BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF024F03

Length=496
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587406.1|  PREDICTED: protein lozenge-like                    120   1e-29   Nicotiana tomentosiformis
ref|XP_009799894.1|  PREDICTED: uncharacterized protein LOC104245...    117   5e-27   Nicotiana sylvestris
ref|XP_009799895.1|  PREDICTED: uncharacterized protein LOC104245...    117   5e-27   Nicotiana sylvestris
ref|XP_006359197.1|  PREDICTED: uncharacterized protein LOC102583016    111   5e-25   Solanum tuberosum [potatoes]
ref|XP_007204996.1|  hypothetical protein PRUPE_ppa004220mg             108   1e-24   
ref|XP_011089706.1|  PREDICTED: YTH domain-containing family prot...    109   2e-24   Sesamum indicum [beniseed]
ref|XP_008221460.1|  PREDICTED: uncharacterized protein LOC103321...    109   2e-24   Prunus mume [ume]
ref|XP_004228948.1|  PREDICTED: uncharacterized protein LOC101253713    109   3e-24   Solanum lycopersicum
ref|XP_009597413.1|  PREDICTED: uncharacterized protein LOC104093...    107   1e-23   Nicotiana tomentosiformis
ref|XP_009597421.1|  PREDICTED: uncharacterized protein LOC104093...    107   1e-23   Nicotiana tomentosiformis
gb|KHN06477.1|  YTH domain family protein 2                             107   2e-23   Glycine soja [wild soybean]
ref|XP_006580216.1|  PREDICTED: YTH domain family protein 1-like        106   2e-23   Glycine max [soybeans]
ref|XP_011089707.1|  PREDICTED: uncharacterized protein LOC105170581    106   3e-23   Sesamum indicum [beniseed]
ref|XP_008221524.1|  PREDICTED: uncharacterized protein LOC103321...    105   4e-23   Prunus mume [ume]
emb|CBI16561.3|  unnamed protein product                                105   6e-23   Vitis vinifera
ref|XP_002285750.1|  PREDICTED: uncharacterized protein LOC100253...    105   7e-23   Vitis vinifera
ref|XP_009764450.1|  PREDICTED: uncharacterized protein LOC104216...    105   9e-23   Nicotiana sylvestris
ref|XP_008366132.1|  PREDICTED: uncharacterized protein LOC103429...    104   1e-22   
ref|XP_009601164.1|  PREDICTED: uncharacterized protein LOC104096490    104   1e-22   
ref|XP_009339197.1|  PREDICTED: uncharacterized protein LOC103931441    104   1e-22   
ref|XP_003531272.1|  PREDICTED: uncharacterized protein LOC100819...    103   2e-22   Glycine max [soybeans]
gb|KHN48074.1|  YTH domain family protein 2                             103   2e-22   Glycine soja [wild soybean]
ref|XP_006585213.1|  PREDICTED: uncharacterized protein LOC100819...    103   3e-22   Glycine max [soybeans]
ref|XP_006585211.1|  PREDICTED: uncharacterized protein LOC100819...    103   3e-22   
ref|XP_006585212.1|  PREDICTED: uncharacterized protein LOC100819...    103   3e-22   
ref|XP_002513402.1|  yth domain-containing protein, putative            103   4e-22   
ref|XP_008366133.1|  PREDICTED: uncharacterized protein LOC103429...    102   5e-22   
ref|XP_009376087.1|  PREDICTED: uncharacterized protein LOC103964...    102   7e-22   Pyrus x bretschneideri [bai li]
gb|KDP29478.1|  hypothetical protein JCGZ_19307                         102   7e-22   Jatropha curcas
ref|XP_010103094.1|  hypothetical protein L484_005073                   101   2e-21   
ref|XP_007014623.1|  Evolutionarily conserved C-terminal region 2...    100   3e-21   
ref|XP_008351953.1|  PREDICTED: uncharacterized protein LOC103415395    100   4e-21   
ref|XP_010651400.1|  PREDICTED: uncharacterized protein LOC100253...    100   4e-21   Vitis vinifera
ref|XP_010257810.1|  PREDICTED: YTH domain-containing family prot...  98.2    1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010257809.1|  PREDICTED: YTH domain-containing family prot...  97.1    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_007159551.1|  hypothetical protein PHAVU_002G247000g           95.1    2e-19   Phaseolus vulgaris [French bean]
ref|XP_004504214.1|  PREDICTED: YTH domain family protein 2-like ...  94.0    6e-19   Cicer arietinum [garbanzo]
ref|XP_004504212.1|  PREDICTED: YTH domain family protein 2-like ...  94.0    6e-19   
ref|XP_004504213.1|  PREDICTED: YTH domain family protein 2-like ...  94.0    7e-19   Cicer arietinum [garbanzo]
gb|KDP23024.1|  hypothetical protein JCGZ_01687                       93.2    1e-18   Jatropha curcas
ref|XP_007014622.1|  Evolutionarily conserved C-terminal region 2...  93.2    1e-18   
gb|KHG09343.1|  Glutamate receptor                                    90.5    3e-18   Gossypium arboreum [tree cotton]
ref|XP_011461644.1|  PREDICTED: YTH domain-containing family prot...  90.5    1e-17   Fragaria vesca subsp. vesca
ref|XP_011461643.1|  PREDICTED: YTH domain-containing family prot...  90.5    1e-17   Fragaria vesca subsp. vesca
gb|KJB21907.1|  hypothetical protein B456_004G020600                  89.4    2e-17   Gossypium raimondii
gb|KJB21909.1|  hypothetical protein B456_004G020600                  89.0    2e-17   Gossypium raimondii
gb|KJB21908.1|  hypothetical protein B456_004G020600                  89.4    3e-17   Gossypium raimondii
ref|XP_009376095.1|  PREDICTED: uncharacterized protein LOC103964...  89.0    3e-17   Pyrus x bretschneideri [bai li]
ref|XP_006445566.1|  hypothetical protein CICLE_v10014439mg           87.4    1e-16   Citrus clementina [clementine]
gb|KDO54489.1|  hypothetical protein CISIN_1g005158mg                 86.7    1e-16   Citrus sinensis [apfelsine]
gb|KDO54493.1|  hypothetical protein CISIN_1g005158mg                 87.0    1e-16   Citrus sinensis [apfelsine]
gb|KDO54494.1|  hypothetical protein CISIN_1g005158mg                 87.0    1e-16   Citrus sinensis [apfelsine]
ref|XP_004506479.1|  PREDICTED: uncharacterized protein LOC101499095  84.0    2e-16   
ref|XP_011025120.1|  PREDICTED: uncharacterized protein LOC105126076  85.1    6e-16   Populus euphratica
ref|XP_006488954.1|  PREDICTED: uncharacterized protein LOC102626...  83.2    3e-15   Citrus sinensis [apfelsine]
ref|XP_002304850.2|  hypothetical protein POPTR_0003s20840g           83.2    3e-15   Populus trichocarpa [western balsam poplar]
gb|KDO54495.1|  hypothetical protein CISIN_1g005158mg                 82.8    4e-15   Citrus sinensis [apfelsine]
ref|XP_003629923.1|  YTH domain family protein                        82.4    6e-15   
gb|AET04399.2|  evolutionarily carboxy-terminal region protein        82.4    6e-15   Medicago truncatula
gb|EYU39279.1|  hypothetical protein MIMGU_mgv1a002515mg              82.0    8e-15   Erythranthe guttata [common monkey flower]
gb|KDO54492.1|  hypothetical protein CISIN_1g005158mg                 82.0    8e-15   Citrus sinensis [apfelsine]
ref|XP_010552316.1|  PREDICTED: uncharacterized protein LOC104822...  81.6    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_010552315.1|  PREDICTED: uncharacterized protein LOC104822...  81.6    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_008451001.1|  PREDICTED: uncharacterized protein LOC103492...  81.3    1e-14   Cucumis melo [Oriental melon]
ref|XP_008451002.1|  PREDICTED: uncharacterized protein LOC103492...  81.3    1e-14   Cucumis melo [Oriental melon]
ref|XP_004144062.1|  PREDICTED: uncharacterized protein LOC101215929  81.3    1e-14   Cucumis sativus [cucumbers]
ref|XP_010552314.1|  PREDICTED: uncharacterized protein LOC104822...  81.3    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_010552313.1|  PREDICTED: uncharacterized protein LOC104822...  81.3    2e-14   Tarenaya hassleriana [spider flower]
gb|KDO54490.1|  hypothetical protein CISIN_1g005158mg                 80.9    2e-14   Citrus sinensis [apfelsine]
ref|XP_008779460.1|  PREDICTED: YTH domain-containing family prot...  79.3    6e-14   Phoenix dactylifera
gb|EYU32828.1|  hypothetical protein MIMGU_mgv1a002229mg              79.0    9e-14   Erythranthe guttata [common monkey flower]
gb|KCW87046.1|  hypothetical protein EUGRSUZ_B03591                   77.8    2e-13   Eucalyptus grandis [rose gum]
ref|XP_008812836.1|  PREDICTED: YTH domain-containing family prot...  77.0    3e-13   Phoenix dactylifera
ref|XP_010932747.1|  PREDICTED: YTH domain-containing family prot...  75.1    2e-12   Elaeis guineensis
ref|XP_010917720.1|  PREDICTED: uncharacterized protein LOC105042282  75.1    2e-12   Elaeis guineensis
gb|KCW87047.1|  hypothetical protein EUGRSUZ_B03591                   74.3    3e-12   Eucalyptus grandis [rose gum]
ref|XP_006826301.1|  hypothetical protein AMTR_s00004p00073360        73.6    5e-12   Amborella trichopoda
ref|XP_006407213.1|  hypothetical protein EUTSA_v10020224mg           73.6    5e-12   
ref|XP_006297132.1|  hypothetical protein CARUB_v10013133mg           73.2    9e-12   Capsella rubella
ref|XP_011048156.1|  PREDICTED: uncharacterized protein LOC105142...  72.0    2e-11   Populus euphratica
ref|XP_010487108.1|  PREDICTED: uncharacterized protein LOC104765...  71.2    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010500586.1|  PREDICTED: uncharacterized protein LOC104777...  71.2    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010465188.1|  PREDICTED: uncharacterized protein LOC104745597  71.2    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_002299095.2|  hypothetical protein POPTR_0001s039401g          70.9    4e-11   
