length=351

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + +       S K+K+  Q P    K+V+EAT ETL+EPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRIV-------SEKVKDILQAPTLESKMVDEATLETLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
              IN+   N+ E++R IKK+I
Sbjct  63   AQINNQEFNATEIVRAIKKKI  83



>ref|XP_002307649.2| hypothetical protein POPTR_0005s24650g [Populus trichocarpa]
 gb|EEE94645.2| hypothetical protein POPTR_0005s24650g [Populus trichocarpa]
Length=419

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GERLK GG+++ + +       S K+KE  Q P    K+V+EAT ET++EPNW  NL +C
Sbjct  10   GERLKTGGAQMSRLV-------SDKVKEILQTPTPESKMVDEATLETMEEPNWGLNLRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN    +  E+++ IK++I
Sbjct  63   SMINSQEFSGTEIVKAIKRKI  83



>ref|XP_011004048.1| PREDICTED: TOM1-like protein 2 isoform X1 [Populus euphratica]
 ref|XP_011004049.1| PREDICTED: TOM1-like protein 2 isoform X1 [Populus euphratica]
Length=438

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GERLK GG+++ + +       S K+KE  Q P    K+V+EAT ET++EPNW  NL +C
Sbjct  10   GERLKTGGAQMSRLV-------SDKVKEILQTPTPESKMVDEATLETMEEPNWGLNLRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN    +  E+++ IK++I
Sbjct  63   SMINSQEFSGTEIVKAIKRKI  83



>ref|XP_011004050.1| PREDICTED: TOM1-like protein 2 isoform X2 [Populus euphratica]
Length=437

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GERLK GG+++ + +       S K+KE  Q P    K+V+EAT ET++EPNW  NL +C
Sbjct  10   GERLKTGGAQMSRLV-------SDKVKEILQTPTPESKMVDEATLETMEEPNWGLNLRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN    +  E+++ IK++I
Sbjct  63   SMINSQEFSGTEIVKAIKRKI  83



>emb|CDX86533.1| BnaC08g01700D [Brassica napus]
Length=358

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + +       S K+K+  Q P    K+V+EAT ETL+EPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRMV-------SEKVKDILQAPTLESKMVDEATLETLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
              IN+   N+ E++R IK++I
Sbjct  63   AQINNQEFNATEIVRAIKRKI  83



>ref|XP_006305076.1| hypothetical protein CARUB_v10009444mg [Capsella rubella]
 gb|EOA37974.1| hypothetical protein CARUB_v10009444mg [Capsella rubella]
Length=381

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + +       S K+K+  Q P    K+V+EAT ETL+EPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRMV-------SEKVKDMLQAPTLESKMVDEATLETLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
              IN++  N  E++R IK++I
Sbjct  63   AQINNEEFNGTEIVRAIKRKI  83



>emb|CDY06201.1| BnaA09g50020D [Brassica napus]
Length=380

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + +       S K K+  Q P    K+V+EAT +TL+EPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRMV-------SDKFKDILQAPTLESKMVDEATLDTLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
              IN++  N+ E++R IK++I
Sbjct  63   AQINNNEFNATEIVRAIKRKI  83



>emb|CDY09983.1| BnaC08g44680D [Brassica napus]
Length=380

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 52/81 (64%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + +       S K K+  Q P    K+V+EAT +TL+EPNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRMV-------SDKFKDILQAPTLESKMVDEATLDTLEEPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
              IN++  N+ E++R IK++I
Sbjct  63   AQINNNEFNATEIVRAIKRKI  83



>gb|KEH23932.1| ENTH/VHS/GAT family protein [Medicago truncatula]
Length=422

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 7/82 (9%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
             GERLK   + +  +I +G      KMKE  Q P    K+V+EAT+ETL EPNW  NL +
Sbjct  9    FGERLKTSSANMS-RIVSG------KMKEILQTPTPESKIVDEATSETLSEPNWGMNLRI  61

