BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF024F17

Length=517
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFV46216.1|  hypothetical protein                                    270   3e-88   Scutellaria baicalensis [Baikal skullcap]
gb|KDO72893.1|  hypothetical protein CISIN_1g036208mg                   270   1e-87   Citrus sinensis [Valencia orange]
emb|CDY02235.1|  BnaA03g39320D                                          259   1e-84   Brassica napus [oilseed rape]
emb|CDX89754.1|  BnaC03g46680D                                          259   3e-84   Brassica napus [oilseed rape]
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       272   4e-84   Nicotiana sylvestris
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    271   5e-84   Zea mays [maize]
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    271   5e-84   Tarenaya hassleriana [spider flower]
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       271   6e-84   Cucumis melo [Oriental melon]
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    271   8e-84   Theobroma cacao [chocolate]
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       271   9e-84   Nicotiana tomentosiformis
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    271   1e-83   Sesamum indicum [beniseed]
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             271   1e-83   Citrus clementina
emb|CDY53148.1|  BnaAnng12070D                                          259   1e-83   Brassica napus [oilseed rape]
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    270   1e-83   Citrus sinensis [Valencia orange]
emb|CDY36723.1|  BnaC02g31440D                                          256   1e-83   Brassica napus [oilseed rape]
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    270   3e-83   Solanum tuberosum [potatoes]
gb|KDP44987.1|  hypothetical protein JCGZ_01487                         270   3e-83   Jatropha curcas
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    270   3e-83   Solanum tuberosum [potatoes]
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       269   5e-83   Solanum lycopersicum
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    269   5e-83   Solanum lycopersicum
gb|AAB42159.1|  Hsc70                                                   269   5e-83   Solanum lycopersicum
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...    269   5e-83   Cucumis sativus [cucumbers]
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    269   5e-83   Nicotiana tomentosiformis
ref|XP_007027053.1|  Heat shock cognate protein 70-1 isoform 2          264   6e-83   Theobroma cacao [chocolate]
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    269   6e-83   Solanum lycopersicum
gb|EPS64948.1|  hypothetical protein M569_09829                         268   7e-83   Genlisea aurea
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  268   8e-83   Morus notabilis
gb|KFK38606.1|  hypothetical protein AALP_AA3G135800                    260   9e-83   Arabis alpina [alpine rockcress]
ref|XP_002316294.1|  heat shock protein 70                              268   1e-82   Populus trichocarpa [western balsam poplar]
gb|EAY89457.1|  hypothetical protein OsI_10990                          261   1e-82   Oryza sativa Indica Group [Indian rice]
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    268   1e-82   Solanum tuberosum [potatoes]
emb|CDY16175.1|  BnaA09g29090D                                          256   1e-82   Brassica napus [oilseed rape]
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    268   1e-82   Populus euphratica
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        268   1e-82   Morus notabilis
gb|EAY98319.1|  hypothetical protein OsI_20227                          261   2e-82   Oryza sativa Indica Group [Indian rice]
emb|CDX85038.1|  BnaC05g20170D                                          256   2e-82   Brassica napus [oilseed rape]
ref|XP_002311161.1|  heat shock protein 70                              268   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     268   2e-82   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AAC84134.1|  heat shock protein                                      252   2e-82   Cichorium intybus [radicchio]
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    268   2e-82   Nicotiana sylvestris
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    267   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    267   3e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    267   3e-82   Tarenaya hassleriana [spider flower]
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    267   3e-82   Petunia x hybrida [garden petunia]
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    267   3e-82   Phoenix dactylifera
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    267   3e-82   Setaria italica
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          267   3e-82   Sorghum bicolor [broomcorn]
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    266   4e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    266   4e-82   Fragaria vesca subsp. vesca
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    266   4e-82   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ11745.1|  heat shock protein 70                                   266   5e-82   Gossypium hirsutum [American cotton]
emb|CDP09040.1|  unnamed protein product                                266   5e-82   Coffea canephora [robusta coffee]
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                266   5e-82   Erythranthe guttata [common monkey flower]
gb|EPS60056.1|  heat shock protein 70                                   266   6e-82   Genlisea aurea
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    266   6e-82   Phoenix dactylifera
gb|ACJ11742.1|  heat shock protein 70                                   266   6e-82   Gossypium hirsutum [American cotton]
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     266   6e-82   Malus domestica [apple tree]
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    265   7e-82   Nelumbo nucifera [Indian lotus]
ref|XP_002528432.1|  heat shock protein, putative                       266   7e-82   Ricinus communis
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     266   9e-82   Prunus mume [ume]
gb|EEC71767.1|  hypothetical protein OsI_04375                          259   9e-82   Oryza sativa Indica Group [Indian rice]
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     266   9e-82   Elaeis guineensis
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    266   9e-82   Populus euphratica
gb|EAY81899.1|  hypothetical protein OsI_37065                          260   1e-81   Oryza sativa Indica Group [Indian rice]
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          265   1e-81   Zea mays [maize]
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    265   1e-81   Solanum tuberosum [potatoes]
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    265   2e-81   Elaeis guineensis
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             265   2e-81   Phaseolus vulgaris [French bean]
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             265   2e-81   Prunus persica
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     265   2e-81   Aegilops tauschii
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        265   2e-81   Morus notabilis
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         265   2e-81   Jatropha curcas
gb|EPS68565.1|  hypothetical protein M569_06198                         265   2e-81   Genlisea aurea
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     265   2e-81   Phoenix dactylifera
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    265   3e-81   Nicotiana tomentosiformis
gb|KJB55903.1|  hypothetical protein B456_009G100400                    265   3e-81   Gossypium raimondii
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    265   3e-81   Nelumbo nucifera [Indian lotus]
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       264   3e-81   Cucurbita maxima [Boston marrow]
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    264   3e-81   
gb|KDP35613.1|  hypothetical protein JCGZ_09051                         264   4e-81   Jatropha curcas
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    264   4e-81   Brassica rapa
ref|XP_002527736.1|  heat shock protein, putative                       264   4e-81   Ricinus communis
emb|CDY50531.1|  BnaA01g30490D                                          264   5e-81   Brassica napus [oilseed rape]
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    264   5e-81   Solanum lycopersicum
emb|CDY31804.1|  BnaC01g27600D                                          258   5e-81   Brassica napus [oilseed rape]
gb|ABR18415.1|  unknown                                                 264   6e-81   Picea sitchensis
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       264   6e-81   Cucurbita maxima [Boston marrow]
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     263   7e-81   Solanum lycopersicum
gb|EYU41710.1|  hypothetical protein MIMGU_mgv1a022248mg                256   7e-81   Erythranthe guttata [common monkey flower]
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     263   7e-81   Vitis vinifera
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     263   8e-81   Vigna radiata [mung bean]
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    263   8e-81   Setaria italica
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...    263   8e-81   
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...    263   9e-81   Cucumis sativus [cucumbers]
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    263   9e-81   Phoenix dactylifera
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             263   9e-81   Eutrema salsugineum
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720          263   1e-80   Amborella trichopoda
gb|AGR45355.1|  HSP70                                                   263   1e-80   Dendrobium catenatum
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          263   1e-80   Theobroma cacao [chocolate]
emb|CDP00073.1|  unnamed protein product                                263   1e-80   Coffea canephora [robusta coffee]
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     263   1e-80   Glycine max [soybeans]
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    263   1e-80   
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     263   1e-80   Glycine max [soybeans]
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     263   1e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       263   1e-80   Glycine soja [wild soybean]
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    263   1e-80   Phoenix dactylifera
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                263   1e-80   Erythranthe guttata [common monkey flower]
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    263   1e-80   Theobroma cacao [chocolate]
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    263   1e-80   Cucumis melo [Oriental melon]
gb|KJB16980.1|  hypothetical protein B456_002G258500                    262   1e-80   Gossypium raimondii
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       263   1e-80   Brachypodium distachyon [annual false brome]
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    263   1e-80   Solanum tuberosum [potatoes]
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     263   2e-80   Cucumis melo [Oriental melon]
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    263   2e-80   Cicer arietinum [garbanzo]
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     262   2e-80   Nelumbo nucifera [Indian lotus]
gb|AIU40169.1|  heat shock protein 70                                   262   2e-80   Saccharum arundinaceum
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    263   2e-80   Tarenaya hassleriana [spider flower]
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    263   2e-80   Zea mays [maize]
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       261   2e-80   Medicago truncatula
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     262   2e-80   Vitis vinifera
emb|CCA29120.1|  heat shock protein 70 isoform 1                        262   2e-80   Solanum lycopersicum
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    262   2e-80   Elaeis guineensis
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    262   2e-80   Oryza brachyantha
gb|ACJ54890.1|  heat shock protein 70                                   262   2e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          262   2e-80   Sorghum bicolor [broomcorn]
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    262   2e-80   Brassica rapa
emb|CDX73815.1|  BnaA03g32320D                                          262   2e-80   Brassica napus [oilseed rape]
emb|CDY00784.1|  BnaC03g37680D                                          262   2e-80   Brassica napus [oilseed rape]
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    262   2e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2     262   2e-80   Fragaria vesca subsp. vesca
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         261   2e-80   Jatropha curcas
emb|CCA29121.1|  heat shock protein 70 isoform 2                        262   2e-80   Solanum lycopersicum
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    262   2e-80   Phoenix dactylifera
ref|NP_001055754.1|  Os05g0460000                                       262   2e-80   
gb|ADZ46371.1|  HSP70                                                   262   3e-80   Malus hupehensis
emb|CDY52661.1|  BnaC01g38510D                                          262   3e-80   Brassica napus [oilseed rape]
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     262   3e-80   Nicotiana sylvestris
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     262   3e-80   Nicotiana tomentosiformis
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    262   3e-80   Cicer arietinum [garbanzo]
gb|AIZ68155.1|  heat shock protein 70                                   261   3e-80   Ornithogalum longebracteatum [sea-onion]
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    261   3e-80   Fragaria vesca subsp. vesca
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    261   4e-80   Elaeis guineensis
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    261   4e-80   Pyrus x bretschneideri [bai li]
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    261   4e-80   Glycine max [soybeans]
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     261   4e-80   Glycine soja [wild soybean]
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       261   5e-80   Medicago truncatula
ref|XP_006424798.1|  hypothetical protein CICLE_v10028007mg             261   5e-80   Citrus clementina
gb|EAY89450.1|  hypothetical protein OsI_10982                          256   5e-80   Oryza sativa Indica Group [Indian rice]
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       261   5e-80   Medicago truncatula
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     261   5e-80   Sesamum indicum [beniseed]
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                261   5e-80   
ref|XP_009353696.1|  PREDICTED: probable mediator of RNA polymera...    258   5e-80   Pyrus x bretschneideri [bai li]
emb|CAB72129.1|  heat shock protein 70                                  261   5e-80   Cucumis sativus [cucumbers]
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          261   5e-80   Sorghum bicolor [broomcorn]