ref|XP_010044924.1|  PREDICTED: uncharacterized protein LOC104433761  70.9    4e-11   Eucalyptus grandis [rose gum]
gb|ABK96645.1|  unknown                                               70.9    4e-11   Populus trichocarpa x Populus deltoides
ref|XP_006407214.1|  hypothetical protein EUTSA_v10020224mg           70.9    4e-11   
emb|CAN81999.1|  hypothetical protein VITISV_031582                   67.0    6e-11   Vitis vinifera
ref|NP_001030689.1|  CIPK1 interacting protein ECT2                   70.1    6e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAN72190.1|  Unknown protein                                       70.1    9e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187955.2|  CIPK1 interacting protein ECT2                      70.1    9e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010044923.1|  PREDICTED: uncharacterized protein LOC104433760  69.3    2e-10   Eucalyptus grandis [rose gum]
ref|XP_010487109.1|  PREDICTED: uncharacterized protein LOC104765...  68.9    2e-10   
ref|NP_850578.1|  CIPK1 interacting protein ECT2                      68.6    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001030690.1|  CIPK1 interacting protein ECT2                   68.6    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011048157.1|  PREDICTED: uncharacterized protein LOC105142...  67.4    6e-10   Populus euphratica
ref|XP_010500580.1|  PREDICTED: uncharacterized protein LOC104777...  67.0    8e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010487106.1|  PREDICTED: uncharacterized protein LOC104765...  67.0    8e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009146490.1|  PREDICTED: uncharacterized protein LOC103870130  66.2    1e-09   Brassica rapa
emb|CDY43989.1|  BnaA05g25840D                                        66.2    1e-09   Brassica napus [oilseed rape]
emb|CDY23602.1|  BnaC05g39920D                                        66.2    1e-09   Brassica napus [oilseed rape]
ref|XP_010542475.1|  PREDICTED: uncharacterized protein LOC104815674  65.9    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_010534849.1|  PREDICTED: uncharacterized protein LOC104810317  65.9    2e-09   Tarenaya hassleriana [spider flower]
ref|NP_001185240.1|  uncharacterized protein                          65.1    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884968.1|  hypothetical protein ARALYDRAFT_478733           65.5    3e-09   
ref|XP_010487107.1|  PREDICTED: uncharacterized protein LOC104765...  65.1    3e-09   
ref|XP_010653842.1|  PREDICTED: uncharacterized protein LOC100245...  61.6    5e-08   Vitis vinifera
ref|XP_010653843.1|  PREDICTED: uncharacterized protein LOC100245...  61.6    5e-08   Vitis vinifera
ref|XP_010910310.1|  PREDICTED: YTH domain-containing family prot...  60.8    9e-08   Elaeis guineensis
emb|CAN81896.1|  hypothetical protein VITISV_009052                   60.1    2e-07   Vitis vinifera
emb|CDY07089.1|  BnaCnng01040D                                        59.3    2e-07   
ref|XP_004985631.1|  PREDICTED: uncharacterized protein LOC101767...  58.9    4e-07   Setaria italica
ref|XP_004985629.1|  PREDICTED: uncharacterized protein LOC101767...  58.9    4e-07   Setaria italica
ref|XP_004985632.1|  PREDICTED: uncharacterized protein LOC101767...  58.5    4e-07   Setaria italica
ref|XP_004985630.1|  PREDICTED: uncharacterized protein LOC101767...  58.5    4e-07   Setaria italica
gb|KGN66348.1|  hypothetical protein Csa_1G599420                     58.2    6e-07   Cucumis sativus [cucumbers]
ref|XP_008451003.1|  PREDICTED: uncharacterized protein LOC103492...  58.2    6e-07   Cucumis melo [Oriental melon]
gb|KFK38676.1|  hypothetical protein AALP_AA3G146000                  58.2    6e-07   Arabis alpina [alpine rockcress]
ref|XP_009124755.1|  PREDICTED: uncharacterized protein LOC103849773  58.2    7e-07   Brassica rapa
gb|AAY44715.1|  unknown                                               57.8    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411291.1|  PREDICTED: uncharacterized protein LOC103993...  57.4    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408492.1|  PREDICTED: uncharacterized protein LOC103990...  57.4    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009411292.1|  PREDICTED: uncharacterized protein LOC103993...  57.4    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408493.1|  PREDICTED: uncharacterized protein LOC103990...  57.4    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009339199.1|  PREDICTED: uncharacterized protein LOC103931...  56.6    2e-06   Pyrus x bretschneideri [bai li]
emb|CDY24182.1|  BnaC01g37620D                                        56.6    2e-06   Brassica napus [oilseed rape]
ref|NP_001169286.1|  hypothetical protein                             56.6    2e-06   Zea mays [maize]
gb|AFW89696.1|  hypothetical protein ZEAMMB73_168477                  56.2    2e-06   
ref|XP_009398525.1|  PREDICTED: YTH domain-containing family prot...  56.2    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF94073.1|  YT521-B-like family protein, expressed                56.2    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009339198.1|  PREDICTED: uncharacterized protein LOC103931...  56.2    3e-06   Pyrus x bretschneideri [bai li]
gb|ABF94076.1|  YT521-B-like family protein, expressed                56.2    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049022.1|  Os03g0158500                                     56.2    3e-06   
gb|EEC74554.1|  hypothetical protein OsI_10095                        56.2    3e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_010229176.1|  PREDICTED: uncharacterized protein LOC100841...  56.2    3e-06   Brachypodium distachyon [annual false brome]
ref|XP_003558773.1|  PREDICTED: uncharacterized protein LOC100841...  56.2    3e-06   Brachypodium distachyon [annual false brome]
gb|AAD10646.1|  Hypothetical protein                                  55.8    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185241.1|  uncharacterized protein                          55.8    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006651059.1|  PREDICTED: uncharacterized protein LOC102715747  55.1    6e-06   Oryza brachyantha
ref|XP_010229175.1|  PREDICTED: uncharacterized protein LOC100841...  55.1    6e-06   Brachypodium distachyon [annual false brome]
ref|XP_009398364.1|  PREDICTED: YTH domain-containing family prot...  55.1    6e-06   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX82538.1|  BnaA03g32830D                                        55.1    6e-06   
ref|NP_001280979.1|  uncharacterized LOC103446969                     54.3    1e-05   Malus domestica [apple tree]
ref|XP_008351306.1|  PREDICTED: uncharacterized protein LOC103414...  54.3    1e-05   
ref|XP_009399331.1|  PREDICTED: YTH domain-containing family prot...  54.3    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX75712.1|  BnaC03g37950D                                        53.1    2e-05   
dbj|BAJ96028.1|  predicted protein                                    53.1    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK04671.1|  predicted protein                                    53.1    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT25443.1|  hypothetical protein F775_28207                       53.1    3e-05   
ref|XP_008351300.1|  PREDICTED: YTH domain-containing family prot...  52.8    3e-05   
gb|AAN06837.1|  Putative RNA-binding protein                          52.8    3e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008645292.1|  PREDICTED: uncharacterized protein LOC100383...  52.4    4e-05   Zea mays [maize]
ref|XP_009398365.1|  PREDICTED: YTH domain-containing family prot...  52.4    4e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS56337.1|  YTH domain family protein 2                           52.4    4e-05   Triticum urartu
ref|XP_008645285.1|  PREDICTED: uncharacterized protein LOC100383...  52.4    5e-05   Zea mays [maize]
ref|NP_001169717.1|  uncharacterized protein LOC100383598             52.4    5e-05   Zea mays [maize]
ref|XP_008384358.1|  PREDICTED: uncharacterized protein LOC103446...  52.0    6e-05   
ref|XP_008366130.1|  PREDICTED: uncharacterized protein LOC103429...  51.6    8e-05   
ref|XP_006445565.1|  hypothetical protein CICLE_v10014439mg           51.2    9e-05   
ref|XP_009603414.1|  PREDICTED: YTH domain-containing family prot...  51.2    1e-04   Nicotiana tomentosiformis
ref|XP_009397705.1|  PREDICTED: uncharacterized protein LOC103982492  50.4    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS72124.1|  hypothetical protein M569_02632                       49.7    4e-04   Genlisea aurea
ref|NP_001280968.1|  YTH domain-containing family protein 2-like      49.3    4e-04   Malus domestica [apple tree]
ref|XP_009135306.1|  PREDICTED: uncharacterized protein LOC103859518  48.9    6e-04   Brassica rapa
ref|XP_009411293.1|  PREDICTED: uncharacterized protein LOC103993...  48.5    7e-04   Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_009587406.1| PREDICTED: protein lozenge-like [Nicotiana tomentosiformis]
Length=304