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C +IN +  N  E+++ IK++I
Sbjct  62   CGLINAEEFNGSEIVKAIKRKI  83



>ref|XP_009118551.1| PREDICTED: target of Myb protein 1-like [Brassica rapa]
Length=380

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSM-SFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            GE+LK GG        A MS M S K K+  Q P    K+V+EAT ETL+EPNW  N+ +
Sbjct  10   GEKLKTGG--------AQMSRMLSDKFKDILQAPALESKMVDEATLETLEEPNWGMNMRI  61

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C  IN+   N+ E++R IK++I
Sbjct  62   CAQINNHEFNATEIVRAIKRKI  83



>ref|XP_010667636.1| PREDICTED: uncharacterized protein LOC104884649 [Beta vulgaris 
subsp. vulgaris]
Length=240

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAET  331
            LGERL+I G+EV +K++A + SMS KMKE FQGPNQADK+VEEA+A++
Sbjct  193  LGERLRIAGNEVSKKMSASVRSMSDKMKELFQGPNQADKIVEEASAKS  240



>emb|CDY10185.1| BnaC05g04280D [Brassica napus]
Length=378

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 53/81 (65%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE+LK GG+++ + +       S K+K+  Q P    K+V+EAT ETL++PNW  N+ +C
Sbjct  10   GEKLKTGGAQMSRIV-------SDKVKDILQAPTLESKMVDEATLETLEDPNWGMNMRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
              IN++  N+ E++R IK++I
Sbjct  63   AQINNNEFNATEIVRAIKRKI  83



>ref|XP_010679306.1| PREDICTED: TOM1-like protein 2 [Beta vulgaris subsp. vulgaris]
Length=424

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 55/82 (67%), Gaps = 4/82 (5%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            +GERLK GG+++G+ I+  +     +MK+  Q P    ++V++AT+ TL+ P+W  NL +
Sbjct  9    IGERLKAGGTQMGRTISLKVK----EMKDLLQTPTPESRIVDQATSATLESPDWGLNLRI  64

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C +IN + ++  E+++ IKK+I
Sbjct  65   CSLINAEELSGAEIVKAIKKKI  86



>ref|XP_004289949.1| PREDICTED: TOM1-like protein 2 [Fragaria vesca subsp. vesca]
Length=401

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 52/82 (63%), Gaps = 7/82 (9%)
 Frame = +2

Query  188  LGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLEL  367
            LGE+L   G+++G+ ++        K+KE  Q P    ++++EAT ET++EPNW  NL +
Sbjct  12   LGEKLVTSGAQMGRMVSG-------KVKEILQTPTPESRMIDEATLETMEEPNWGMNLRI  64

Query  368  CDMINHDRVNSVELIRGIKKRI  433
            C MIN +  +  E++R IK++I
Sbjct  65   CAMINSEEFSGFEVVRVIKRKI  86



>ref|XP_011013579.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
Length=410

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE LK GG+++ + ++        K+KE  Q P    K+V+EAT ET++EPNW  NL +C
Sbjct  10   GELLKTGGAQMSRLVSG-------KVKEMLQTPTPESKMVDEATLETMEEPNWGLNLRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN    +  E+++ IK++ 
Sbjct  63   AMINSQEFSGTEIVKAIKRKF  83



>ref|XP_011028806.1| PREDICTED: TOM1-like protein 2 [Populus euphratica]
Length=410

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE LK GG+++ + ++        K+KE  Q P    K+V+EAT ET++EPNW  NL +C
Sbjct  10   GELLKTGGAQMSRLVSG-------KVKEMLQTPTPESKMVDEATLETMEEPNWGLNLRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN    +  E+++ IK++ 
Sbjct  63   AMINSQEFSGTEIVKAIKRKF  83



>gb|EYU17922.1| hypothetical protein MIMGU_mgv1a008118mg [Erythranthe guttata]
Length=384