gb|KJB16979.1|  hypothetical protein B456_002G258500                    261   5e-80   Gossypium raimondii
gb|ACJ11741.1|  heat shock protein 70                                   261   5e-80   Gossypium hirsutum [American cotton]
gb|ABP35942.1|  heat shock protein 70                                   261   5e-80   Cyclamen persicum
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    261   5e-80   Sesamum indicum [beniseed]
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    261   6e-80   Nicotiana tomentosiformis
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    261   6e-80   Setaria italica
gb|AAR17080.1|  heat shock protein 70-3                                 261   6e-80   Nicotiana tabacum [American tobacco]
gb|ABA95501.2|  Heat shock cognate 70 kDa protein, putative, expr...    260   6e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010423854.1|  PREDICTED: probable mediator of RNA polymera...    247   6e-80   Camelina sativa [gold-of-pleasure]
gb|AAB99745.1|  HSP70                                                   261   6e-80   Triticum aestivum [Canadian hard winter wheat]
gb|ACJ11740.1|  heat shock protein 70                                   261   7e-80   Gossypium hirsutum [American cotton]
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     261   7e-80   Vitis vinifera
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    261   7e-80   Nicotiana sylvestris
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    261   8e-80   Brachypodium distachyon [annual false brome]
gb|KJB73858.1|  hypothetical protein B456_011G256600                    261   8e-80   Gossypium raimondii
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     261   8e-80   Triticum urartu
ref|NP_001068540.1|  Os11g0703900                                       261   9e-80   
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    261   9e-80   Oryza brachyantha
ref|XP_002312089.1|  heat shock protein 70 cognate                      260   9e-80   Populus trichocarpa [western balsam poplar]
ref|NP_001044757.1|  Os01g0840100                                       260   9e-80   
dbj|BAK00257.1|  predicted protein                                      260   1e-79   Hordeum vulgare subsp. vulgare [barley]
ref|XP_007144450.1|  hypothetical protein PHAVU_007G157200g             259   1e-79   Phaseolus vulgaris [French bean]
ref|WP_039310754.1|  molecular chaperone DnaK                           260   1e-79   Paenibacillus sp. IHB B 3415
gb|AAA86903.1|  heat shock protein cognate 70                           247   1e-79   Sorghum bicolor [broomcorn]
emb|CAA83548.1|  PsHSC71.0                                              260   1e-79   Pisum sativum [garden pea]
ref|XP_003621869.1|  Heat shock protein                                 260   1e-79   Medicago truncatula
emb|CDP09035.1|  unnamed protein product                                260   1e-79   Coffea canephora [robusta coffee]
ref|XP_002532297.1|  heat shock protein, putative                       260   1e-79   Ricinus communis
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       260   1e-79   Aegilops tauschii
ref|NP_001183165.1|  uncharacterized protein LOC100501536               260   1e-79   Zea mays [maize]
gb|ACB70177.1|  70 kDa heat shock protein                               260   1e-79   Capparis spinosa [caper]
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    260   1e-79   Tarenaya hassleriana [spider flower]
gb|KCW50223.1|  hypothetical protein EUGRSUZ_J00023                     259   1e-79   Eucalyptus grandis [rose gum]
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    263   1e-79   Zea mays [maize]
gb|AAB97316.1|  cytosolic heat shock 70 protein                         260   2e-79   Spinacia oleracea
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             260   2e-79   Phaseolus vulgaris [French bean]
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    260   2e-79   Brassica rapa
gb|AAB88009.1|  heat shock cognate protein HSC70                        259   2e-79   Brassica napus [oilseed rape]
gb|KCW50224.1|  hypothetical protein EUGRSUZ_J00023                     259   2e-79   Eucalyptus grandis [rose gum]
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    259   2e-79   Eucalyptus grandis [rose gum]
gb|ADD71975.1|  heat shock protein 70                                   259   2e-79   Rhododendron calophytum
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             259   2e-79   Eutrema salsugineum
dbj|BAJ34054.1|  unnamed protein product                                259   2e-79   Eutrema halophilum
ref|XP_009112006.1|  PREDICTED: probable mediator of RNA polymera...    256   2e-79   Brassica rapa
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             259   2e-79   Arabidopsis lyrata subsp. lyrata
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             259   2e-79   Populus trichocarpa [western balsam poplar]
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    259   3e-79   Populus euphratica
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             259   3e-79   Citrus clementina
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     259   3e-79   Eucalyptus grandis [rose gum]
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    259   3e-79   Brachypodium distachyon [annual false brome]
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    259   3e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     259   3e-79   Vigna radiata [mung bean]
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    259   3e-79   Solanum tuberosum [potatoes]
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    259   4e-79   Solanum lycopersicum
gb|EMS51135.1|  Heat shock cognate 70 kDa protein                       258   4e-79   Triticum urartu
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     259   4e-79   Populus euphratica
gb|ACD93209.1|  heat shock protein 70                                   259   4e-79   Camellia sinensis [black tea]
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    259   4e-79   Tarenaya hassleriana [spider flower]
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             259   4e-79   Capsella rubella
ref|NP_187864.1|  heat shock protein 70-4                               259   4e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    259   4e-79   Brachypodium distachyon [annual false brome]
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    259   4e-79   Phoenix dactylifera
gb|AFA51946.1|  heat shock protein 70                                   259   5e-79   Paeonia suffruticosa [moutan peony]
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein               259   5e-79   Fragaria vesca subsp. vesca
gb|ACR38891.1|  heat shock protein 70                                   259   5e-79   Apopellia endiviifolia (species B)
gb|KJB46580.1|  hypothetical protein B456_007G375600                    258   5e-79   Gossypium raimondii
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             258   5e-79   Citrus clementina
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    258   5e-79   Populus euphratica
ref|XP_008458071.1|  PREDICTED: heat shock cognate 70 kDa protein...    245   5e-79   
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             258   5e-79   Prunus persica
gb|AEK70336.1|  heat shock protein 70                                   258   5e-79   Paeonia lactiflora [common garden peony]
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    258   6e-79   Arabis alpina [alpine rockcress]
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    258   6e-79   Arabis alpina [alpine rockcress]
emb|CAB72130.1|  heat shock protein 70                                  258   6e-79   Cucumis sativus [cucumbers]
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             258   6e-79   Eutrema salsugineum
gb|AAS09825.1|  heat shock cognate protein 70                           258   6e-79   Eutrema halophilum
ref|NP_001119156.1|  heat shock cognate protein 70-1                    255   6e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    258   6e-79   Phoenix dactylifera
ref|XP_008223372.1|  PREDICTED: probable mediator of RNA polymera...    255   7e-79   
ref|XP_007009369.1|  Heat shock protein 70                              258   7e-79   Theobroma cacao [chocolate]
ref|XP_007023492.1|  Heat shock protein 70B                             258   8e-79   Theobroma cacao [chocolate]
gb|EEC76425.1|  hypothetical protein OsI_14101                          252   8e-79   Oryza sativa Indica Group [Indian rice]
gb|AFU34347.1|  70-kDa heat shock protein                               258   9e-79   Ipomoea batatas [batate]
gb|AAA62445.1|  heat shock protein                                      258   1e-78   Spinacia oleracea
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    258   1e-78   Pyrus x bretschneideri [bai li]
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     259   1e-78   Eucalyptus grandis [rose gum]
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     259   1e-78   Eucalyptus grandis [rose gum]
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                258   1e-78   Erythranthe guttata [common monkey flower]
gb|KJB20862.1|  hypothetical protein B456_003G169700                    258   1e-78   Gossypium raimondii
gb|ACM42161.1|  heat shock protein 70.58                                258   1e-78   Ageratina adenophora
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    258   1e-78   Malus domestica [apple tree]
gb|ACD45076.1|  heat-shock protein 70                                   258   1e-78   Dactylis glomerata [cocksfoot]
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    257   1e-78   Solanum lycopersicum
gb|KJB36734.1|  hypothetical protein B456_006G174000                    257   1e-78   Gossypium raimondii
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    257   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_001767221.1|  predicted protein                                  257   1e-78   Physcomitrella patens
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    257   1e-78   Oryza brachyantha
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    257   2e-78   Pyrus x bretschneideri [bai li]
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    257   2e-78   Tarenaya hassleriana [spider flower]
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    257   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    257   2e-78   Brassica rapa
ref|XP_001767839.1|  predicted protein                                  257   2e-78   Physcomitrella patens
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    257   2e-78   Camelina sativa [gold-of-pleasure]
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     257   2e-78   Petunia x hybrida [garden petunia]
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       257   2e-78   Aegilops tauschii
emb|CAA05547.1|  heat shock protein 70                                  257   2e-78   Arabidopsis thaliana [mouse-ear cress]
gb|AGL07711.1|  heat shock protein 70                                   257   2e-78   Ziziphus jujuba [Chinese jujube]
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    257   2e-78   Nicotiana tomentosiformis
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    257   2e-78   Setaria italica
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    257   2e-78   Nicotiana sylvestris
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       257   3e-78   Aegilops tauschii
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             256   3e-78   Capsella rubella
ref|XP_001751923.1|  predicted protein                                  256   3e-78   Physcomitrella patens
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     256   3e-78   Glycine soja [wild soybean]
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          256   3e-78   Sorghum bicolor [broomcorn]
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           256   3e-78   Cucurbita maxima [Boston marrow]
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    258   3e-78   
dbj|BAK07857.1|  predicted protein                                      259   3e-78   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    256   3e-78   Prunus mume [ume]
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             256   3e-78   Phaseolus vulgaris [French bean]
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     256   3e-78   Vitis vinifera
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    256   3e-78   
dbj|BAK02194.1|  predicted protein                                      256   4e-78   Hordeum vulgare subsp. vulgare [barley]
ref|XP_003621886.1|  Heat shock protein                                 256   4e-78   Medicago truncatula
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    256   4e-78   Brassica rapa
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    256   4e-78   
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       257   4e-78   
gb|ACJ85522.1|  unknown                                                 256   5e-78   
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    256   5e-78   
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    256   5e-78   
ref|NP_001049712.1|  Os03g0276500                                       256   5e-78   
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    256   5e-78   
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             256   5e-78   
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    256   6e-78   
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    256   6e-78   
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...    256   7e-78   
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...    256   7e-78   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       255   8e-78   
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    255   9e-78   
gb|AAP04522.1|  heat shock protein 70                                   255   1e-77   
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        255   1e-77   
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        255   1e-77   
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    255   1e-77   
gb|ABD32895.1|  Heat shock protein Hsp70                                255   1e-77   
ref|XP_001781229.1|  predicted protein                                  255   1e-77   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             255   1e-77   
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    255   1e-77   
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    255   1e-77   
dbj|BAJ86014.1|  predicted protein                                      255   1e-77   
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    254   1e-77   
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg             255   1e-77   
ref|XP_001783048.1|  predicted protein                                  255   1e-77   
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          255   1e-77   
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    254   1e-77   
emb|CAA52684.1|  heat shock protein 70 cognate                          254   2e-77   
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          255   2e-77   
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    254   2e-77   
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             254   2e-77   
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       254   2e-77   