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  330
            AAVAP+ADQ ++LLQ LSLDSQ K+LEI EP KK  VDS    NGQIQP DRS +PL+PD
Sbjct  2    AAVAPSADQAADLLQKLSLDSQNKSLEIAEPKKK-PVDSKDVGNGQIQPVDRSVTPLLPD  60

Query  331  FMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQH  495
            FMDPTLCY+PNGYP YY GYDG+GNEWE Y RYVN EGVEM G YGDN S +YQH
Sbjct  61   FMDPTLCYVPNGYPSYYYGYDGSGNEWEDYTRYVNPEGVEMTGAYGDNGSFMYQH  115



>ref|XP_009799894.1| PREDICTED: uncharacterized protein LOC104245894 isoform X1 [Nicotiana 
sylvestris]
Length=701

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 90/115 (78%), Gaps = 1/115 (1%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  330
            AAVAP ADQ ++LLQ LSLDSQ K LEI EP KK  VDS    NGQIQ  DRS +PL+PD
Sbjct  2    AAVAPPADQAADLLQKLSLDSQNKTLEIAEPKKK-PVDSKDVGNGQIQSLDRSVTPLLPD  60

Query  331  FMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQH  495
            FMDPTLCY+PNGYP YY GYDG+GNEWE Y RYVN EGVEM G YGDN S +YQH
Sbjct  61   FMDPTLCYVPNGYPSYYYGYDGSGNEWEDYTRYVNPEGVEMTGAYGDNGSFMYQH  115



>ref|XP_009799895.1| PREDICTED: uncharacterized protein LOC104245894 isoform X2 [Nicotiana 
sylvestris]
Length=699

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 90/115 (78%), Gaps = 1/115 (1%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  330
            AAVAP ADQ ++LLQ LSLDSQ K LEI EP KK  VDS    NGQIQ  DRS +PL+PD
Sbjct  2    AAVAPPADQAADLLQKLSLDSQNKTLEIAEPKKK-PVDSKDVGNGQIQSLDRSVTPLLPD  60

Query  331  FMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQH  495
            FMDPTLCY+PNGYP YY GYDG+GNEWE Y RYVN EGVEM G YGDN S +YQH
Sbjct  61   FMDPTLCYVPNGYPSYYYGYDGSGNEWEDYTRYVNPEGVEMTGAYGDNGSFMYQH  115



>ref|XP_006359197.1| PREDICTED: uncharacterized protein LOC102583016 [Solanum tuberosum]
Length=704

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 87/117 (74%), Gaps = 2/117 (2%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  330
            AA AP ADQ ++LLQ+LSLDS++K LEI +  KK S + TH ANGQ+Q  DRS +P++P+
Sbjct  2    AAGAPPADQAADLLQNLSLDSRSKTLEIADAKKKPSGNPTHGANGQVQSTDRSVTPVLPE  61

Query  331  FMDPTLCYLPNgypyyy--ggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQH  495
            FMDP LCY+PN Y       GYD + NEWE Y RY N +GVEMPGVYGDNSSL+Y H
Sbjct  62   FMDPNLCYVPNSYTSTAYYYGYDASANEWEDYARYANPDGVEMPGVYGDNSSLIYHH  118



>ref|XP_007204996.1| hypothetical protein PRUPE_ppa004220mg [Prunus persica]
 gb|EMJ06195.1| hypothetical protein PRUPE_ppa004220mg [Prunus persica]
Length=522

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 97/124 (78%), Gaps = 10/124 (8%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSV------DSTHAANGQIQPADRSF  312
            A VAP ADQ ++LLQ LSLDSQTK LEIPEPTKK SV      DS +AANGQIQ ++RS 
Sbjct  2    ATVAPPADQAADLLQKLSLDSQTKTLEIPEPTKKPSVNQYGSIDSGNAANGQIQ-SERSV  60

Query  313  SPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSL  483
            +PL+PDFMDP+LCYLPN     YYYGGYDGTGNEW+ Y RYVN EGVEM  GVYGDN SL
Sbjct  61   TPLLPDFMDPSLCYLPNAYPSAYYYGGYDGTGNEWDDYSRYVNPEGVEMTSGVYGDNGSL  120

Query  484  VYQH  495
            +Y H
Sbjct  121  LYHH  124



>ref|XP_011089706.1| PREDICTED: YTH domain-containing family protein 1-like [Sesamum 
indicum]
Length=703

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 95/119 (80%), Gaps = 6/119 (5%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  330
            AAVAP ADQ ++LLQ LSLDSQ K +EIP+ TKK S+DS++ ANG IQ +DRS +PL+PD
Sbjct  2    AAVAPPADQAADLLQKLSLDSQAKTIEIPDATKKPSIDSSNVANG-IQ-SDRSVTPLLPD  59

Query  331  FMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            FMDPT+CYLPN      YYYGGYDG+ NEWE Y RYVN +GVEM PGVYGDN SL+Y H
Sbjct  60   FMDPTMCYLPNGYPSTAYYYGGYDGSANEWEDYTRYVNQDGVEMTPGVYGDNGSLMYHH  118



>ref|XP_008221460.1| PREDICTED: uncharacterized protein LOC103321408 isoform X1 [Prunus 
mume]
Length=704

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 97/124 (78%), Gaps = 10/124 (8%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSV------DSTHAANGQIQPADRSF  312
            A VAP ADQ ++LLQ LSLDSQTK LEIPEPTKK SV      DS +AANGQIQ ++RS 
Sbjct  2    ATVAPPADQAADLLQKLSLDSQTKTLEIPEPTKKPSVNQYGSIDSGNAANGQIQ-SERSV  60

Query  313  SPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSL  483
            +PL+PDFMDP+LCYLPN     YYYGGYDGTGNEW+ Y RYVN EGVEM  GVYGDN SL
Sbjct  61   TPLLPDFMDPSLCYLPNAYPSAYYYGGYDGTGNEWDDYSRYVNPEGVEMTSGVYGDNGSL  120

Query  484  VYQH  495
            +Y H
Sbjct  121  LYHH  124



>ref|XP_004228948.1| PREDICTED: uncharacterized protein LOC101253713 [Solanum lycopersicum]
Length=706

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  330
            AA AP ADQ ++LLQ+LSLDS+ K LEI +  KK S + T  ANGQ+Q ADRS +P++P+
Sbjct  2    AAGAPPADQAADLLQNLSLDSRNKTLEIADTKKKPSGNPTDGANGQLQSADRSVTPVLPE  61

Query  331  FMDPTLCYLPNgypyyy--ggydgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQH  495
            FMDP LCY+PN Y       GYD + NEWE Y RY N +GVEMPGVYGDNSSL+Y H
Sbjct  62   FMDPNLCYVPNSYASTAYYYGYDASANEWEDYARYTNPDGVEMPGVYGDNSSLIYHH  118



>ref|XP_009597413.1| PREDICTED: uncharacterized protein LOC104093384 isoform X1 [Nicotiana 
tomentosiformis]
Length=705

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 68/95 (72%), Gaps = 3/95 (3%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gypyyyggy  390
            + LEI EP KK SVDS    NGQIQ  +RS +PL+P+F+DP  CYLPN       YY GY
Sbjct  25   RNLEITEPKKKPSVDSKDVGNGQIQSMNRSVTPLLPEFIDPNFCYLPNGYPSTAAYYYGY  84

Query  391  dgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQH  495
            D +GNEWE Y RY+N +GVEMPGVYGDN SL+Y H
Sbjct  85   DASGNEWEDYSRYLNPDGVEMPGVYGDNGSLIYHH  119



>ref|XP_009597421.1| PREDICTED: uncharacterized protein LOC104093384 isoform X2 [Nicotiana 
tomentosiformis]
Length=703

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 68/95 (72%), Gaps = 3/95 (3%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gypyyyggy  390
            + LEI EP KK SVDS    NGQIQ  +RS +PL+P+F+DP  CYLPN       YY GY
Sbjct  25   RNLEITEPKKKPSVDSKDVGNGQIQSMNRSVTPLLPEFIDPNFCYLPNGYPSTAAYYYGY  84

Query  391  dgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQH  495
            D +GNEWE Y RY+N +GVEMPGVYGDN SL+Y H
Sbjct  85   DASGNEWEDYSRYLNPDGVEMPGVYGDNGSLIYHH  119



>gb|KHN06477.1| YTH domain family protein 2 [Glycine soja]
Length=708

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 77/102 (75%), Gaps = 10/102 (10%)
 Frame = +1

Query  220  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  372
            K LEIPEPTKK       SVDS +AANGQIQ  DRS +P++ DF+DPT+CYLPN      
Sbjct  25   KPLEIPEPTKKATGNQYGSVDSGNAANGQIQSYDRSVTPVLQDFIDPTMCYLPNGYPSTA  84

Query  373  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SL+Y H
Sbjct  85   YYYGGYDGTGNEWDEYSRYVNSEGVEMTSGVYGDNGSLLYHH  126



>ref|XP_006580216.1| PREDICTED: YTH domain family protein 1-like [Glycine max]
Length=679

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 77/102 (75%), Gaps = 10/102 (10%)
 Frame = +1