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 7/85 (8%)
 Frame = +2

Query  179  SQLLGERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATN  358
            S  LGER+K  G+++G+ I +       KMKE  Q P    K+V+EAT ++ DE NW  +
Sbjct  13   SSSLGERIKTSGAQMGRTIGS-------KMKEILQTPTPESKVVDEATDDSTDELNWGLS  65

Query  359  LELCDMINHDRVNSVELIRGIKKRI  433
            L +C MI     +  E++R IK++I
Sbjct  66   LRICAMIGRQEYDGAEIVRAIKRKI  90



>ref|XP_002300774.2| hypothetical protein POPTR_0002s03910g [Populus trichocarpa]
 gb|EEE80047.2| hypothetical protein POPTR_0002s03910g [Populus trichocarpa]
Length=410

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 7/81 (9%)
 Frame = +2

Query  191  GERLKIGGSEVGQKITAGMSSMSFKMKEFFQGPNQADKLVEEATAETLDEPNWATNLELC  370
            GE LK GG+++ + ++        K+KE  Q P    K+V+EAT ET++EPNW  NL +C
Sbjct  10   GELLKTGGAQMSRLVSG-------KVKEMLQTPTPESKMVDEATLETMEEPNWGLNLRIC  62

Query  371  DMINHDRVNSVELIRGIKKRI  433
             MIN    +  E+++ +K++ 
Sbjct  63   AMINSQEFSGTEIVKAMKRKF  83



>ref|XP_006371247.1| hypothetical protein POPTR_0019s07670g [Populus trichocarpa]
 gb|ERP49044.1| hypothetical protein POPTR_0019s07670g [Populus trichocarpa]
Length=81

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -2

Query  375  MSQSSRFVAQLGsskvsavasstslsAWLGPWKNSFILKLMELIPAVIFCPTSDPPIFKR  196
            MSQ SRF+AQ GSS VSAVASSTSLSAWLGP  +SF LKL+EL+PA+IF PTS PPI +R
Sbjct  1    MSQISRFMAQSGSSSVSAVASSTSLSAWLGPCNSSFTLKLIELMPALIFRPTSAPPILRR  60

Query  195  SPKS  184
            SPK+
Sbjct  61   SPKA  64



>ref|XP_004498477.1| PREDICTED: TOM1-like protein 1-like [Cicer arietinum]
Length=662

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CDM+NHD   + E+++GIKKRI
Sbjct  3    NSMVERATSDMLIGPDWAMNIEICDMLNHDPGQAKEVVKGIKKRI  47



>ref|XP_010100264.1| Protein PEROXIN-4 [Morus notabilis]
 gb|EXB82271.1| Protein PEROXIN-4 [Morus notabilis]
Length=905

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CDM+NHD   + ++++GIKKRI
Sbjct  3    NSMVERATSDMLIGPDWAMNIEICDMLNHDPAQAKDVVKGIKKRI  47



>ref|XP_008220049.1| PREDICTED: target of Myb protein 1 [Prunus mume]
Length=699

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            +VE AT++ L  P+WA N+E+CDM NHD V + ++++GIKKR+
Sbjct  5    MVERATSDMLIGPDWAMNIEICDMCNHDPVQAKDVVKGIKKRL  47



>gb|EPS60910.1| hypothetical protein M569_13891 [Genlisea aurea]
Length=65

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            LVE AT++ L  P+WA N+E+CD+ NHD   + ++++GIKKR+
Sbjct  5    LVERATSDLLIGPDWAMNIEICDVCNHDPAQAKDVVKGIKKRL  47



>ref|XP_007225177.1| hypothetical protein PRUPE_ppa002235mg [Prunus persica]
 gb|EMJ26376.1| hypothetical protein PRUPE_ppa002235mg [Prunus persica]
Length=697