ref|NP_195870.1|  heat shock cognate protein 70-1                       254   2e-77   
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             254   2e-77   
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...    251   2e-77   
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                254   2e-77   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               254   2e-77   
ref|XP_001785822.1|  predicted protein                                  254   2e-77   
gb|AAV98051.1|  heat shock protein 70                                   254   2e-77   
gb|AIU34470.1|  putative heat shock protein                             254   2e-77   
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                254   3e-77   
gb|AIA22210.1|  heat shock protein 70                                   254   3e-77   
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             254   3e-77   
emb|CAA47948.2|  heat shock protein 70                                  254   3e-77   
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     254   3e-77   
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     254   3e-77   
dbj|BAJ91305.1|  predicted protein                                      254   3e-77   
ref|XP_008353760.1|  PREDICTED: heat shock 70 kDa protein isoform X4    254   4e-77   
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     254   4e-77   
ref|XP_008353758.1|  PREDICTED: heat shock 70 kDa protein isoform X2    254   4e-77   
ref|XP_001759874.1|  predicted protein                                  253   4e-77   
gb|KHN13890.1|  Heat shock cognate 70 kDa protein 2                     255   4e-77   
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    261   4e-77   
ref|XP_002873055.1|  predicted protein                                  253   4e-77   
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg             253   5e-77   
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             253   5e-77   
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          253   5e-77   
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg             253   5e-77   
gb|KCW74480.1|  hypothetical protein EUGRSUZ_E03189                     250   5e-77   
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg             253   6e-77   
gb|AAV97978.1|  heat shock protein hsp70                                253   6e-77   
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3    253   6e-77   
ref|NP_001051724.1|  Os03g0821100                                       253   7e-77   
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein               253   7e-77   
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             253   7e-77   
gb|ACC93947.1|  heat-shock protein 70                                   253   7e-77   
ref|NP_176036.1|  heat shock protein ERD2                               252   8e-77   
dbj|BAA04848.1|  HSP70                                                  253   9e-77   
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1    253   9e-77   
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       253   9e-77   
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1    253   1e-76   
dbj|BAP90755.1|  heat shock protein 70                                  253   1e-76   
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     253   1e-76   
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    252   1e-76   
ref|XP_003625487.1|  Heat shock protein                                 254   1e-76   
ref|XP_008450536.1|  PREDICTED: heat shock 70 kDa protein               252   1e-76   
ref|XP_011034569.1|  PREDICTED: heat shock 70 kDa protein-like          252   1e-76   
ref|XP_006368489.1|  heat shock protein 70 cognate                      252   2e-76   
ref|XP_004152854.1|  PREDICTED: heat shock 70 kDa protein-like          252   2e-76   
ref|NP_187555.1|  heat shock protein 70-3                               252   2e-76   
gb|KDP41951.1|  hypothetical protein JCGZ_26969                         252   2e-76   
ref|XP_002891955.1|  early-responsive to dehydration 2                  251   2e-76   
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein               252   2e-76   
ref|XP_010063602.1|  PREDICTED: probable mediator of RNA polymera...    249   2e-76   
emb|CDO98244.1|  unnamed protein product                                251   2e-76   
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like          251   2e-76   
ref|XP_002312090.1|  heat shock protein 70 cognate                      251   3e-76   
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    251   3e-76   
ref|XP_002873056.1|  HSC70-1                                            251   3e-76   
gb|KJB49429.1|  hypothetical protein B456_008G119200                    250   3e-76   
ref|XP_002987209.1|  hypothetical protein SELMODRAFT_125427             251   3e-76   
ref|XP_010094065.1|  Heat shock 70 kDa protein                          251   4e-76   
ref|XP_002976367.1|  hypothetical protein SELMODRAFT_443126             251   4e-76   
gb|KJB83911.1|  hypothetical protein B456_013G270600                    251   4e-76   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    251   4e-76   
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    250   4e-76   
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          251   4e-76   
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          251   4e-76   
ref|XP_007013854.1|  Heat shock protein 70B                             251   4e-76   
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein               251   5e-76   
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    251   5e-76   
emb|CCD74508.1|  early-responsive to dehydration 2                      250   5e-76   
gb|ABX76301.1|  heat shock protein 70                                   251   6e-76   
gb|KJB20110.1|  hypothetical protein B456_003G133400                    250   6e-76   
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                250   6e-76   
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    250   7e-76   
gb|ACV52590.1|  heat shock protein 70-like protein                      236   7e-76   
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   250   7e-76   
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                250   8e-76   
gb|AAM48131.1|AF509336_1  heat shock protein 70                         250   9e-76   
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          250   1e-75   
ref|XP_010094064.1|  Heat shock cognate 70 kDa protein                  250   1e-75   
ref|NP_195869.1|  heat shock protein 70                                 250   1e-75   
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein               250   1e-75   
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    250   1e-75   
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    250   1e-75   
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    249   1e-75   
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like          249   1e-75   
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     251   1e-75   
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             249   2e-75   
ref|XP_010063601.1|  PREDICTED: probable mediator of RNA polymera...    248   2e-75   
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    248   2e-75   
ref|XP_010063600.1|  PREDICTED: heat shock 70 kDa protein 5-like ...    249   2e-75   
ref|XP_010265523.1|  PREDICTED: heat shock 70 kDa protein-like          249   3e-75   
ref|XP_010063599.1|  PREDICTED: heat shock 70 kDa protein-like is...    249   3e-75   
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    248   4e-75   
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    248   4e-75   
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    248   4e-75   
ref|XP_010273661.1|  PREDICTED: heat shock 70 kDa protein-like          248   4e-75   
ref|XP_011079384.1|  PREDICTED: heat shock 70 kDa protein               248   5e-75   
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    248   6e-75   
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                     250   6e-75   
gb|KJB49499.1|  hypothetical protein B456_008G122300                    246   7e-75   
ref|XP_006368490.1|  heat shock protein 70 cognate                      248   7e-75   
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    248   8e-75   
ref|XP_006378714.1|  heat shock protein 70 cognate                      247   9e-75   
gb|KDP41952.1|  hypothetical protein JCGZ_26970                         247   1e-74   
ref|XP_002512742.1|  heat shock protein, putative                       247   1e-74   
gb|AAA32819.1|  heat shock protein HSP70-1                              231   1e-74   
ref|XP_009789460.1|  PREDICTED: heat shock 70 kDa protein               247   2e-74   
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    250   3e-74   
ref|XP_003549537.1|  PREDICTED: heat shock 70 kDa protein-like is...    246   4e-74   
ref|XP_006341414.1|  PREDICTED: heat shock cognate 70 kDa protein...    246   4e-74   
ref|XP_010318701.1|  PREDICTED: heat shock 70 kDa protein 5             246   4e-74   
gb|EYU21748.1|  hypothetical protein MIMGU_mgv1a020843mg                246   5e-74   
ref|XP_009615698.1|  PREDICTED: heat shock 70 kDa protein               245   5e-74   
ref|XP_007154870.1|  hypothetical protein PHAVU_003G154800g             245   6e-74   
ref|XP_009122774.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    243   7e-74   
ref|XP_002512741.1|  heat shock protein, putative                       245   8e-74   
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein               245   8e-74   
ref|XP_011082530.1|  PREDICTED: heat shock 70 kDa protein-like          245   9e-74   
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     252   1e-73   
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    249   1e-73   
gb|KDO55360.1|  hypothetical protein CISIN_1g038511mg                   244   1e-73   
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             244   1e-73   
ref|XP_010678398.1|  PREDICTED: heat shock 70 kDa protein-like          244   2e-73   
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                    243   3e-73   
ref|XP_009399566.1|  PREDICTED: heat shock 70 kDa protein-like          243   3e-73   
ref|XP_010929169.1|  PREDICTED: heat shock 70 kDa protein-like          243   3e-73   
ref|XP_003519161.1|  PREDICTED: heat shock 70 kDa protein-like          243   3e-73   
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       243   3e-73   
ref|XP_009771888.1|  PREDICTED: heat shock 70 kDa protein-like          243   4e-73   
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    243   5e-73   
ref|XP_010905019.1|  PREDICTED: heat shock 70 kDa protein               242   7e-73   
emb|CDP02832.1|  unnamed protein product                                242   8e-73   
dbj|BAM44861.1|  heat shock protein                                     233   8e-73   
ref|XP_008354483.1|  PREDICTED: heat shock cognate 70 kDa protein...    235   1e-72   
gb|KCW53915.1|  hypothetical protein EUGRSUZ_J03127                     241   1e-72   
ref|XP_011073307.1|  PREDICTED: heat shock 70 kDa protein-like          242   1e-72   
ref|XP_009622824.1|  PREDICTED: heat shock 70 kDa protein-like          241   1e-72   
ref|XP_004507753.1|  PREDICTED: heat shock 70 kDa protein-like          241   2e-72   
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             241   2e-72   
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             241   2e-72   
gb|AGT97046.1|  heat shock protein 70                                   241   3e-72   
ref|XP_010034044.1|  PREDICTED: heat shock 70 kDa protein-like          241   3e-72   
ref|XP_006343624.1|  PREDICTED: heat shock 70 kDa protein-like          241   3e-72   
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        240   4e-72   
ref|XP_010537859.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    240   4e-72   
ref|XP_006346613.1|  PREDICTED: heat shock 70 kDa protein-like          240   5e-72   
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             240   6e-72   
gb|ABK25453.1|  unknown                                                 239   8e-72   
ref|XP_004242612.1|  PREDICTED: heat shock 70 kDa protein-like          239   1e-71   
ref|XP_010242444.1|  PREDICTED: heat shock cognate 70 kDa protein...    224   1e-71   
gb|KDO67637.1|  hypothetical protein CISIN_1g041815mg                   235   1e-71   
gb|AAA82975.1|  PsHSP71.2                                               239   2e-71   
ref|XP_008794364.1|  PREDICTED: heat shock 70 kDa protein-like          239   2e-71   
ref|XP_006416851.1|  hypothetical protein EUTSA_v10007031mg             238   2e-71   
dbj|BAE48223.1|  heat shock protein 70                                  238   2e-71   
ref|XP_003610287.1|  Heat-shock protein                                 238   3e-71   
gb|KDP38702.1|  hypothetical protein JCGZ_04055                         238   3e-71   
emb|CBI31691.3|  unnamed protein product                                232   8e-71   
dbj|BAJ34597.1|  unnamed protein product                                237   9e-71   
ref|XP_006826662.1|  hypothetical protein AMTR_s00137p00032560          237   1e-70   
ref|XP_010091163.1|  Heat shock 70 kDa protein                          237   1e-70   
gb|KHN14134.1|  Heat shock 70 kDa protein                               236   1e-70   
gb|EYU34331.1|  hypothetical protein MIMGU_mgv1a021436mg                236   2e-70   
gb|AES65513.2|  animal HSPA9 nucleotide-binding domain protein          243   2e-70   
sp|P26413.1|HSP70_SOYBN  RecName: Full=Heat shock 70 kDa protein        236   2e-70   
ref|XP_010476705.1|  PREDICTED: heat shock 70 kDa protein 5             236   2e-70   
ref|XP_003595262.1|  Heat shock protein                                 242   3e-70   
ref|XP_010497610.1|  PREDICTED: heat shock 70 kDa protein 5-like        235   4e-70   
gb|AAL68968.1|  heat shock protein 70                                   235   4e-70   
ref|XP_009149047.1|  PREDICTED: heat shock 70 kDa protein 5             235   4e-70   
ref|XP_005843891.1|  heat shock protein 70                              235   5e-70   
ref|XP_010459142.1|  PREDICTED: heat shock 70 kDa protein 5-like        234   6e-70   
emb|CAN66715.1|  hypothetical protein VITISV_041184                     234   6e-70   
ref|XP_002303859.2|  heat shock protein 70 cognate                      234   8e-70   
gb|KDD74618.1|  heat shock protein Hsp70                                233   8e-70   
ref|XP_006306285.1|  hypothetical protein CARUB_v10012149mg             234   1e-69   
gb|ETL43818.1|  hsp70-like protein                                      220   1e-69   
gb|ETL96982.1|  hsp70-like protein                                      219   1e-69   
prf||1205208A  heat shock protein hsp70                                 233   2e-69
ref|XP_009110463.1|  PREDICTED: heat shock 70 kDa protein 5-like        233   2e-69   
emb|CDX96825.1|  BnaA08g23680D                                          233   2e-69   
ref|XP_002279097.1|  PREDICTED: heat shock cognate 70 kDa protein       233   2e-69   
emb|CDX83960.1|  BnaC08g16850D                                          233   2e-69   
gb|EMD49224.1|  heat shock protein hsp70A2, putative                    219   3e-69   
gb|EPS69582.1|  heat shock protein hsp70                                232   3e-69   
ref|NP_173055.1|  heat shock protein 70B                                232   4e-69   