Query  220  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  372
            K LEIPEPTKK       SVDS +AANGQIQ  DRS +P++ DF+DPT+CYLPN      
Sbjct  25   KPLEIPEPTKKATGNQYGSVDSGNAANGQIQSYDRSVTPVLQDFIDPTMCYLPNGYPSTA  84

Query  373  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SL+Y H
Sbjct  85   YYYGGYDGTGNEWDEYSRYVNSEGVEMTSGVYGDNGSLLYHH  126



>ref|XP_011089707.1| PREDICTED: uncharacterized protein LOC105170581 [Sesamum indicum]
Length=696

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 93/119 (78%), Gaps = 6/119 (5%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  330
            AAVAP +DQ ++LLQ LSLDSQ K +EIP+ TKK S+DS++  NG IQ +DRS +PL+PD
Sbjct  2    AAVAPPSDQAADLLQKLSLDSQAKTIEIPDATKKPSIDSSNVPNG-IQ-SDRSVTPLLPD  59

Query  331  FMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            FMDPT+CYLPN      YYY GYDG+ NEWE Y RYVN +GVEM PGVYGDN SL+Y H
Sbjct  60   FMDPTMCYLPNGYPSTAYYYSGYDGSANEWEDYTRYVNQDGVEMTPGVYGDNGSLMYHH  118



>ref|XP_008221524.1| PREDICTED: uncharacterized protein LOC103321408 isoform X2 [Prunus 
mume]
Length=703

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 78/101 (77%), Gaps = 10/101 (10%)
 Frame = +1

Query  220  KALEIPEPTKKVSV------DSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNg--ypy  375
            K LEIPEPTKK SV      DS +AANGQIQ ++RS +PL+PDFMDP+LCYLPN     Y
Sbjct  24   KTLEIPEPTKKPSVNQYGSIDSGNAANGQIQ-SERSVTPLLPDFMDPSLCYLPNAYPSAY  82

Query  376  yyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YYGGYDGTGNEW+ Y RYVN EGVEM  GVYGDN SL+Y H
Sbjct  83   YYGGYDGTGNEWDDYSRYVNPEGVEMTSGVYGDNGSLLYHH  123



>emb|CBI16561.3| unnamed protein product [Vitis vinifera]
Length=675

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 91/123 (74%), Gaps = 8/123 (7%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS------VDSTHAANGQIQPADRSF  312
            AAVAP ADQ +ELLQ LSLDSQTK LEIPEPTKK S      VD   AANGQ Q  +RS 
Sbjct  2    AAVAPPADQAAELLQKLSLDSQTKTLEIPEPTKKPSGNQFGAVDGGDAANGQNQSCERSV  61

Query  313  SPLIPDFMDPTLCYLPNgypyyyggyd-gtgNEWEGYPRYVNAEGVEMP-GVYGDNSSLV  486
            +PL+ +FMDP++CY+PNGY  YY G   GT NEWE Y RY+N EGVEMP GVYGDN SL+
Sbjct  62   TPLLQEFMDPSVCYVPNGYSSYYYGGYDGTTNEWEDYSRYMNPEGVEMPAGVYGDNGSLM  121

Query  487  YQH  495
            Y H
Sbjct  122  YHH  124



>ref|XP_002285750.1| PREDICTED: uncharacterized protein LOC100253534 isoform X1 [Vitis 
vinifera]
Length=705

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 91/123 (74%), Gaps = 8/123 (7%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS------VDSTHAANGQIQPADRSF  312
            AAVAP ADQ +ELLQ LSLDSQTK LEIPEPTKK S      VD   AANGQ Q  +RS 
Sbjct  2    AAVAPPADQAAELLQKLSLDSQTKTLEIPEPTKKPSGNQFGAVDGGDAANGQNQSCERSV  61

Query  313  SPLIPDFMDPTLCYLPNgypyyyggyd-gtgNEWEGYPRYVNAEGVEMP-GVYGDNSSLV  486
            +PL+ +FMDP++CY+PNGY  YY G   GT NEWE Y RY+N EGVEMP GVYGDN SL+
Sbjct  62   TPLLQEFMDPSVCYVPNGYSSYYYGGYDGTTNEWEDYSRYMNPEGVEMPAGVYGDNGSLM  121

Query  487  YQH  495
            Y H
Sbjct  122  YHH  124



>ref|XP_009764450.1| PREDICTED: uncharacterized protein LOC104216148 isoform X1 [Nicotiana 
sylvestris]
Length=709

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 69/95 (73%), Gaps = 3/95 (3%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyg---gy  390
            K LEI EP KK SVDS +  NGQ Q  +RS +P++P+F+DP  CYLPNGYP       GY
Sbjct  25   KNLEIAEPKKKPSVDSKNVGNGQNQSMNRSVTPVLPEFIDPNFCYLPNGYPSTAAYYYGY  84

Query  391  dgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQH  495
            D +GNEWE Y RY+N +GVEMPGVYGDN SL+Y H
Sbjct  85   DASGNEWEDYSRYLNLDGVEMPGVYGDNGSLIYHH  119



>ref|XP_008366132.1| PREDICTED: uncharacterized protein LOC103429778 isoform X1 [Malus 
domestica]
Length=704

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 95/125 (76%), Gaps = 11/125 (9%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADRSF  312
            A VAP  +Q ++LLQ +SLDSQTK LEIPEPTKK       S+DS +AANGQI PA+RS 
Sbjct  2    ATVAPPVEQAADLLQKMSLDSQTKTLEIPEPTKKPSGNQYGSIDSGNAANGQI-PAERSV  60

Query  313  SPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSS  480
            +PL+PDF DP++CYLPN      YYYGGYDGTG+EW+ Y RYVN EGVEM  GVYGDN S
Sbjct  61   TPLLPDFTDPSMCYLPNSYPSTAYYYGGYDGTGSEWDDYSRYVNHEGVEMTSGVYGDNGS  120

Query  481  LVYQH  495
            L+Y H
Sbjct  121  LIYHH  125



>ref|XP_009601164.1| PREDICTED: uncharacterized protein LOC104096490, partial [Nicotiana 
tomentosiformis]
Length=709

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gypyyyggy  390
            + LEI EP KK SVDS    NGQIQ  +RS +PL+P+F+DP  CYLPN       YY GY
Sbjct  29   RNLEITEPKKKPSVDSKDVGNGQIQSMNRSVTPLLPEFIDPNFCYLPNGYPSTAAYYYGY  88

Query  391  dgtgNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQH  495
            D +GNEWE Y RY+N +GVEM GVYGDN SL+Y H
Sbjct  89   DASGNEWEDYSRYLNPDGVEMAGVYGDNGSLIYHH  123



>ref|XP_009339197.1| PREDICTED: uncharacterized protein LOC103931441 [Pyrus x bretschneideri]
Length=704

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 94/125 (75%), Gaps = 11/125 (9%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSV------DSTHAANGQIQPADRSF  312
            A VAP  +Q ++LLQ +SLDSQTK LEIPEPTKK SV      DS +AANGQI P DRS 
Sbjct  2    ATVAPPVEQAADLLQKMSLDSQTKTLEIPEPTKKPSVNQYGSIDSGNAANGQI-PEDRSV  60

Query  313  SPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSS  480
            +PL+PDF DP++CYLPN      YYYGGYDGTG+EW+ Y RYVN EGVEM  GVYGDN S
Sbjct  61   TPLLPDFADPSMCYLPNSYPSTAYYYGGYDGTGSEWDDYSRYVNPEGVEMTSGVYGDNGS  120

Query  481  LVYQH  495
            L+Y H
Sbjct  121  LIYHH  125



>ref|XP_003531272.1| PREDICTED: uncharacterized protein LOC100819200 isoformX1 [Glycine 
max]
Length=707

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 76/102 (75%), Gaps = 10/102 (10%)
 Frame = +1

Query  220  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  372
            K LEIPEPTKK       SVDS +AANGQI   DRS +P++ DF+DPT+CYLPN      
Sbjct  25   KPLEIPEPTKKATGNQYGSVDSGNAANGQIPSYDRSVTPVLQDFIDPTMCYLPNGYPSTA  84

Query  373  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SL+Y H
Sbjct  85   YYYGGYDGTGNEWDDYSRYVNSEGVEMTSGVYGDNGSLLYHH  126



>gb|KHN48074.1| YTH domain family protein 2 [Glycine soja]
Length=707

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 76/102 (75%), Gaps = 10/102 (10%)
 Frame = +1

Query  220  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  372
            K LEIPEPTKK       SVDS +AANGQI   DRS +P++ DF+DPT+CYLPN      
Sbjct  25   KPLEIPEPTKKATGNQYGSVDSGNAANGQIPSYDRSVTPVLQDFIDPTMCYLPNGYPSTA  84

Query  373  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SL+Y H
Sbjct  85   YYYGGYDGTGNEWDDYSRYVNSEGVEMTSGVYGDNGSLLYHH  126



>ref|XP_006585213.1| PREDICTED: uncharacterized protein LOC100819200 isoform X4 [Glycine 
max]
Length=678

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 76/102 (75%), Gaps = 10/102 (10%)
 Frame = +1

Query  220  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  372
            K LEIPEPTKK       SVDS +AANGQI   DRS +P++ DF+DPT+CYLPN      
Sbjct  25   KPLEIPEPTKKATGNQYGSVDSGNAANGQIPSYDRSVTPVLQDFIDPTMCYLPNGYPSTA  84