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            +VE AT++ L  P+WA N+E+CDM NHD V + ++++GIKKR+
Sbjct  5    MVERATSDMLIGPDWAMNIEICDMCNHDPVQAKDVVKGIKKRL  47



>emb|CDY45016.1| BnaA08g12030D [Brassica napus]
Length=666

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D V + ++++G+KKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPVQAKDVVKGVKKRI  47



>ref|XP_010526178.1| PREDICTED: TOM1-like protein 2 [Tarenaya hassleriana]
Length=646

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA NLE+CDM+N+D V + ++++GIKKRI
Sbjct  3    NAMVERATSDMLIGPDWAMNLEICDMLNNDPVQAKDVVKGIKKRI  47



>emb|CDY49322.1| BnaC03g66920D [Brassica napus]
Length=664

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D V + ++++G+KKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPVQAKDVVKGVKKRI  47



>ref|XP_009108832.1| PREDICTED: TOM1-like protein 2 isoform X1 [Brassica rapa]
Length=651

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D V + ++++G+KKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPVQAKDVVKGVKKRI  47



>ref|XP_003544671.1| PREDICTED: TOM1-like protein 2-like [Glycine max]
 gb|KHN13671.1| Target of Myb protein 1 [Glycine soja]
Length=672

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CDM+NHD   + ++++GIKKRI
Sbjct  3    NSMVERATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRI  47



>ref|XP_002516559.1| protein transporter, putative [Ricinus communis]
 gb|EEF45900.1| protein transporter, putative [Ricinus communis]
Length=667

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CDM NHD   + ++++GIKKRI
Sbjct  3    NSMVERATSDMLIGPDWAMNIEICDMCNHDPAQAKDVVKGIKKRI  47



>ref|XP_008378101.1| PREDICTED: TOM1-like protein 1 [Malus domestica]
Length=704

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            LVE AT++ L  P+WA N+E+CD+ NHD V + ++++GIKKR+
Sbjct  5    LVERATSDMLIGPDWAMNIEICDICNHDPVQAKDVVKGIKKRL  47



>ref|XP_009367903.1| PREDICTED: target of Myb protein 1 [Pyrus x bretschneideri]
Length=701

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            +VE AT++ L  P+WA NLE+CD+ NHD V + ++++GIKKR+
Sbjct  5    MVERATSDMLIGPDWAMNLEICDICNHDPVQAKDVVKGIKKRL  47



>ref|NP_001237269.1| VHS and GAT domain protein [Glycine max]
 gb|ABB90835.1| VHS and GAT domain protein [Glycine max]
 gb|KHN31566.1| Target of Myb protein 1 [Glycine soja]
Length=672

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CDM+NHD   + ++++GIKKRI
Sbjct  3    NSMVERATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRI  47



>gb|KEH40293.1| ENTH/VHS/GAT family protein [Medicago truncatula]
Length=674

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CDM+NHD   + ++++GIKKRI
Sbjct  3    NSMVERATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRI  47



>ref|NP_195002.2| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
 gb|AAM53282.1| putative protein [Arabidopsis thaliana]
 gb|AAN15352.1| putative protein [Arabidopsis thaliana]
 gb|AEE86114.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
Length=675

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++GIKKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRI  47



>ref|XP_010432670.1| PREDICTED: TOM1-like protein 2 isoform X2 [Camelina sativa]
Length=676

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++GIKKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRI  47



>ref|NP_001190892.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
 gb|AEE86115.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
Length=676

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++GIKKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRI  47



>ref|XP_002284083.2| PREDICTED: target of Myb protein 1 [Vitis vinifera]
 emb|CBI20881.3| unnamed protein product [Vitis vinifera]
Length=691

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CDM+NHD   + ++++GIKKRI
Sbjct  3    NSMVERATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRI  47



>ref|XP_010437859.1| PREDICTED: TOM1-like protein 2 isoform X2 [Camelina sativa]
Length=679