>gb|AFV46216.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=233

 Score =   270 bits (690),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV++KGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNHKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKMK
Sbjct  121  EEISSMVLTKMK  132



>gb|KDO72893.1| hypothetical protein CISIN_1g036208mg, partial [Citrus sinensis]
Length=279

 Score =   270 bits (690),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAG GDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLNKMK  132



>emb|CDY02235.1| BnaA03g39320D [Brassica napus]
Length=185

 Score =   259 bits (661),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>emb|CDX89754.1| BnaC03g46680D [Brassica napus]
Length=224

 Score =   259 bits (662),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  40   MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  99

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVVSYKGE+KQF+A
Sbjct  100  QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFAA  159

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  160  EEISSMVLIKMR  171



>ref|XP_009784009.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana sylvestris]
Length=651

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAGPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKMK
Sbjct  121  EEISSMVLTKMK  132



>ref|XP_008656365.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 gb|AFW82225.1| hypothetical protein ZEAMMB73_366749 [Zea mays]
Length=649

 Score =   271 bits (694),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKV+AGPGDKPMIVVSYKGEDKQFSAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVAGPGDKPMIVVSYKGEDKQFSAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVLTKMK
Sbjct  122  ISSMVLTKMK  131



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score =   271 bits (694),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 132/132 (100%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRRYSDPSV++DMKLWPFKVI+GPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDPSVKADMKLWPFKVISGPGDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   271 bits (694),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   271 bits (693),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQSDMKLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKMK
Sbjct  121  EEISSMVLTKMK  132



>ref|XP_009604213.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana tomentosiformis]
Length=651

 Score =   271 bits (693),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKMK
Sbjct  121  EEISSMVLTKMK  132



>ref|XP_011091460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=649

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVSYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_006424799.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
 gb|ESR38039.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
Length=649

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAG GDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLNKMK  132



>emb|CDY53148.1| BnaAnng12070D [Brassica napus]
Length=256

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_006488297.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
Length=649

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAG GDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLNKMK  132



>emb|CDY36723.1| BnaC02g31440D [Brassica napus]
Length=195

 Score =   256 bits (655),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDR+EIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRIEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_006349005.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVTYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKMK
Sbjct  121  EEISSMVLTKMK  132



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQ DMKLWPFKVIAGPGDKPMIVVSYKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQGDMKLWPFKVIAGPGDKPMIVVSYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_006349004.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVTYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKMK
Sbjct  121  EEISSMVLTKMK  132



>ref|XP_004250959.1| PREDICTED: heat shock cognate 70 kDa protein [Solanum lycopersicum]
Length=654

 Score =   269 bits (688),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +1

Query  115  LLMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  294
            +  AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAAAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60

Query  295  KNQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQF  474
            KNQVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQF
Sbjct  61   KNQVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEEKQF  120

Query  475  SAEEISSMVLTKMK  516
            SAEEISSMVLTKMK
Sbjct  121  SAEEISSMVLTKMK  134



>ref|XP_010319122.1| PREDICTED: heat shock protein 70 isoform 3 isoform X1 [Solanum 
lycopersicum]
Length=652

 Score =   269 bits (688),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>gb|AAB42159.1| Hsc70 [Solanum lycopersicum]
Length=651

 Score =   269 bits (688),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156712.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   269 bits (687),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   269 bits (687),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLVKMK  132



>ref|XP_007027053.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY07555.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
Length=457

 Score =   264 bits (674),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  LMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  297
            +MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  16   VMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  75

Query  298  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  477
            NQVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI+GPGDKPMIVVSYKGE+KQF+
Sbjct  76   NQVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQFA  135

Query  478  AEEISSMVLTKMK  516
            AEEISSMVL KM+
Sbjct  136  AEEISSMVLMKMR  148



>ref|NP_001266213.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
 emb|CCA29122.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
Length=651

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>gb|EPS64948.1| hypothetical protein M569_09829, partial [Genlisea aurea]
Length=635

 Score =   268 bits (686),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +1

Query  115  LLMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  294
            LLMA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  7    LLMAVKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  66

Query  295  KNQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQF  474
            KNQVAMNP NTVFDAKRLIGRR+SDPSVQSD+KLWPFKVIAG GDKPMIVVSYKGE+KQF
Sbjct  67   KNQVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIAGAGDKPMIVVSYKGEEKQF  126

Query  475  SAEEISSMVLTKMK  516
            SAEEISSMVL KMK
Sbjct  127  SAEEISSMVLIKMK  140



>ref|XP_010106444.1| Heat shock cognate 70 kDa protein [Morus notabilis]
 gb|EXC10620.1| Heat shock cognate 70 kDa protein [Morus notabilis]
Length=652

 Score =   268 bits (686),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMKLWPFKVIAGPGDKPMIVV++KGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQNDMKLWPFKVIAGPGDKPMIVVNHKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>gb|KFK38606.1| hypothetical protein AALP_AA3G135800 [Arabis alpina]
Length=357

 Score =   260 bits (665),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKVI+GP +KPMIVV++KGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMIVVNHKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSD+KLWPFKV+AGPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVVAGPGDKPMIVVTYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|EAY89457.1| hypothetical protein OsI_10990 [Oryza sativa Indica Group]
Length=415

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  MAG-KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  297
            MAG KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGNKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  298  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  477
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GP DKPMIVV+YKGE+K+FS
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFS  120

Query  478  AEEISSMVLTKMK  516
            AEEISSMVLTKMK
Sbjct  121  AEEISSMVLTKMK  133



>ref|XP_006365705.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+K+FSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKEFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>emb|CDY16175.1| BnaA09g29090D [Brassica napus]
Length=257