Query  373  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SL+Y H
Sbjct  85   YYYGGYDGTGNEWDDYSRYVNSEGVEMTSGVYGDNGSLLYHH  126



>ref|XP_006585211.1| PREDICTED: uncharacterized protein LOC100819200 isoform X2 [Glycine 
max]
Length=709

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 76/102 (75%), Gaps = 10/102 (10%)
 Frame = +1

Query  220  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  372
            K LEIPEPTKK       SVDS +AANGQI   DRS +P++ DF+DPT+CYLPN      
Sbjct  27   KPLEIPEPTKKATGNQYGSVDSGNAANGQIPSYDRSVTPVLQDFIDPTMCYLPNGYPSTA  86

Query  373  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SL+Y H
Sbjct  87   YYYGGYDGTGNEWDDYSRYVNSEGVEMTSGVYGDNGSLLYHH  128



>ref|XP_006585212.1| PREDICTED: uncharacterized protein LOC100819200 isoform X3 [Glycine 
max]
Length=680

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 76/102 (75%), Gaps = 10/102 (10%)
 Frame = +1

Query  220  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  372
            K LEIPEPTKK       SVDS +AANGQI   DRS +P++ DF+DPT+CYLPN      
Sbjct  27   KPLEIPEPTKKATGNQYGSVDSGNAANGQIPSYDRSVTPVLQDFIDPTMCYLPNGYPSTA  86

Query  373  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SL+Y H
Sbjct  87   YYYGGYDGTGNEWDDYSRYVNSEGVEMTSGVYGDNGSLLYHH  128



>ref|XP_002513402.1| yth domain-containing protein, putative [Ricinus communis]
 gb|EEF48805.1| yth domain-containing protein, putative [Ricinus communis]
Length=636

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 97/125 (78%), Gaps = 10/125 (8%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSV------DSTHAANGQIQPADRSF  312
            A VAP+A++T++LLQ+LSLDSQTK LEIPEPTKK SV      DS  +ANGQIQP +RS 
Sbjct  2    ATVAPSAEKTADLLQNLSLDSQTKPLEIPEPTKKTSVYQYGAVDSGVSANGQIQPTERSL  61

Query  313  SPLIPDFMDPTLCYLPNgy---pyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSS  480
            +P +PD MDPT+CYLPNGY    YYYG Y+GTG+EW+ Y RY N EGVEM  GVYGDN S
Sbjct  62   TPFLPDLMDPTVCYLPNGYPSPAYYYGSYNGTGSEWDDYSRYANTEGVEMTSGVYGDNGS  121

Query  481  LVYQH  495
            +++ +
Sbjct  122  VMFHN  126



>ref|XP_008366133.1| PREDICTED: uncharacterized protein LOC103429778 isoform X2 [Malus 
domestica]
Length=703

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 77/102 (75%), Gaps = 11/102 (11%)
 Frame = +1

Query  220  KALEIPEPTKK------VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  372
            K LEIPEPTKK       S+DS +AANGQI PA+RS +PL+PDF DP++CYLPN      
Sbjct  24   KTLEIPEPTKKPSGNQYGSIDSGNAANGQI-PAERSVTPLLPDFTDPSMCYLPNSYPSTA  82

Query  373  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YYYGGYDGTG+EW+ Y RYVN EGVEM  GVYGDN SL+Y H
Sbjct  83   YYYGGYDGTGSEWDDYSRYVNHEGVEMTSGVYGDNGSLIYHH  124



>ref|XP_009376087.1| PREDICTED: uncharacterized protein LOC103964826 isoform X1 [Pyrus 
x bretschneideri]
Length=704

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 95/125 (76%), Gaps = 11/125 (9%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSV------DSTHAANGQIQPADRSF  312
            A VAP  +Q ++LLQ +SLDSQTK LEIPEPTKK SV      DS +AANGQI P++RS 
Sbjct  2    ATVAPPVEQAADLLQKMSLDSQTKTLEIPEPTKKPSVNQYGSIDSGNAANGQI-PSERSV  60

Query  313  SPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSS  480
            +PL+ DF+DP++CYLPN      YYYGGYDGTGNEW+ Y RYVN EGVEM  GVYGDN S
Sbjct  61   TPLLSDFVDPSMCYLPNGYPSTAYYYGGYDGTGNEWDDYSRYVNPEGVEMTSGVYGDNGS  120

Query  481  LVYQH  495
            L+Y H
Sbjct  121  LLYHH  125



>gb|KDP29478.1| hypothetical protein JCGZ_19307 [Jatropha curcas]
Length=688

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 93/125 (74%), Gaps = 10/125 (8%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSV------DSTHAANGQIQPADRSF  312
            AAVAP+ ++ +ELLQ+LS+DSQTK LEIPEPTKK SV      +S  +ANGQI  A+RS 
Sbjct  2    AAVAPSTEKAAELLQTLSIDSQTKTLEIPEPTKKTSVYQYGGVESGVSANGQIPTAERSV  61

Query  313  SPLIPDFMDPTLCYLPNgy---pyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSS  480
            +P +PD MDP++CYLPN Y    YYYG Y+G+ NEWE Y RY N EGVEM  GVYGDN S
Sbjct  62   TPFLPDLMDPSMCYLPNSYPSPAYYYGSYNGSSNEWEDYSRYANTEGVEMASGVYGDNGS  121

Query  481  LVYQH  495
            ++Y +
Sbjct  122  VMYHN  126



>ref|XP_010103094.1| hypothetical protein L484_005073 [Morus notabilis]
 gb|EXB94817.1| hypothetical protein L484_005073 [Morus notabilis]
Length=714

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 75/101 (74%), Gaps = 10/101 (10%)
 Frame = +1

Query  220  KALEIPEPTKKVS------VDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  372
            K  EIPEPTKK S      +DS +A NGQI PADRS SPL+PDFMDP++CY+PN      
Sbjct  33   KGAEIPEPTKKQSANQFGSLDSGNAVNGQIPPADRSVSPLLPDFMDPSVCYVPNGYPSTA  92

Query  373  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQ  492
            YYYGGYDGTGNEW+ Y RY+N +GVEM  GVYGDN SL+Y 
Sbjct  93   YYYGGYDGTGNEWDDYSRYMNPDGVEMTSGVYGDNGSLMYH  133



>ref|XP_007014623.1| Evolutionarily conserved C-terminal region 2 isoform 2 [Theobroma 
cacao]
 gb|EOY32242.1| Evolutionarily conserved C-terminal region 2 isoform 2 [Theobroma 
cacao]
Length=710

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 95/126 (75%), Gaps = 9/126 (7%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADR  306
            MAA VAP ADQT+ELLQ LSLDSQ K L+IPEPTKK       SVDS +A N QI   +R
Sbjct  1    MAATVAPPADQTAELLQKLSLDSQAKPLDIPEPTKKPSVYQYESVDSGNAGNTQIPSFER  60

Query  307  SFSPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNS  477
              +PL+PDFMDPT+CYLPNG    YYYGG++GTGN+W+ Y RYVN +GV+M  GVYGDN 
Sbjct  61   CATPLLPDFMDPTMCYLPNGYPSAYYYGGFEGTGNDWDEYSRYVNPDGVDMTSGVYGDNG  120

Query  478  SLVYQH  495
            SL+Y H
Sbjct  121  SLMYHH  126



>ref|XP_008351953.1| PREDICTED: uncharacterized protein LOC103415395 [Malus domestica]
Length=633

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 94/125 (75%), Gaps = 11/125 (9%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSV------DSTHAANGQIQPADRSF  312
            A VAP  +Q ++LLQ +SLDSQTK LE PEPTKK SV      DS +AANGQ  P++RS 
Sbjct  2    ATVAPPVEQAADLLQKMSLDSQTKTLEXPEPTKKPSVNQYGSIDSGNAANGQ-XPSERSV  60

Query  313  SPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSS  480
            +PL+PDF+DP++CYLPN      YYYGGYDGTGNEW+ Y RYVN EGVEM  GVYGDN S
Sbjct  61   TPLLPDFVDPSMCYLPNGYPSTAYYYGGYDGTGNEWDDYSRYVNPEGVEMTSGVYGDNGS  120

Query  481  LVYQH  495
            L+Y H
Sbjct  121  LLYHH  125



>ref|XP_010651400.1| PREDICTED: uncharacterized protein LOC100253534 isoform X2 [Vitis 
vinifera]
Length=704

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 71/100 (71%), Gaps = 8/100 (8%)
 Frame = +1

Query  220  KALEIPEPTKKVS------VDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyy  381
            K LEIPEPTKK S      VD   AANGQ Q  +RS +PL+ +FMDP++CY+PNGY  YY
Sbjct  24   KTLEIPEPTKKPSGNQFGAVDGGDAANGQNQSCERSVTPLLQEFMDPSVCYVPNGYSSYY  83

Query  382  ggyd-gtgNEWEGYPRYVNAEGVEMP-GVYGDNSSLVYQH  495
             G   GT NEWE Y RY+N EGVEMP GVYGDN SL+Y H
Sbjct  84   YGGYDGTTNEWEDYSRYMNPEGVEMPAGVYGDNGSLMYHH  123



>ref|XP_010257810.1| PREDICTED: YTH domain-containing family protein 2-like [Nelumbo 
nucifera]
Length=532