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++GIKKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRI  47



>ref|XP_010432669.1| PREDICTED: TOM1-like protein 2 isoform X1 [Camelina sativa]
Length=677

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++GIKKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRI  47



>ref|XP_010447347.1| PREDICTED: TOM1-like protein 2 isoform X2 [Camelina sativa]
Length=678

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++GIKKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRI  47



>ref|XP_006412434.1| hypothetical protein EUTSA_v10024602mg [Eutrema salsugineum]
 gb|ESQ53887.1| hypothetical protein EUTSA_v10024602mg [Eutrema salsugineum]
Length=672

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++GIKKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRI  47



>ref|XP_010447346.1| PREDICTED: TOM1-like protein 2 isoform X1 [Camelina sativa]
Length=679

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++GIKKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRI  47



>ref|XP_010437858.1| PREDICTED: TOM1-like protein 2 isoform X1 [Camelina sativa]
Length=680

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++GIKKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRI  47



>gb|KFK29873.1| hypothetical protein AALP_AA7G190000 [Arabis alpina]
Length=678

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++GIKKRI
Sbjct  3    NAMVERATSELLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRI  47



>ref|XP_002869247.1| protein transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45506.1| protein transporter [Arabidopsis lyrata subsp. lyrata]
Length=667

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            +VE AT+E L  P+WA NLE+CDM+N D   + ++++GIKKRI
Sbjct  1    MVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRI  43



>gb|KFK29872.1| hypothetical protein AALP_AA7G190000 [Arabis alpina]
Length=679

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++GIKKRI
Sbjct  3    NAMVERATSELLIGPDWAMNLEICDMLNSDPAQAKDVVKGIKKRI  47



>ref|XP_011459005.1| PREDICTED: target of Myb protein 1 [Fragaria vesca subsp. vesca]
Length=707

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CD+ NHD V + ++++GIKKR+
Sbjct  3    NSMVERATSDMLIGPDWAMNIEICDICNHDPVQAKDVVKGIKKRL  47



>emb|CDY13501.1| BnaA03g52190D [Brassica napus]
Length=649

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++G+KKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGVKKRI  47



>gb|AEK78080.1| VHS [Triticum aestivum]
Length=253

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            LV+ AT+E+L  P+W+ NLE+CD++NHD   + ++++ IKKRI
Sbjct  6    LVDRATSESLIGPDWSLNLEICDILNHDPSQAKDVVKSIKKRI  48



>ref|XP_009138141.1| PREDICTED: TOM1-like protein 2 isoform X1 [Brassica rapa]
Length=649

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++G+KKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGVKKRI  47



>ref|XP_009138142.1| PREDICTED: TOM1-like protein 2 isoform X2 [Brassica rapa]
Length=648

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++G+KKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGVKKRI  47



>ref|XP_006833334.1| hypothetical protein AMTR_s00109p00078110 [Amborella trichopoda]
 gb|ERM98612.1| hypothetical protein AMTR_s00109p00078110 [Amborella trichopoda]
Length=617

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + LVE AT++ L  P+WA N+E+CD++NHD   + +++RGIKKR+
Sbjct  3    NSLVERATSDMLIGPDWAMNIEICDILNHDPGQAKDVVRGIKKRM  47



>ref|XP_006450645.1| hypothetical protein CICLE_v10007656mg [Citrus clementina]
 gb|ESR63885.1| hypothetical protein CICLE_v10007656mg [Citrus clementina]
Length=676

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +V+ AT++ L  P+WA N+E+CDM+NHD   + ++++GIKKRI
Sbjct  3    NSMVDRATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRI  47



>gb|KDP34202.1| hypothetical protein JCGZ_07773 [Jatropha curcas]
Length=682

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CD+ NHD   + ++++GIKKRI
Sbjct  3    NSMVERATSDMLIGPDWAMNIEICDICNHDPAQAKDVVKGIKKRI  47