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  LMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  297
            + AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60

Query  298  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  477
            NQVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVV YKGE+KQF+
Sbjct  61   NQVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVDYKGEEKQFA  120

Query  478  AEEISSMVLTKMK  516
            AEEISSMVL KM+
Sbjct  121  AEEISSMVLIKMR  133



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDVKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|EAY98319.1| hypothetical protein OsI_20227 [Oryza sativa Indica Group]
Length=410

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKV+ GPGDKPMIVV YKGE+KQF+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KM+
Sbjct  122  ISSMVLIKMR  131



>emb|CDX85038.1| BnaC05g20170D [Brassica napus]
Length=263

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  LMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  297
            +  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MSGGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60

Query  298  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  477
            NQVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVVSYKGE+KQF+
Sbjct  61   NQVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFA  120

Query  478  AEEISSMVLTKMK  516
            AEEISSMVL KM+
Sbjct  121  AEEISSMVLIKMR  133



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDVKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV++KGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNHKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EE+SSMVLTKMK
Sbjct  121  EEVSSMVLTKMK  132



>gb|AAC84134.1| heat shock protein [Cichorium intybus]
Length=153

 Score =   252 bits (644),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKV  GP +KPMI V+YKGE+K F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVNYKGEEKTFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR++DPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFNDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLVKMK  132



>ref|XP_009407484.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
 ref|XP_009407485.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=649

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  LMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  297
            +  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  298  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  477
            NQVAMNP NTVFDAKRLIGRRYSDPSVQSD+KLWPFKVIAGPGDKPMIVV YKGE+KQFS
Sbjct  61   NQVAMNPINTVFDAKRLIGRRYSDPSVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFS  120

Query  478  AEEISSMVLTKMK  516
            AEEISSMVL KMK
Sbjct  121  AEEISSMVLIKMK  133



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRRYSD SVQSD+KLWPFKV+ GPGDKPMI+V Y+GEDKQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDASVQSDIKLWPFKVVPGPGDKPMIIVQYRGEDKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRRYSDPSVQ+DMKLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDPSVQADMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>sp|P09189.1|HSP7C_PETHY RecName: Full=Heat shock cognate 70 kDa protein [Petunia x hybrida]
 emb|CAA30018.1| heat shock protein 70 [Petunia x hybrida]
Length=651

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKMK
Sbjct  121  EEISSMVLTKMK  132



>ref|XP_008776656.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=649

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAGPGDKPMIVV YKGE+KQFSAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVQYKGEEKQFSAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KMK
Sbjct  122  ISSMVLMKMK  131



>ref|XP_004961848.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKV+AGP DKPMIVV+YKGE+KQFSAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVAGPADKPMIVVNYKGEEKQFSAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVLTKMK
Sbjct  122  ISSMVLTKMK  131



>ref|XP_002441219.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor]
 gb|EES19649.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor]
Length=649

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKV+AGP DKPMIVV+YKGE+KQFSAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVAGPADKPMIVVNYKGEEKQFSAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVLTKMK
Sbjct  122  ISSMVLTKMK  131



>ref|XP_009380663.1| PREDICTED: heat shock cognate 70 kDa protein-like [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/129 (97%), Positives = 127/129 (98%), Gaps = 0/129 (0%)
 Frame = +1

Query  130  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  309
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  310  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  489
            MNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVIAGPGDKPMIVV YKGE+KQFS EEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVQYKGEEKQFSPEEI  122

Query  490  SSMVLTKMK  516
            SSMVLTKMK
Sbjct  123  SSMVLTKMK  131



>ref|XP_004287404.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQ DMKLWPFKV+AGPGDKPMIVVSYKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQGDMKLWPFKVVAGPGDKPMIVVSYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLVKMR  132



>ref|XP_009388623.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRRYSD SVQSD+KLWPFKVIAGPGDKPMIVV YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRRYSD SVQSDMKLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMI+V+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EE+SSMVLTKMK
Sbjct  121  EEVSSMVLTKMK  132



>gb|EYU33210.1| hypothetical protein MIMGU_mgv1a002616mg [Erythranthe guttata]
Length=653

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMK WPFKVI GP +KPMIVVS+KGEDKQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKHWPFKVIPGPAEKPMIVVSHKGEDKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>gb|EPS60056.1| heat shock protein 70 [Genlisea aurea]
Length=653

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRRYSD SVQSD++LWPFKVI GPGDKPMIVVSYKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDASVQSDIQLWPFKVIPGPGDKPMIVVSYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   266 bits (680),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMI V YKGEDKQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIGVQYKGEDKQFSA  120

Query  481  EEISSMVLTKMK  516
            EE+SSMVL KMK
Sbjct  121  EEVSSMVLMKMK  132



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
 gb|KJB67650.1| hypothetical protein B456_010G202100 [Gossypium raimondii]
Length=648

 Score =   266 bits (680),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRRYSD SVQSDMKLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   266 bits (680),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVXYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_010253827.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=619

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMI+VSYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIMVSYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   266 bits (680),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRRYSD SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDASVQSDIKLWPFKVIAGPGDKPMIVVAYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   266 bits (679),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE++QF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEERQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|EEC71767.1| hypothetical protein OsI_04375 [Oryza sativa Indica Group]
Length=423

 Score =   259 bits (663),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV YKGE+KQFSAEE
Sbjct  62   AMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KM+
Sbjct  122  ISSMVLIKMR  131



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   266 bits (679),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV YKGEDKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   266 bits (679),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQ+D+KLWPFKV+AGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQNDIKLWPFKVVAGPGDKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|EAY81899.1| hypothetical protein OsI_37065 [Oryza sativa Indica Group]
Length=434

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_008674843.1| PREDICTED: heat shock 70 kDa protein-like [Zea mays]
 tpg|DAA56909.1| TPA: hypothetical protein ZEAMMB73_648566 [Zea mays]
Length=648

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVVSYKGE+KQF+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVSYKGEEKQFAAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KMK
Sbjct  122  ISSMVLIKMK  131



>ref|XP_006349514.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=647

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GPGDKPMIVV+YKGEDKQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEDKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKV+AGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDVSVQSDIKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLMKMK  132



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D +VQSDMKLWPFKVIAGPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDAAVQSDMKLWPFKVIAGPGDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE++QF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEERQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|EMT11425.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=648

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR SDPSVQSDMKLWPFKVIAGPGDKPMIVV YKGE+K+F+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRVSDPSVQSDMKLWPFKVIAGPGDKPMIVVQYKGEEKEFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_010095013.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58119.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=648

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++DPSVQSD+KLWPFKVI+GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDPSVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVVSYKGEDKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVSYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|EPS68565.1| hypothetical protein M569_06198 [Genlisea aurea]
Length=650

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAG GDKPMIVVSYKGEDKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGVGDKPMIVVSYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_008784530.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Phoenix dactylifera]
Length=649

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKV+AGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDVKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQ DMKLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDTSVQGDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKMK
Sbjct  121  EEISSMVLTKMK  132



>gb|KJB55903.1| hypothetical protein B456_009G100400 [Gossypium raimondii]
Length=650

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDSSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLMKMK  132



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV+YKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVTYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD  VQSD+KLWPFKVIAGPGDKPMIVVSYKGEDKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDAPVQSDIKLWPFKVIAGPGDKPMIVVSYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_006644983.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=649

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVI GPGDKPMIVV YKGE+KQFSAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KMK
Sbjct  122  ISSMVLIKMK  131



>gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI+GPGDKPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_009120551.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=650

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKVI+GP +KPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPGDKPMI+VSYKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIIVSYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>emb|CDY50531.1| BnaA01g30490D [Brassica napus]
Length=650

 Score =   264 bits (674),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKVI+GP +KPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>sp|P27322.1|HSP72_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
 emb|CAA37971.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=644

 Score =   264 bits (674),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>emb|CDY31804.1| BnaC01g27600D [Brassica napus]
Length=417

 Score =   258 bits (658),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|ABR18415.1| unknown [Picea sitchensis]
 gb|ACN39931.1| unknown [Picea sitchensis]
 gb|ACN39963.1| unknown [Picea sitchensis]
Length=652

 Score =   264 bits (674),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 128/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDP+VQ+DMKLWPFKVI+GP +KPMIVVSYKGEDKQF+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPTVQNDMKLWPFKVISGPAEKPMIVVSYKGEDKQFAAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVLTKMK
Sbjct  122  ISSMVLTKMK  131



>gb|AAN86275.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=652

 Score =   264 bits (674),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EE+SSMVL KMK
Sbjct  121  EEVSSMVLIKMK  132



>ref|XP_004249574.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
Length=644

 Score =   263 bits (673),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>gb|EYU41710.1| hypothetical protein MIMGU_mgv1a022248mg, partial [Erythranthe 
guttata]
Length=371

 Score =   256 bits (653),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFK+I GPGDKP+IVV+YKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFNDASVQSDIKLWPFKLIPGPGDKPLIVVNYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score =   263 bits (673),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV+Y+GE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGPGDKPMIVVNYRGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   263 bits (673),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKVI+G GDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGAGDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_004984743.1| PREDICTED: heat shock cognate 70 kDa protein-like [Setaria italica]
Length=650

 Score =   263 bits (673),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIG+AAKN
Sbjct  1    MASKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGEAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GP DKPMIVV+YKGE+K+FSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKMK
Sbjct  121  EEISSMVLTKMK  132



>ref|XP_008371627.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   263 bits (673),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRRYSDPSVQ DMK WPFKVI GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDPSVQGDMKHWPFKVIPGPGDKPMIVVIYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLVKMR  132



>ref|XP_004142076.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 ref|XP_004161675.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   263 bits (672),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMI+VSYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIIVSYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_008812036.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=647

 Score =   263 bits (672),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQ+D KLWPFKVIAGPGDKPMIVV YKGE+KQFS EE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQADRKLWPFKVIAGPGDKPMIVVQYKGEEKQFSPEE  121

Query  487  ISSMVLTKMK  516
            ISSMVLTKMK
Sbjct  122  ISSMVLTKMK  131



>ref|XP_006407319.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
 gb|ESQ48772.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
Length=650