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 90/125 (72%), Gaps = 10/125 (8%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADRSF  312
            AAVAP ADQ ++LLQ LS+DSQT  +E+PE TKK       SV++  A NG +Q  +RS 
Sbjct  2    AAVAPPADQAADLLQKLSIDSQTNNIEVPEATKKPSTIQYGSVEAAEAHNGPVQSFERST  61

Query  313  SPLIPDFMDPTLCYLPNgypyyy---ggydgtgNEWEGYPRYVNAEGVEMP-GVYGDNSS  480
            +PL+ DFMDP++CYLPNGY       GGYDG  NEW+ YPRYVN +GVEMP GVYGDN S
Sbjct  62   TPLLQDFMDPSMCYLPNGYASTAYYYGGYDGHINEWDDYPRYVNPDGVEMPTGVYGDNGS  121

Query  481  LVYQH  495
            L+Y H
Sbjct  122  LMYHH  126



>ref|XP_010257809.1| PREDICTED: YTH domain-containing family protein 1-like [Nelumbo 
nucifera]
Length=588

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 90/125 (72%), Gaps = 10/125 (8%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADRSF  312
            AAVAP ADQ ++LLQ LS+DSQTK +E+PE TKK       SV++  A NG +Q  +RS 
Sbjct  2    AAVAPPADQAADLLQKLSIDSQTKNIEVPEATKKPFTIQYGSVETAEAPNGPVQSCERST  61

Query  313  SPLIPDFMDPTLCYLPNgypyyy---ggydgtgNEWEGYPRYVNAEGVEMP-GVYGDNSS  480
            +PL+ DFMDP++CYLPNGY       GGYDG  NEW+ YPR+VN +GVEM  GVYGDN S
Sbjct  62   TPLLQDFMDPSMCYLPNGYASTAYYYGGYDGHINEWDDYPRFVNPDGVEMSTGVYGDNGS  121

Query  481  LVYQH  495
            L+Y H
Sbjct  122  LIYHH  126



>ref|XP_007159551.1| hypothetical protein PHAVU_002G247000g [Phaseolus vulgaris]
 gb|ESW31545.1| hypothetical protein PHAVU_002G247000g [Phaseolus vulgaris]
Length=677

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 74/102 (73%), Gaps = 11/102 (11%)
 Frame = +1

Query  220  KALEIPEPTKKV------SVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  372
            K LE+PEPTKK       SVDS + ANGQI   +RS +P++ DF+DP +CYLPN      
Sbjct  25   KPLEMPEPTKKATGNQYGSVDSGNGANGQIPSYERSVTPVL-DFIDPAMCYLPNGYPSTA  83

Query  373  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YYYGGYDGTGNEW+ Y RYVN+EGVEM  GVYGDN SLVY H
Sbjct  84   YYYGGYDGTGNEWDDYSRYVNSEGVEMTSGVYGDNGSLVYHH  125



>ref|XP_004504214.1| PREDICTED: YTH domain family protein 2-like isoform X3 [Cicer 
arietinum]
Length=677

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 72/101 (71%), Gaps = 9/101 (9%)
 Frame = +1

Query  220  KALEIPEPTKK------VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNg--ypy  375
            KALEIPEP KK       +VDS + ANGQI   +RS +P++ DFMDPT+CYLPNG     
Sbjct  25   KALEIPEPNKKPTGNQYGTVDSGNHANGQIPSYERSITPVLQDFMDPTMCYLPNGYPSTA  84

Query  376  yyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YY GYDGTGN+WE Y RY+N E V+M  GVYGDN SL+Y H
Sbjct  85   YYYGYDGTGNDWEDYSRYLNPEAVDMTSGVYGDNGSLLYHH  125



>ref|XP_004504212.1| PREDICTED: YTH domain family protein 2-like isoform X1 [Cicer 
arietinum]
Length=685

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 72/102 (71%), Gaps = 10/102 (10%)
 Frame = +1

Query  220  KALEIPEPTKK------VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  372
            KALEIPEP KK       +VDS + ANGQI   +RS +P++ DFMDPT+CYLPN      
Sbjct  25   KALEIPEPNKKPTGNQYGTVDSGNHANGQIPSYERSITPVLQDFMDPTMCYLPNGYPSTA  84

Query  373  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YYYG YDGTGN+WE Y RY+N E V+M  GVYGDN SL+Y H
Sbjct  85   YYYGSYDGTGNDWEDYSRYLNPEAVDMTSGVYGDNGSLLYHH  126



>ref|XP_004504213.1| PREDICTED: YTH domain family protein 2-like isoform X2 [Cicer 
arietinum]
Length=678

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 72/102 (71%), Gaps = 10/102 (10%)
 Frame = +1

Query  220  KALEIPEPTKK------VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  372
            KALEIPEP KK       +VDS + ANGQI   +RS +P++ DFMDPT+CYLPN      
Sbjct  25   KALEIPEPNKKPTGNQYGTVDSGNHANGQIPSYERSITPVLQDFMDPTMCYLPNGYPSTA  84

Query  373  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YYYG YDGTGN+WE Y RY+N E V+M  GVYGDN SL+Y H
Sbjct  85   YYYGSYDGTGNDWEDYSRYLNPEAVDMTSGVYGDNGSLLYHH  126



>gb|KDP23024.1| hypothetical protein JCGZ_01687 [Jatropha curcas]
Length=689

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 91/125 (73%), Gaps = 10/125 (8%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSV------DSTHAANGQIQPADRSF  312
            A VAP+ ++ +ELLQ+LSLD+QTK LEIPEPTKK SV      +S  +ANGQI  A+RS 
Sbjct  2    ATVAPSTEEAAELLQTLSLDTQTKTLEIPEPTKKTSVYQYGGVESGVSANGQIPSAERSV  61

Query  313  SPLIPDFMDPTLCYLPNgypy---yyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSS  480
            +P +PD MDPT+CYLPNGY     YYG Y+G+G EW+ Y RY N +GVEM  GVY DN S
Sbjct  62   TPFLPDLMDPTMCYLPNGYASPAYYYGSYNGSGTEWDDYSRYANTDGVEMASGVYPDNGS  121

Query  481  LVYQH  495
            ++Y +
Sbjct  122  VMYHN  126



>ref|XP_007014622.1| Evolutionarily conserved C-terminal region 2 isoform 1 [Theobroma 
cacao]
 gb|EOY32241.1| Evolutionarily conserved C-terminal region 2 isoform 1 [Theobroma 
cacao]
Length=742

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 74/101 (73%), Gaps = 9/101 (9%)
 Frame = +1

Query  220  KALEIPEPTKK------VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNg--ypy  375
            K L+IPEPTKK       SVDS +A N QI   +R  +PL+PDFMDPT+CYLPNG    Y
Sbjct  58   KPLDIPEPTKKPSVYQYESVDSGNAGNTQIPSFERCATPLLPDFMDPTMCYLPNGYPSAY  117

Query  376  yyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YYGG++GTGN+W+ Y RYVN +GV+M  GVYGDN SL+Y H
Sbjct  118  YYGGFEGTGNDWDEYSRYVNPDGVDMTSGVYGDNGSLMYHH  158



>gb|KHG09343.1| Glutamate receptor [Gossypium arboreum]
Length=416

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 92/126 (73%), Gaps = 9/126 (7%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADR  306
            MA  VAP ADQT+ELLQ L++DSQ K  +IPEPTKK       SVDS +  N QI   DR
Sbjct  1    MAPTVAPPADQTAELLQKLTIDSQAKPFDIPEPTKKPSVYQYGSVDSGNTGNTQIPTFDR  60

Query  307  SFSPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNS  477
            S +PL+ DFMDPT+CY+P+G    YYYGG+DGTGNEW+ Y +Y+N +GV+M  GVYGDN 
Sbjct  61   STTPLLQDFMDPTMCYIPSGYPSAYYYGGFDGTGNEWDEYSQYLNPDGVDMTSGVYGDNG  120

Query  478  SLVYQH  495
            SL+Y H
Sbjct  121  SLMYHH  126



>ref|XP_011461644.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=772

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 86/133 (65%), Gaps = 10/133 (8%)
 Frame = +1

Query  124  RGSIDRAMAAAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSV------DSTHAANG  285
            R S   +  A VAP ADQ ++LLQ LS+DSQTK LEIPEPTKK SV      DS +A NG
Sbjct  57   RSSYQFSAMATVAPPADQAADLLQKLSIDSQTKTLEIPEPTKKPSVNQYGSIDSGNAVNG  116

Query  286  QIQPADRSFSPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-P  456
            QI P+DRS +PL  DF D +  YLPNG     YY G      +W+ Y RYVN EGV+M  
Sbjct  117  QI-PSDRSVTPLSTDFTDQSFSYLPNGYPSAAYYYGGYDGAGDWDEYSRYVNPEGVDMTS  175

Query  457  GVYGDNSSLVYQH  495
            GVYGDN SL+Y H
Sbjct  176  GVYGDNGSLMYHH  188



>ref|XP_011461643.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=773

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 86/133 (65%), Gaps = 10/133 (8%)
 Frame = +1

Query  124  RGSIDRAMAAAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSV------DSTHAANG  285
            R S   +  A VAP ADQ ++LLQ LS+DSQTK LEIPEPTKK SV      DS +A NG
Sbjct  57   RSSYQFSAMATVAPPADQAADLLQKLSIDSQTKTLEIPEPTKKPSVNQYGSIDSGNAVNG  116