>gb|KDO79743.1| hypothetical protein CISIN_1g005810mg [Citrus sinensis]
Length=672

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +V+ AT++ L  P+WA N+E+CDM+NHD   + ++++GIKKRI
Sbjct  3    NSMVDRATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRI  47



>ref|XP_006283262.1| hypothetical protein CARUB_v10004294mg [Capsella rubella]
 gb|EOA16160.1| hypothetical protein CARUB_v10004294mg [Capsella rubella]
Length=673

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++G+KKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPAQAKDVVKGVKKRI  47



>ref|XP_006476080.1| PREDICTED: ADP-ribosylation factor-binding protein GGA3-like 
[Citrus sinensis]
 gb|KDO79742.1| hypothetical protein CISIN_1g005810mg [Citrus sinensis]
Length=676

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +V+ AT++ L  P+WA N+E+CDM+NHD   + ++++GIKKRI
Sbjct  3    NSMVDRATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRI  47



>gb|EYU20455.1| hypothetical protein MIMGU_mgv1a002579mg [Erythranthe guttata]
Length=657

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CD+ NHD   + +++RGIKKR+
Sbjct  3    NSMVERATSDMLIGPDWAMNIEICDICNHDPAQAKDVVRGIKKRL  47



>gb|EYU29271.1| hypothetical protein MIMGU_mgv1a004368mg [Erythranthe guttata]
Length=531

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CD+ NHD   + +++RGIKKRI
Sbjct  3    NPMVERATSDMLIGPDWAMNIEICDICNHDPAQAKDVVRGIKKRI  47



>emb|CDX72371.1| BnaC07g43930D [Brassica napus]
Length=645

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT+E L  P+WA NLE+CDM+N D   + ++++G+KKRI
Sbjct  3    NAMVERATSEMLIGPDWAMNLEICDMLNSDPSQAKDVVKGVKKRI  47



>ref|XP_011081815.1| PREDICTED: TOM1-like protein 2 [Sesamum indicum]
Length=651

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CD+ NHD V + ++++GIKKR+
Sbjct  3    NSMVERATSDMLIGPDWAMNIEICDICNHDPVQAKDVVKGIKKRL  47



>emb|CDY47726.1| BnaA10g04150D [Brassica napus]
Length=330

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 6/82 (7%)
 Frame = +2

Query  194  ERLKIGGSEVGQKITAGMSSM----SFKMKEFFQGPNQADKLVEEATAETLDEPNWATNL  361
            ++LKI  SE G+K+  G + M    S K+K+  Q P    K+V+EAT ET +E NW  ++
Sbjct  2    DKLKI--SEWGEKLKTGRAQMNRIVSDKVKDILQAPTLESKMVDEATLETFEESNWGMSM  59

Query  362  ELCDMINHDRVNSVELIRGIKK  427
             +C  IN+   N+ +L+   +K
Sbjct  60   RICAQINNHEFNASKLLEPSRK  81



>gb|KDO79744.1| hypothetical protein CISIN_1g005810mg [Citrus sinensis]
Length=484

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +V+ AT++ L  P+WA N+E+CDM+NHD   + ++++GIKKRI
Sbjct  3    NSMVDRATSDMLIGPDWAMNIEICDMLNHDPGQAKDVVKGIKKRI  47



>ref|XP_004965472.1| PREDICTED: target of Myb protein 1-like [Setaria italica]
Length=685

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            LVE AT+E+L  P+W+ NLE+CD++NHD   + ++++ IKKRI
Sbjct  6    LVERATSESLIGPDWSLNLEICDILNHDPSQAKDVVKTIKKRI  48



>ref|XP_008337081.1| PREDICTED: TOM1-like protein 1 [Malus domestica]
Length=698

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            +VE AT++ L  P+WA NL +CD+ NHD V + ++++GIKKR+
Sbjct  5    MVERATSDMLIGPDWAMNLXICDICNHDPVQAKDVVKGIKKRL  47