 Score =   263 bits (672),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKV++GP +KPMIVV++KGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVVSGPAEKPMIVVNHKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>ref|XP_006833219.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV YKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV YKGEDKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI+GPGDKPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVIAG GDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDSSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLNKMK  132



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GP DKPMIVV+YKG++KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGDEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_004142745.1| PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis sativus]
 gb|KGN51286.1| Heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQ DMKLWPFKVI GP +KPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIPGPAEKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLMKMK  132



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV YKGEDKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQ DMKLWPFKVI GP +KPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIPGPAEKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLMKMK  132



>ref|XP_008784528.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERL+GDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQSDM+LWPFKVI GPGDKP+IVV YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDTSVQSDMRLWPFKVIPGPGDKPLIVVQYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>gb|EYU19900.1| hypothetical protein MIMGU_mgv1a002641mg [Erythranthe guttata]
Length=651

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQ+DMKLWPFKVI GP +KPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQADMKLWPFKVIPGPAEKPMIVVSYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_008458906.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis 
melo]
Length=652

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEG AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGTAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSD+KLWPFKVIAGP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>gb|KJB16980.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=613

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_003564580.1| PREDICTED: heat shock cognate 70 kDa protein [Brachypodium distachyon]
Length=654

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MA  GEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQ DMKLWPFKVI GPGDKPMIVV+YKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKMK
Sbjct  121  EEISSMVLTKMK  132



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR SD SVQSDMKLWPFKVI GP +KPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPAEKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLMKMK  132



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>gb|AIU40169.1| heat shock protein 70 [Saccharum arundinaceum]
Length=648

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGI+LGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIELGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQF+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KMK
Sbjct  122  ISSMVLIKMK  131



>ref|XP_010555208.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=652

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD KLWPFKVI GPGDKPMIVV+YKGEDKQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDAKLWPFKVIPGPGDKPMIVVNYKGEDKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_008658250.1| PREDICTED: uncharacterized protein LOC100272911 isoform X1 [Zea 
mays]
 gb|AFW88811.1| hypothetical protein ZEAMMB73_832667 [Zea mays]
Length=652

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  MAG-KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  297
            MAG KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGNKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  298  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  477
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GP DKPMIVV+YKGE+K+FS
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFS  120

Query  478  AEEISSMVLTKMK  516
            AEEISSMVLTKMK
Sbjct  121  AEEISSMVLTKMK  133



>gb|KEH30132.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=578

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR SD SVQSDMKLWPFKVI GP DKPMIVV+YK E+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDVSVQSDMKLWPFKVIPGPADKPMIVVNYKAEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLMKMK  132



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERL+GDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD +VQSD+KLWPFKV+AGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDIKLWPFKVVAGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>emb|CCA29120.1| heat shock protein 70 isoform 1 [Solanum lycopersicum]
Length=648

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQ DMKLWPFKVI GPGDKPMIVV+YKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKMK
Sbjct  121  EEISSMVLTKMK  132



>ref|XP_010918390.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=649

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV YKGE+KQFSAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPNDKPMIVVQYKGEEKQFSAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KMK
Sbjct  122  ISSMVLMKMK  131



>ref|XP_006649853.1| PREDICTED: heat shock cognate 70 kDa protein-like [Oryza brachyantha]
Length=653

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 131/133 (98%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  MAG-KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  297
            MAG KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGNKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  298  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  477
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GPGDKPMIVV++KGE+K+FS
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPGDKPMIVVTHKGEEKKFS  120

Query  478  AEEISSMVLTKMK  516
            AEEISSMVLTKMK
Sbjct  121  AEEISSMVLTKMK  133



>gb|ACJ54890.1| heat shock protein 70 [Oryza sativa Japonica Group]
Length=653

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  MAG-KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  297
            MAG KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGNKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  298  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  477
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GP DKPMIVV+YKGE+K+FS
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFS  120

Query  478  AEEISSMVLTKMK  516
            AEEISSMVLTKMK
Sbjct  121  AEEISSMVLTKMK  133



>ref|XP_002465468.1| hypothetical protein SORBIDRAFT_01g039390 [Sorghum bicolor]
 gb|EER92466.1| hypothetical protein SORBIDRAFT_01g039390 [Sorghum bicolor]
Length=652

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  LMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  297
            + + KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MASSKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  298  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  477
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GP DKPMIVV+YKGE+K+FS
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFS  120

Query  478  AEEISSMVLTKMK  516
            AEEISSMVLTKMK
Sbjct  121  AEEISSMVLTKMK  133



>ref|XP_009135236.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=652

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKVI+GP +KPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMISVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>emb|CDX73815.1| BnaA03g32320D [Brassica napus]
Length=652

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKVI+GP +KPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMISVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>emb|CDY00784.1| BnaC03g37680D [Brassica napus]
Length=650

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKVI+GP +KPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMISVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>gb|ABF95267.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EAZ26449.1| hypothetical protein OsJ_10337 [Oryza sativa Japonica Group]
Length=653

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  MAG-KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  297
            MAG KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAGNKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  298  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  477
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GP DKPMIVV+YKGE+K+FS
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFS  120

Query  478  AEEISSMVLTKMK  516
            AEEISSMVLTKMK
Sbjct  121  AEEISSMVLTKMK  133



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQ DMKLWPFKV+AGPGDKPMI VSYKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQGDMKLWPFKVVAGPGDKPMINVSYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLVKMR  132



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>emb|CCA29121.1| heat shock protein 70 isoform 2 [Solanum lycopersicum]
Length=644

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL +MK
Sbjct  121  EEISSMVLIRMK  132



>ref|XP_008812042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD  VQSD+KLWPFKV+AGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDACVQSDVKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLMKMK  132



>ref|NP_001055754.1| Os05g0460000 [Oryza sativa Japonica Group]
 gb|AAT39165.1| putative hsp70 [Oryza sativa Japonica Group]
 dbj|BAF17668.1| Os05g0460000 [Oryza sativa Japonica Group]
 dbj|BAH01403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63984.1| hypothetical protein OsJ_18811 [Oryza sativa Japonica Group]
Length=646

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/129 (94%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +1

Query  130  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  309
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  310  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  489
            MNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKV+ GPGDKPMIVV YKGE+KQF+AEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAEEI  122

Query  490  SSMVLTKMK  516
            SSMVL KM+
Sbjct  123  SSMVLIKMR  131



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRRYSDPSVQ DMK WPFK I GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDPSVQGDMKHWPFKAIPGPGDKPMIVVMYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLVKMR  132



>emb|CDY52661.1| BnaC01g38510D [Brassica napus]
Length=647

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MASKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQ+DM+ WPFKVI+GP +KPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVISGPAEKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>ref|XP_009786102.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana sylvestris]
Length=648

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQSDMKLWPFKVI G GDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_009597695.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana tomentosiformis]
Length=648

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQSDMKLWPFKVI G GDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR SD SVQSDMKLWPFKVI GP DKPMIVV+YKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>gb|AIZ68155.1| heat shock protein 70 [Ornithogalum saundersiae]
Length=648

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFK+I+GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKLISGPGDKPMIVVQYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_004307259.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Fragaria vesca subsp. vesca]
Length=649

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++DPSVQ D+K WPFKV+AGP +KPMIVVSYKGE+KQFSA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFNDPSVQGDIKHWPFKVVAGPAEKPMIVVSYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>ref|XP_010937656.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Elaeis guineensis]
Length=647

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQ+DMKLWPFKVIAGPGDKP+IVV YKGE+K F+ EE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQADMKLWPFKVIAGPGDKPLIVVQYKGEEKHFTPEE  121

Query  487  ISSMVLTKMK  516
            ISSMVLTKMK
Sbjct  122  ISSMVLTKMK  131



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQ DMK WPFKVI GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQGDMKHWPFKVIPGPGDKPMIVVIYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLVKMR  132



>ref|XP_003552691.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform 1 [Glycine 
max]
Length=649

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GP DKPMIVV+YKGEDKQFSA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>gb|KHN13891.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI GP DKPMIVV+YKGEDKQFSA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+ D SVQSDMKLWPFKVI GP DKPMIVV+YK E+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFGDVSVQSDMKLWPFKVIPGPADKPMIVVNYKAEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLMKMK  132



>ref|XP_006424798.1| hypothetical protein CICLE_v10028007mg [Citrus clementina]
 gb|ESR38038.1| hypothetical protein CICLE_v10028007mg [Citrus clementina]
Length=636

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFT+TERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTNTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDP VQ DMKLWPF+VIAG GDKPMIVV+YK E+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPLVQKDMKLWPFQVIAGAGDKPMIVVNYKCEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEI+SMVLTKMK
Sbjct  121  EEITSMVLTKMK  132



>gb|EAY89450.1| hypothetical protein OsI_10982 [Oryza sativa Indica Group]
Length=438

 Score =   256 bits (653),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD KLWPFKV+ GPGDKPMI V YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDTSVQSDAKLWPFKVLPGPGDKPMIGVQYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLNKMK  132



>gb|KEH30133.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR SD SVQSDMKLWPFKVI GP DKPMIVV+YK E+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDVSVQSDMKLWPFKVIPGPADKPMIVVNYKAEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLMKMK  132



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>ref|NP_001234491.1| heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 sp|P24629.1|HSP71_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 emb|CAA37970.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=650

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVA+NP NTVFDAKRLIGRR+SD SVQ DMKLWPFKVI GPGDKPMIVV+YKGE+K+F+A
Sbjct  61   QVALNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKMK
Sbjct  121  EEISSMVLTKMK  132



>ref|XP_009353696.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Pyrus x bretschneideri]
Length=520

 Score =   258 bits (659),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D ++QSDMKLWPFKVIAG GDKP IVV+YKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFTDATIQSDMKLWPFKVIAGAGDKPTIVVNYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>emb|CAB72129.1| heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEI ANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIFANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_002456611.1| hypothetical protein SORBIDRAFT_03g039360 [Sorghum bicolor]
 gb|EES01731.1| hypothetical protein SORBIDRAFT_03g039360 [Sorghum bicolor]
Length=648