Query  286  QIQPADRSFSPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-P  456
            QI P+DRS +PL  DF D +  YLPNG     YY G      +W+ Y RYVN EGV+M  
Sbjct  117  QI-PSDRSVTPLSTDFTDQSFSYLPNGYPSAAYYYGGYDGAGDWDEYSRYVNPEGVDMTS  175

Query  457  GVYGDNSSLVYQH  495
            GVYGDN SL+Y H
Sbjct  176  GVYGDNGSLMYHH  188



>gb|KJB21907.1| hypothetical protein B456_004G020600 [Gossypium raimondii]
Length=656

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 91/126 (72%), Gaps = 9/126 (7%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADR  306
            MA  VAP ADQT+ELLQ L++DSQ K  +IPEPTKK       SVDS +  N QI   DR
Sbjct  1    MAPTVAPPADQTAELLQKLTIDSQAKPFDIPEPTKKPSVYQYGSVDSGNTGNTQIPTFDR  60

Query  307  SFSPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNS  477
            S +PL+ DFMDP +CY+P+G    YYYGG+DGTGNEW+ Y +Y+N +GV+M  GVYGDN 
Sbjct  61   STTPLLQDFMDPNMCYIPSGYPSAYYYGGFDGTGNEWDEYSQYLNPDGVDMTSGVYGDNG  120

Query  478  SLVYQH  495
            SL+Y H
Sbjct  121  SLMYHH  126



>gb|KJB21909.1| hypothetical protein B456_004G020600 [Gossypium raimondii]
Length=583

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 91/126 (72%), Gaps = 9/126 (7%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADR  306
            MA  VAP ADQT+ELLQ L++DSQ K  +IPEPTKK       SVDS +  N QI   DR
Sbjct  1    MAPTVAPPADQTAELLQKLTIDSQAKPFDIPEPTKKPSVYQYGSVDSGNTGNTQIPTFDR  60

Query  307  SFSPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNS  477
            S +PL+ DFMDP +CY+P+G    YYYGG+DGTGNEW+ Y +Y+N +GV+M  GVYGDN 
Sbjct  61   STTPLLQDFMDPNMCYIPSGYPSAYYYGGFDGTGNEWDEYSQYLNPDGVDMTSGVYGDNG  120

Query  478  SLVYQH  495
            SL+Y H
Sbjct  121  SLMYHH  126



>gb|KJB21908.1| hypothetical protein B456_004G020600 [Gossypium raimondii]
Length=670

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 91/126 (72%), Gaps = 9/126 (7%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADR  306
            MA  VAP ADQT+ELLQ L++DSQ K  +IPEPTKK       SVDS +  N QI   DR
Sbjct  1    MAPTVAPPADQTAELLQKLTIDSQAKPFDIPEPTKKPSVYQYGSVDSGNTGNTQIPTFDR  60

Query  307  SFSPLIPDFMDPTLCYLPNg--ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNS  477
            S +PL+ DFMDP +CY+P+G    YYYGG+DGTGNEW+ Y +Y+N +GV+M  GVYGDN 
Sbjct  61   STTPLLQDFMDPNMCYIPSGYPSAYYYGGFDGTGNEWDEYSQYLNPDGVDMTSGVYGDNG  120

Query  478  SLVYQH  495
            SL+Y H
Sbjct  121  SLMYHH  126



>ref|XP_009376095.1| PREDICTED: uncharacterized protein LOC103964826 isoform X2 [Pyrus 
x bretschneideri]
Length=686

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 85/119 (71%), Gaps = 17/119 (14%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  330
            A VAP  +Q ++LLQ +SLDSQTK LEIPEPTKK+             P++RS +PL+ D
Sbjct  2    ATVAPPVEQAADLLQKMSLDSQTKTLEIPEPTKKI-------------PSERSVTPLLSD  48

Query  331  FMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            F+DP++CYLPN      YYYGGYDGTGNEW+ Y RYVN EGVEM  GVYGDN SL+Y H
Sbjct  49   FVDPSMCYLPNGYPSTAYYYGGYDGTGNEWDDYSRYVNPEGVEMTSGVYGDNGSLLYHH  107



>ref|XP_006445566.1| hypothetical protein CICLE_v10014439mg [Citrus clementina]
 ref|XP_006488953.1| PREDICTED: uncharacterized protein LOC102626352 isoform X1 [Citrus 
sinensis]
 gb|ESR58806.1| hypothetical protein CICLE_v10014439mg [Citrus clementina]
 gb|KDO54487.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
 gb|KDO54488.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=711

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 90/128 (70%), Gaps = 12/128 (9%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAA-NGQIQPAD  303
            MA  VAP  ++ S+LLQ LSLDSQTK+LEI E TKK       SVDS +AA NGQI P++
Sbjct  1    MATTVAPAVEKASDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSE  59

Query  304  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            RS +P + DFMDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGD
Sbjct  60   RSGTPFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGD  119

Query  472  NSSLVYQH  495
            N SL+Y H
Sbjct  120  NGSLMYHH  127



>gb|KDO54489.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=509

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 90/128 (70%), Gaps = 12/128 (9%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAA-NGQIQPAD  303
            MA  VAP  ++ S+LLQ LSLDSQTK+LEI E TKK       SVDS +AA NGQI P++
Sbjct  1    MATTVAPAVEKASDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSE  59

Query  304  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            RS +P + DFMDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGD
Sbjct  60   RSGTPFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGD  119

Query  472  NSSLVYQH  495
            N SL+Y H
Sbjct  120  NGSLMYHH  127



>gb|KDO54493.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=638

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 90/128 (70%), Gaps = 12/128 (9%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAA-NGQIQPAD  303
            MA  VAP  ++ S+LLQ LSLDSQTK+LEI E TKK       SVDS +AA NGQI P++
Sbjct  1    MATTVAPAVEKASDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSE  59

Query  304  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            RS +P + DFMDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGD
Sbjct  60   RSGTPFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGD  119

Query  472  NSSLVYQH  495
            N SL+Y H
Sbjct  120  NGSLMYHH  127



>gb|KDO54494.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=591

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 90/128 (70%), Gaps = 12/128 (9%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAA-NGQIQPAD  303
            MA  VAP  ++ S+LLQ LSLDSQTK+LEI E TKK       SVDS +AA NGQI P++
Sbjct  1    MATTVAPAVEKASDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSE  59

Query  304  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            RS +P + DFMDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGD
Sbjct  60   RSGTPFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGD  119

Query  472  NSSLVYQH  495
            N SL+Y H
Sbjct  120  NGSLMYHH  127



>ref|XP_004506479.1| PREDICTED: uncharacterized protein LOC101499095 [Cicer arietinum]
Length=252

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 68/102 (67%), Gaps = 10/102 (10%)
 Frame = +1

Query  220  KALEIPEPTKK------VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gyp  372
            KALEIPEP KK       +VDS   ANGQI   +RS +P++ DFMDPT+CYLPN      
Sbjct  25   KALEIPEPNKKPRGNQYGTVDSGIHANGQIPSYERSITPVLQDFMDPTMCYLPNGYPSTA  84

Query  373  yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YYYG Y GTGN+ + Y RY+N E V M  GVYGDN SL+Y H
Sbjct  85   YYYGAYGGTGNDSDDYSRYLNPEAVNMTSGVYGDNGSLLYHH  126



>ref|XP_011025120.1| PREDICTED: uncharacterized protein LOC105126076 [Populus euphratica]
Length=619

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 60/93 (65%), Gaps = 13/93 (14%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgt  399
            K LE+PEPT K            IQP+DRS +P++  FMDPT+CYLPNGY  YY G    
Sbjct  25   KTLEMPEPTSK------------IQPSDRSVTPVLSSFMDPTVCYLPNGYQSYYYGGYNG  72

Query  400  gNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
              EW+ Y +Y+NAEGV+M  GVYGDN S +Y H
Sbjct  73   AGEWDDYSKYLNAEGVDMVSGVYGDNGSAMYPH  105



>ref|XP_006488954.1| PREDICTED: uncharacterized protein LOC102626352 isoform X2 [Citrus 
sinensis]
 gb|KDO54491.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=710

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 91/128 (71%), Gaps = 13/128 (10%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAA-NGQIQPAD  303
            MA  VAP A +TS+LLQ LSLDSQTK+LEI E TKK       SVDS +AA NGQI P++
Sbjct  1    MATTVAP-AVETSDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSE  58

Query  304  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            RS +P + DFMDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGD
Sbjct  59   RSGTPFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGD  118

Query  472  NSSLVYQH  495
            N SL+Y H
Sbjct  119  NGSLMYHH  126



>ref|XP_002304850.2| hypothetical protein POPTR_0003s20840g [Populus trichocarpa]
 gb|EEE79829.2| hypothetical protein POPTR_0003s20840g [Populus trichocarpa]
Length=619

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 60/93 (65%), Gaps = 13/93 (14%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgt  399
            K LE+PEPT K            IQP+DRS +P++ +FMDPT+CYLPNGY  YY G    
Sbjct  25   KTLEMPEPTSK------------IQPSDRSVTPVLSNFMDPTVCYLPNGYQSYYYGGYNG  72

Query  400  gNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
              EW+ Y +Y+N EGV+M  GVYGDN S +Y H
Sbjct  73   AGEWDDYSKYLNPEGVDMVSGVYGDNGSAMYPH  105