>gb|AFW86617.1| putative VHS/GAT domain containing family protein [Zea mays]
Length=674

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            LVE AT+E+L  P+W+ NLE+CD++NHD   + ++++ IKKRI
Sbjct  6    LVERATSESLIGPDWSLNLEICDILNHDPSQAKDVVKTIKKRI  48



>ref|XP_002437041.1| hypothetical protein SORBIDRAFT_10g019670 [Sorghum bicolor]
 gb|EER88408.1| hypothetical protein SORBIDRAFT_10g019670 [Sorghum bicolor]
Length=675

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            LVE AT+E+L  P+W+ NLE+CD++NHD   + ++++ IKKRI
Sbjct  6    LVERATSESLIGPDWSLNLEICDILNHDPSQAKDVVKTIKKRI  48



>ref|XP_004172991.1| PREDICTED: TOM1-like protein 2-like, partial [Cucumis sativus]
Length=359

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            +VE AT++ L  P+WA N+E+CDMIN D   + ++++GIKKR+
Sbjct  5    IVERATSDMLIGPDWAANMEICDMINRDYGQTKDVVKGIKKRL  47



>gb|EMT01224.1| TOM1-like protein 2 [Aegilops tauschii]
Length=765

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            LV+ AT+E+L  P+W+ NLE+CD++NHD   + ++++ IKKRI
Sbjct  6    LVDRATSESLIGPDWSLNLEICDILNHDPSQAKDVVKSIKKRI  48



>gb|AFW86618.1| LOW QUALITY PROTEIN: putative VHS/GAT domain containing family 
protein [Zea mays]
Length=671

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            LVE AT+E+L  P+W+ NLE+CD++NHD   + ++++ IKKRI
Sbjct  6    LVERATSESLIGPDWSLNLEICDILNHDPSQAKDVVKTIKKRI  48



>ref|NP_001151446.1| VHS and GAT domain protein [Zea mays]
 gb|ACG42901.1| VHS and GAT domain protein [Zea mays]
Length=672

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            LVE AT+E+L  P+W+ NLE+CD++NHD   + ++++ IKKRI
Sbjct  6    LVERATSESLIGPDWSLNLEICDILNHDPSQAKDVVKTIKKRI  48



>ref|XP_007012073.1| ENTH/VHS/GAT family protein [Theobroma cacao]
 gb|EOY29692.1| ENTH/VHS/GAT family protein [Theobroma cacao]
Length=650

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CDM+NHD   + ++++GIKK++
Sbjct  3    NSMVERATSDMLIGPDWARNIEICDMLNHDPGQAKDVVKGIKKKL  47



>ref|XP_006656045.1| PREDICTED: target of Myb protein 1-like [Oryza brachyantha]
Length=681

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            LV+ AT+E+L  P+W+ NLE+CD++NHD   + ++++ IKKRI
Sbjct  6    LVDRATSESLIGPDWSLNLEICDILNHDPSQAKDVVKSIKKRI  48



>ref|XP_009768540.1| PREDICTED: target of Myb protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=673

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA NLE+CD+ NHD   + ++++GIK+R+
Sbjct  3    NSMVERATSDMLIGPDWAMNLEICDICNHDPAQAKDVVKGIKRRL  47



>gb|KHG12147.1| TOM1-like protein 2 [Gossypium arboreum]
Length=678

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CDM+NHD   + ++++GIKK++
Sbjct  3    NSMVERATSDLLIGPDWARNIEICDMLNHDPGQAKDVVKGIKKKL  47



>gb|EMS50126.1| TOM1-like protein 2 [Triticum urartu]
Length=701

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            LV+ AT+E+L  P+W+ NLE+CD++NHD   + ++++ IKKRI
Sbjct  6    LVDRATSESLIGPDWSLNLEICDILNHDPSQAKDVVKSIKKRI  48