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQF+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KM+
Sbjct  122  ISSMVLIKMR  131



>gb|KJB16979.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=648

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|ABP35942.1| heat shock protein 70 [Cyclamen persicum]
Length=650

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   261 bits (667),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   261 bits (667),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI+GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_004970526.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=648

 Score =   261 bits (667),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQF+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KM+
Sbjct  122  ISSMVLIKMR  131



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score =   261 bits (667),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI+GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>gb|ABA95501.2| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=615

 Score =   260 bits (665),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_010423854.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=190

 Score =   247 bits (631),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVI-AGPGDKPMIVVSYKGEDKQFS  477
            QVAMNP NTVFDAKRLIGRR+SD SVQSD KLWPF VI +G  +KPMI V+YKGE+KQF+
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDRKLWPFTVITSGTAEKPMIAVNYKGEEKQFA  120

Query  478  AEEISSMVLTKMK  516
            AEEISSMVL+KM+
Sbjct  121  AEEISSMVLSKMR  133



>gb|AAB99745.1| HSP70 [Triticum aestivum]
 gb|EMT04103.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=648

 Score =   261 bits (666),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQF+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFAAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KM+
Sbjct  122  ISSMVLIKMR  131



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   261 bits (666),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD KLWPFKVIAGPGDKPMI V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDTKLWPFKVIAGPGDKPMICVAYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   261 bits (666),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVVYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score =   261 bits (666),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI+GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_010231300.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brachypodium distachyon]
Length=649

 Score =   261 bits (666),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV +KGE+KQF+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQHKGEEKQFAAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KM+
Sbjct  122  ISSMVLIKMR  131



>gb|KJB73858.1| hypothetical protein B456_011G256600 [Gossypium raimondii]
Length=652

 Score =   261 bits (666),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWP+KVIAG GDKPMI+VSYKGEDKQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPYKVIAGSGDKPMIIVSYKGEDKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>gb|EMS68426.1| Heat shock cognate 70 kDa protein 4 [Triticum urartu]
Length=648

 Score =   261 bits (666),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV+YKGE+KQF+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFAAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KM+
Sbjct  122  ISSMVLIKMR  131



>ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group]
 gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza 
sativa Japonica Group]
 gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group]
Length=649

 Score =   261 bits (666),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_006663128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   261 bits (666),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVIAGPGDKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   260 bits (665),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRRYSD SVQSD+KLWPFKVI GP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDASVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|NP_001044757.1| Os01g0840100 [Oryza sativa Japonica Group]
 dbj|BAB67894.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAB93214.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAF06671.1| Os01g0840100 [Oryza sativa Japonica Group]
 gb|EAZ14100.1| hypothetical protein OsJ_04024 [Oryza sativa Japonica Group]
 dbj|BAH01518.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86881.1| 70kDa heat shock protein [Oryza sativa Japonica Group]
 gb|ADR66969.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=648

 Score =   260 bits (665),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNP NTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV YKGE+KQFSAEE
Sbjct  62   AMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KM+
Sbjct  122  ISSMVLIKMR  131



>dbj|BAK00257.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=648

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMI+V+YKGE+KQF+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIIVNYKGEEKQFAAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KM+
Sbjct  122  ISSMVLIKMR  131



>ref|XP_007144450.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16444.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=614

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR SD SVQSDMKLWPFKV AGPGDKPMI VSYKGEDKQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRVSDASVQSDMKLWPFKVFAGPGDKPMIQVSYKGEDKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>ref|WP_039310754.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
 gb|AHL69785.1| heat shock protein [Camellia sinensis]
 gb|KHL91223.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
Length=650

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR++D SVQSDMKLWPFKVIAGPGDKPMI V+YKGE+K F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDMKLWPFKVIAGPGDKPMIGVNYKGEEKLFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|AAA86903.1| heat shock protein cognate 70, partial [Sorghum bicolor]
Length=209

 Score =   247 bits (631),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKG+GP+IGIDLGTTYSCVGVWQ DRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPSIGIDLGTTYSCVGVWQRDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFK I+GPG+KPMIVV +KGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKGISGPGEKPMIVVQHKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>emb|CAA83548.1| PsHSC71.0 [Pisum sativum]
Length=647

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR SD SVQSDMKLWPFK+IAGP +KPMIVV+YKGEDKQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRVSDASVQSDMKLWPFKIIAGPAEKPMIVVNYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR SD SVQSDMKLWPFKVIAGPG+KPMI V+YKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIAGPGEKPMIGVNYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>emb|CDP09035.1| unnamed protein product [Coffea canephora]
Length=650

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR SD SVQ+D+KLWPFKVIAGPGDKPMI V+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRLSDSSVQNDIKLWPFKVIAGPGDKPMIAVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_002532297.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30081.1| heat shock protein, putative [Ricinus communis]
Length=652

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|EMT06830.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=647

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MA  GEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVQYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|NP_001183165.1| uncharacterized protein LOC100501536 [Zea mays]
 gb|ACR35910.1| unknown [Zea mays]
 gb|AFW84633.1| heat shock protein1 [Zea mays]
Length=648

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQV
Sbjct  2    AKSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GPGDKPMIVV+YKGE+KQF+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KMK
Sbjct  122  ISSMVLIKMK  131



>gb|ACB70177.1| 70 kDa heat shock protein [Capparis spinosa]
Length=649

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRRYSD SVQ+DMKLWPFKV+ G GDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQADMKLWPFKVVPGSGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_010553033.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=652

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|KCW50223.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=615

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPG+KPMI+V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|AFW88810.1| hypothetical protein ZEAMMB73_832667 [Zea mays]
Length=782

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  MAG-KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  297
            MAG KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  131  MAGNKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  190

Query  298  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  477
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQ+DMK+WPFKV+ GP DKPMIVV+YKGE+K+FS
Sbjct  191  NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFS  250

Query  478  AEEISSMVLTKMK  516
            AEEISSMVLTKMK
Sbjct  251  AEEISSMVLTKMK  263



>gb|AAB97316.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88132.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88133.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=651

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKVI G GDKPMIVVSYKGEDK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVSYKGEDKEFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_007144451.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16445.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=648

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR SD SVQSDMKLWPFKV AGPGDKPMI VSYKGEDKQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRVSDASVQSDMKLWPFKVFAGPGDKPMIQVSYKGEDKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>ref|XP_009122772.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37e [Brassica rapa]
Length=646

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+IAGP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|AAB88009.1| heat shock cognate protein HSC70 [Brassica napus]
Length=645

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+IAGP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|KCW50224.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=632

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPG+KPMI+V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_010030975.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Eucalyptus 
grandis]
 gb|KCW50222.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=649

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPG+KPMI+V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|ADD71975.1| heat shock protein 70 [Rhododendron calophytum]
Length=651

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVIAGPG+KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVIAGPGEKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLVKMK  132



>ref|XP_006407676.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49129.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=650

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVV+YKGEDK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEDKEFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSM+L KM+
Sbjct  121  EEISSMILIKMR  132



>dbj|BAJ34054.1| unnamed protein product [Thellungiella halophila]
Length=650

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMIVV+YKGEDK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEDKEFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSM+L KM+
Sbjct  121  EEISSMILIKMR  132



>ref|XP_009112006.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=517

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLW FK+IAGP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWLFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_002884912.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61171.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRRYSDPSVQ+D   WPFKVI+GPG+KPMIVV++KGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDPSVQADKSHWPFKVISGPGEKPMIVVNHKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLVKMR  132



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI+GPGDKPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVISGPGDKPMIGVTYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRRY+D SVQSD+KLWPFKVI GP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYTDTSVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQ DMKLWPFKVIAGP DKPMI V+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_010030977.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Eucalyptus grandis]
Length=649

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+K WPFKV  GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>ref|XP_003558220.1| PREDICTED: heat shock cognate 70 kDa protein-like [Brachypodium 
distachyon]
Length=658

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 127/129 (98%), Gaps = 0/129 (0%)
 Frame = +1

Query  130  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  309
            KGEGPAIGIDLGTTYSCVGVWQHDRVEI+ANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct  10   KGEGPAIGIDLGTTYSCVGVWQHDRVEIVANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  69

Query  310  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  489
            MNPTNTVFDAKRLIGRR+SDPSVQ+DMKLWPFKV+ G GDKPMIVV+YKGE+K+FSAEEI
Sbjct  70   MNPTNTVFDAKRLIGRRFSDPSVQADMKLWPFKVVPGAGDKPMIVVTYKGEEKKFSAEEI  129

Query  490  SSMVLTKMK  516
            SSMVLTKM+
Sbjct  130  SSMVLTKMR  138



>ref|XP_009414320.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=648

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKV +GPGDKPMI V YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVTSGPGDKPMIAVQYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLMKMK  132



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKV +GPGDKPMI V+YKGEDKQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVFSGPGDKPMIQVNYKGEDKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKV  GPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKV  GPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>gb|EMS51135.1| Heat shock cognate 70 kDa protein [Triticum urartu]
Length=610

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 126/133 (95%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  MAGKG-EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  297
            MA KG EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAKKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  60

Query  298  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  477
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV YKGE+KQF+
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVQYKGEEKQFA  120

Query  478  AEEISSMVLTKMK  516
            AEEISSMVL KMK
Sbjct  121  AEEISSMVLIKMK  133



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSC+GVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCIGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRRY+D SVQSD+KLWPFKVI GP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYTDTSVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|ACD93209.1| heat shock protein 70 [Camellia sinensis]
Length=677

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR++D SVQSDMKLWPFKVIAGPGDKPMI V+YKGE+K F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDMKLWPFKVIAGPGDKPMIGVNYKGEEKLFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_010558317.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=654

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_006297174.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
 gb|EOA30072.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
Length=649

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD  LWPFK+I+GPG+KPMIVV+YKGEDK+FSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDRALWPFKIISGPGEKPMIVVNYKGEDKEFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSM+L KM+
Sbjct  121  EEISSMILIKMR  132