>gb|KJB07515.1| hypothetical protein B456_001G027900 [Gossypium raimondii]
Length=645

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CDM+NHD   + ++++GIKK++
Sbjct  3    NSMVERATSDLLIGPDWARNIEICDMLNHDPGQAKDVVKGIKKKL  47



>ref|NP_187491.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
 gb|AAG51368.1|AC012562_29 hypothetical protein; 78804-81924 [Arabidopsis thaliana]
 gb|AEE74680.1| ENTH/VHS/GAT family protein [Arabidopsis thaliana]
Length=607

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            LV+ AT++ L  P+WA NLE+CDM+NH+   + E++ GIKKR+
Sbjct  5    LVDRATSDMLIGPDWAMNLEICDMLNHEPGQTREVVSGIKKRL  47



>ref|XP_006299627.1| hypothetical protein CARUB_v10015806mg [Capsella rubella]
 gb|EOA32525.1| hypothetical protein CARUB_v10015806mg [Capsella rubella]
Length=613

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            LV+ AT++ L  P+WA NLE+CDM+NH+   + E++ GIKKR+
Sbjct  5    LVDRATSDMLIGPDWAMNLEICDMLNHEPGQTREVVSGIKKRL  47



>ref|XP_006366215.1| PREDICTED: TOM1-like protein 2-like [Solanum tuberosum]
Length=674

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA NLE+CD+ NHD   + ++++GIK+R+
Sbjct  3    NSMVERATSDMLIGPDWAMNLEICDICNHDPAQAKDVVKGIKRRL  47



>ref|XP_004245269.1| PREDICTED: target of Myb protein 1 [Solanum lycopersicum]
Length=674

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA NLE+CD+ NHD   + ++++GIK+R+
Sbjct  3    NSMVERATSDMLIGPDWAMNLEICDICNHDPAQAKDVVKGIKRRL  47



>gb|KGN60332.1| hypothetical protein Csa_3G895780 [Cucumis sativus]
Length=638

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CDMIN D   + ++++GIKKR+
Sbjct  3    NPIVERATSDMLIGPDWAANMEICDMINRDYGQTKDVVKGIKKRL  47



>ref|XP_008466043.1| PREDICTED: target of Myb protein 1-like isoform X1 [Cucumis melo]
 ref|XP_008466044.1| PREDICTED: target of Myb protein 1-like isoform X1 [Cucumis melo]
 ref|XP_008466045.1| PREDICTED: target of Myb protein 1-like isoform X1 [Cucumis melo]
Length=662

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CDMIN D   + ++++GIKKR+
Sbjct  3    NPIVERATSDMLIGPDWAANMEICDMINRDYGQTKDVVKGIKKRL  47



>ref|XP_010465480.1| PREDICTED: uncharacterized protein LOC104745793 isoform X1 [Camelina 
sativa]
Length=1536

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  305  LVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            LV+ AT++ L  P+WA NLE+CDM+NH+   + E++ GIKKR+
Sbjct  5    LVDRATSDMLIGPDWAMNLEICDMLNHEPGQTREVVSGIKKRL  47



>gb|KJB07512.1| hypothetical protein B456_001G027900 [Gossypium raimondii]
Length=678

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA N+E+CDM+NHD   + ++++GIKK++
Sbjct  3    NSMVERATSDLLIGPDWARNIEICDMLNHDPGQAKDVVKGIKKKL  47



>ref|XP_009631039.1| PREDICTED: target of Myb protein 1-like [Nicotiana tomentosiformis]
Length=673

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  299  DKLVEEATAETLDEPNWATNLELCDMINHDRVNSVELIRGIKKRI  433
            + +VE AT++ L  P+WA NLE+CD+ NHD   + ++++GIK+R+
Sbjct  3    NAMVERATSDMLIGPDWAMNLEICDICNHDPAQAKDVVKGIKRRL  47



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566946208800