>ref|NP_187864.1| heat shock protein 70-4 [Arabidopsis thaliana]
 sp|Q9LHA8.1|MD37C_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 4; 
AltName: Full=Heat shock cognate 70 kDa protein 4; AltName: 
Full=Heat shock cognate protein 70-4; Short=AtHsc70-4; AltName: 
Full=Heat shock protein 70-4; Short=AtHsp70-4 [Arabidopsis 
thaliana]
 gb|AAG51030.1|AC069474_29 heat shock protein 70; 34105-36307 [Arabidopsis thaliana]
 dbj|BAB02269.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AAL06844.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL06851.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL24367.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AEE75218.1| heat shock protein 70-4 [Arabidopsis thaliana]
Length=650

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRRYSDPSVQ+D   WPFKV++GPG+KPMIVV++KGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDPSVQADKSHWPFKVVSGPGEKPMIVVNHKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_003558228.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=651

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD KLWPFKVI GPGDKPMI V Y+GEDKQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDAKLWPFKVIPGPGDKPMIGVQYRGEDKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLNKMK  132



>ref|XP_008776699.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVA+NP NTVFDAKRLIGRR+SD SVQ+DMKLWPFKV+AGPGDKP+I V YKGE+KQF+A
Sbjct  61   QVAINPINTVFDAKRLIGRRFSDASVQNDMKLWPFKVVAGPGDKPLIAVQYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|AFA51946.1| heat shock protein 70 [Paeonia suffruticosa]
Length=650

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFK+I GP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKLIPGPAEKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>ref|XP_004287145.1| PREDICTED: heat shock 70 kDa protein [Fragaria vesca subsp. vesca]
Length=653

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MA K EG AIGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAAKTEGKAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQ+DMKLWPFKV+AGPGDKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPQNTVFDAKRLIGRRFSDPSVQADMKLWPFKVVAGPGDKPMIVVTYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>gb|ACR38891.1| heat shock protein 70 [Pellia endiviifolia (species B)]
 gb|ACR38900.1| heat shock protein 70 [Pellia endiviifolia (species B)]
Length=651

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQ DMKLWPFKV  GPGDKPMI V YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDGSVQDDMKLWPFKVTPGPGDKPMIGVQYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>gb|KJB46580.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46581.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46582.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
Length=647

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSD KLWPFKVI GPGDKPMI V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDTKLWPFKVIPGPGDKPMICVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD +VQSD KLWPFKVIAG GDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDTKLWPFKVIAGAGDKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_011027180.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=649

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI+GPGDKPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDVSVQSDIKLWPFKVISGPGDKPMIGVTYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_008458071.1| PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis melo]
Length=201

 Score =   245 bits (626),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGE PAI IDLGTTYSCV VWQHDRVEIIANDQGNRTT SYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGESPAIRIDLGTTYSCVDVWQHDRVEIIANDQGNRTTSSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLI +R+SDPSV SD+KLW FKVIAGP DKPMIVV+YKGE+KQFSA
Sbjct  61   QVAMNPINTVFDAKRLICQRFSDPSVHSDIKLWLFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_007207158.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
 gb|EMJ08357.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
Length=635

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFKV  GPGDKPMI VSYKGEDK F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVTPGPGDKPMIGVSYKGEDKVFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|AEK70336.1| heat shock protein 70 [Paeonia lactiflora]
Length=650

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFK+I GP +KPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKLIPGPAEKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>gb|KFK38330.1| hypothetical protein AALP_AA3G100200 [Arabis alpina]
Length=650

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMI+V+YKGEDK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEDKEFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSM+L KM+
Sbjct  121  EEISSMILIKMR  132



>gb|KFK24738.1| hypothetical protein AALP_AA8G018100 [Arabis alpina]
Length=650

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMI+V+YKGE+KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>emb|CAB72130.1| heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QV MNP NTVFDAKRLIGRR+SD SVQSD+KLWPFKVI GPGDKPMI+VSYKG +KQF+A
Sbjct  61   QVTMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIIVSYKGGEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_006398709.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
 gb|ESQ40162.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
Length=651

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMI+V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|AAS09825.1| heat shock cognate protein 70 [Eutrema halophilum]
Length=651

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+I GP DKPMI+V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|NP_001119156.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 gb|AED90481.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=521

 Score =   255 bits (651),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQSDMKLWPFK+ AGP DKPMI V YKGE+K+F+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_008802766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  127  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  306
             K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
Sbjct  2    AKAEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  307  AMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEE  486
            AMNPTNTVFDAKRLIGRR+SDPSVQ+DMKLWPFKVI GPGDKPMIVV YK E+KQFSAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQNDMKLWPFKVIPGPGDKPMIVVQYKCEEKQFSAEE  121

Query  487  ISSMVLTKMK  516
            ISSMVL KMK
Sbjct  122  ISSMVLMKMK  131



>ref|XP_008223372.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Prunus mume]
Length=519

 Score =   255 bits (651),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGD+AKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDSAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD S+QSDMKLWPFKVI G GDKP IVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASIQSDMKLWPFKVIPGAGDKPTIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   258 bits (659),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D +VQSD+KLWPFKVIAGP DKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDATVQSDIKLWPFKVIAGPADKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_007023492.1| Heat shock protein 70B [Theobroma cacao]
 gb|EOY26114.1| Heat shock protein 70B [Theobroma cacao]
Length=654

 Score =   258 bits (659),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MA K +G AIGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAAKAQGKAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SDPSVQSDMK WPFKV+AGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPQNTVFDAKRLIGRRFSDPSVQSDMKHWPFKVVAGPGDKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKMK
Sbjct  121  EEISSMVLTKMK  132



>gb|EEC76425.1| hypothetical protein OsI_14101 [Oryza sativa Indica Group]
Length=434

 Score =   252 bits (644),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  130  KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  309
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQVA
Sbjct  5    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA  64

Query  310  MNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSAEEI  489
            MNP NTVFDAKRLIGRR+SD SVQSD+K+WP+KVI GPGDKPMIVV YKGE+KQFSAEEI
Sbjct  65   MNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEI  124

Query  490  SSMVLTKMK  516
            SSMVL KM+
Sbjct  125  SSMVLIKMR  133



>gb|AFU34347.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34348.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34349.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34350.1| 70-kDa heat shock protein [Ipomoea batatas]
Length=652

 Score =   258 bits (659),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+KLWPFKVI GPGDKPMIVV+YKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>gb|AAA62445.1| heat shock protein [Spinacia oleracea]
 gb|AAB88134.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=647

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD SVQ+DMK WPFKV++GPG+KPMI V+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQADMKHWPFKVVSGPGEKPMIGVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKMK
Sbjct  121  EEISSMVLTKMK  132



>ref|XP_009353695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X1 
[Pyrus x bretschneideri]
Length=649

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D ++QSDMKLWPFKVIAG GDKP IVV+YKGEDKQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFTDATIQSDMKLWPFKVIAGAGDKPTIVVNYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  121  EEISSMVLTKMR  132



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  94   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  153

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+K WPFKV  GPGDKPMIVV+YKGE+KQF+A
Sbjct  154  QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFAA  213

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  214  EEISSMVLTKMR  225



>gb|KCW50226.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=742

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  94   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  153

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR++D SVQSD+K WPFKV  GPGDKPMIVV+YKGE+KQF+A
Sbjct  154  QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFAA  213

Query  481  EEISSMVLTKMK  516
            EEISSMVLTKM+
Sbjct  214  EEISSMVLTKMR  225



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD  VQ DMK+WPFKVI GPG+KPMIVV+YKGEDKQF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDAPVQGDMKMWPFKVIPGPGEKPMIVVNYKGEDKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLMKMR  132



>gb|KJB20862.1| hypothetical protein B456_003G169700 [Gossypium raimondii]
Length=648

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MA K EG AIGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAAKAEGKAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP+NTVFDAKRLIGRR++DPSVQSDMK WPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPSNTVFDAKRLIGRRFTDPSVQSDMKHWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRR+SD SVQSD+KLWPFKV  GPG+KPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGEKPMISVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



>ref|XP_008369876.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Malus domestica]
Length=648

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR SD SVQSDMKLWPFKV +GPGDKPMI VSYKGEDK F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRISDASVQSDMKLWPFKVTSGPGDKPMIGVSYKGEDKLFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|ACD45076.1| heat-shock protein 70 [Dactylis glomerata]
Length=656

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 126/133 (95%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  MAGKG-EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  297
            MA KG EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAKKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  60

Query  298  NQVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFS  477
            NQVAMNPTNTVFDAKRLIGRR+SDPSVQSDMKLWPFKVI GP DKPMIVV YKGE+KQF+
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVQYKGEEKQFA  120

Query  478  AEEISSMVLTKMK  516
            AEEISSMVL KMK
Sbjct  121  AEEISSMVLIKMK  133



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD +VQSD+K WPFKVIAGPGDKPMIVV+YKGE+KQF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDIKHWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>gb|KJB36734.1| hypothetical protein B456_006G174000 [Gossypium raimondii]
Length=646

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+SD +VQSD+KLWPFKVI G GDKPMIVVSYKGE+KQF+A
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDAAVQSDIKLWPFKVIPGSGDKPMIVVSYKGEEKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_010499184.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNPTNTVFDAKRLIGRRYSDPSVQSD+K WPF V +GP +KPMI V+YKGE+KQFSA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDPSVQSDLKHWPFTVKSGPAEKPMITVNYKGEEKQFSA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KM+
Sbjct  121  EEISSMVLIKMR  132



>ref|XP_001767221.1| predicted protein [Physcomitrella patens]
 gb|EDQ67902.1| predicted protein [Physcomitrella patens]
Length=652

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  300
            MAGKGEG AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGTAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  301  QVAMNPTNTVFDAKRLIGRRYSDPSVQSDMKLWPFKVIAGPGDKPMIVVSYKGEDKQFSA  480
            QVAMNP NTVFDAKRLIGRR+ D SVQSDMKLWPFKVIAGPG KP+IVV+YKGE KQF+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFDDASVQSDMKLWPFKVIAGPGSKPIIVVNYKGETKQFAA  120

Query  481  EEISSMVLTKMK  516
            EEISSMVL KMK
Sbjct  121  EEISSMVLIKMK  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325