>gb|KDO54495.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=585

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 91/128 (71%), Gaps = 13/128 (10%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAA-NGQIQPAD  303
            MA  VAP A +TS+LLQ LSLDSQTK+LEI E TKK       SVDS +AA NGQI P++
Sbjct  1    MATTVAP-AVETSDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSE  58

Query  304  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            RS +P + DFMDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGD
Sbjct  59   RSGTPFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGD  118

Query  472  NSSLVYQH  495
            N SL+Y H
Sbjct  119  NGSLMYHH  126



>ref|XP_003629923.1| YTH domain family protein [Medicago truncatula]
Length=677

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 10/121 (8%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS---VDSTHAANGQIQPADRSFSPL  321
            AAVA  ADQ +ELLQ  SL+SQ K+LEIPEP KK +    DS +A NGQI   +RS +P+
Sbjct  2    AAVANPADQAAELLQKFSLESQPKSLEIPEPNKKATGNQYDSGNALNGQIPSYERSVTPV  61

Query  322  IPDFMDPTLCYLPN-gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDN-SSLVYQ  492
            + DFMDP +CYLPN    YYYGGYDGTG+EWE    Y+NA+GV++  GVYGDN SSLVY 
Sbjct  62   LQDFMDPAMCYLPNGYPSYYYGGYDGTGSEWE----YLNADGVDLTSGVYGDNGSSLVYH  117

Query  493  H  495
            H
Sbjct  118  H  118



>gb|AET04399.2| evolutionarily carboxy-terminal region protein [Medicago truncatula]
Length=670

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 10/121 (8%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS---VDSTHAANGQIQPADRSFSPL  321
            AAVA  ADQ +ELLQ  SL+SQ K+LEIPEP KK +    DS +A NGQI   +RS +P+
Sbjct  2    AAVANPADQAAELLQKFSLESQPKSLEIPEPNKKATGNQYDSGNALNGQIPSYERSVTPV  61

Query  322  IPDFMDPTLCYLPN-gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDN-SSLVYQ  492
            + DFMDP +CYLPN    YYYGGYDGTG+EWE    Y+NA+GV++  GVYGDN SSLVY 
Sbjct  62   LQDFMDPAMCYLPNGYPSYYYGGYDGTGSEWE----YLNADGVDLTSGVYGDNGSSLVYH  117

Query  493  H  495
            H
Sbjct  118  H  118



>gb|EYU39279.1| hypothetical protein MIMGU_mgv1a002515mg [Erythranthe guttata]
Length=665

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 64/92 (70%), Gaps = 5/92 (5%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgt  399
            K  E  + TKK SVDS++ ANG +Q +DRS +PL+PDF DP+  Y PN YP     Y G 
Sbjct  24   KTYENQDATKKPSVDSSNVANG-VQ-SDRSITPLLPDFTDPSTGYHPNSYPSPAYYYSG-  80

Query  400  gNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQ  492
             N+WE YPRY+NA+GV+M PG YGDN S++Y 
Sbjct  81   -NDWEDYPRYMNADGVDMTPGAYGDNGSIMYH  111



>gb|KDO54492.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=708

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 71/103 (69%), Gaps = 12/103 (12%)
 Frame = +1

Query  220  KALEIPEPTKK------VSVDSTHAA-NGQIQPADRSFSPLIPDFMDPTLCYLPN---gy  369
            K+LEI E TKK       SVDS +AA NGQI P++RS +P + DFMDP +CY+PN     
Sbjct  23   KSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSERSGTPFLNDFMDPNMCYVPNGYPST  81

Query  370  pyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
             +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGDN SL+Y H
Sbjct  82   AFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGDNGSLMYHH  124



>ref|XP_010552316.1| PREDICTED: uncharacterized protein LOC104822698 isoform X4 [Tarenaya 
hassleriana]
Length=677

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 5/118 (4%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLI  324
            A +AP ADQ ++LLQ LSLDSQ KALEIPEPTK  +V    A  +NGQ+   DRS +PL+
Sbjct  2    ATIAPPADQATDLLQKLSLDSQAKALEIPEPTKNTAVYQYAAVDSNGQVPSYDRSLTPLL  61

Query  325  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM--PGVYGDNSSLVY  489
            P D +DP++CY+PN Y  YY G  G G+EW  Y  Y N +GV+M  PG+YG+N S+VY
Sbjct  62   PSDALDPSVCYVPNAYQPYYFGGYGNGHEWGEYTGYTNPDGVDMTSPGIYGENGSVVY  119



>ref|XP_010552315.1| PREDICTED: uncharacterized protein LOC104822698 isoform X3 [Tarenaya 
hassleriana]
Length=678

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 5/118 (4%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLI  324
            A +AP ADQ ++LLQ LSLDSQ KALEIPEPTK  +V    A  +NGQ+   DRS +PL+
Sbjct  2    ATIAPPADQATDLLQKLSLDSQAKALEIPEPTKNTAVYQYAAVDSNGQVPSYDRSLTPLL  61

Query  325  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM--PGVYGDNSSLVY  489
            P D +DP++CY+PN Y  YY G  G G+EW  Y  Y N +GV+M  PG+YG+N S+VY
Sbjct  62   PSDALDPSVCYVPNAYQPYYFGGYGNGHEWGEYTGYTNPDGVDMTSPGIYGENGSVVY  119



>ref|XP_008451001.1| PREDICTED: uncharacterized protein LOC103492414 isoform X1 [Cucumis 
melo]
Length=704

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 72/97 (74%), Gaps = 9/97 (9%)
 Frame = +1

Query  220  KALEIPEPTKKVS------VDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgy-pyy  378
            K +EIPEPTKK S      +DS +AA  QI P +RS +P + +FMDP++CYLPNGY  YY
Sbjct  27   KPVEIPEPTKKQSANQYGSIDSGNAAISQI-PNERSVTPFLQEFMDPSMCYLPNGYPSYY  85

Query  379  yggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLV  486
            YGG+DGT N+W+ Y RY N++GVEM  GVYGDN SL+
Sbjct  86   YGGFDGTANDWDDYSRYTNSDGVEMTSGVYGDNGSLM  122



>ref|XP_008451002.1| PREDICTED: uncharacterized protein LOC103492414 isoform X2 [Cucumis 
melo]
Length=703

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 72/97 (74%), Gaps = 9/97 (9%)
 Frame = +1

Query  220  KALEIPEPTKKVS------VDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgy-pyy  378
            K +EIPEPTKK S      +DS +AA  QI P +RS +P + +FMDP++CYLPNGY  YY
Sbjct  27   KPVEIPEPTKKQSANQYGSIDSGNAAISQI-PNERSVTPFLQEFMDPSMCYLPNGYPSYY  85

Query  379  yggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLV  486
            YGG+DGT N+W+ Y RY N++GVEM  GVYGDN SL+
Sbjct  86   YGGFDGTANDWDDYSRYTNSDGVEMTSGVYGDNGSLM  122



>ref|XP_004144062.1| PREDICTED: uncharacterized protein LOC101215929 [Cucumis sativus]
 ref|XP_004159352.1| PREDICTED: uncharacterized LOC101215929 [Cucumis sativus]
Length=704

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 72/97 (74%), Gaps = 9/97 (9%)
 Frame = +1

Query  220  KALEIPEPTKKVS------VDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgy-pyy  378
            K +EIPEPTKK S      +DS +AA  QI P +RS +P + +FMDP++CYLPNGY  YY
Sbjct  27   KPVEIPEPTKKQSANQYGSIDSGNAAISQI-PNERSVTPFLQEFMDPSMCYLPNGYPSYY  85

Query  379  yggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLV  486
            YGG+DGT N+W+ Y RY N++GVEM  GVYGDN SL+
Sbjct  86   YGGFDGTANDWDDYSRYTNSDGVEMTSGVYGDNGSLM  122



>ref|XP_010552314.1| PREDICTED: uncharacterized protein LOC104822698 isoform X2 [Tarenaya 
hassleriana]
Length=678

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 83/119 (70%), Gaps = 6/119 (5%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAA---NGQIQPADRSFSPL  321
            A +AP ADQ ++LLQ LSLDSQ KALEIPEPTK  +    +AA   NGQ+   DRS +PL
Sbjct  2    ATIAPPADQATDLLQKLSLDSQAKALEIPEPTKNQTAVYQYAAVDSNGQVPSYDRSLTPL  61

Query  322  IP-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM--PGVYGDNSSLVY  489
            +P D +DP++CY+PN Y  YY G  G G+EW  Y  Y N +GV+M  PG+YG+N S+VY
Sbjct  62   LPSDALDPSVCYVPNAYQPYYFGGYGNGHEWGEYTGYTNPDGVDMTSPGIYGENGSVVY  120



>ref|XP_010552313.1| PREDICTED: uncharacterized protein LOC104822698 isoform X1 [Tarenaya 
hassleriana]
Length=679

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 83/119 (70%), Gaps = 6/119 (5%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAA---NGQIQPADRSFSPL  321
            A +AP ADQ ++LLQ LSLDSQ KALEIPEPTK  +    +AA   NGQ+   DRS +PL
Sbjct  2    ATIAPPADQATDLLQKLSLDSQAKALEIPEPTKNQTAVYQYAAVDSNGQVPSYDRSLTPL  61

Query  322  IP-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM--PGVYGDNSSLVY  489
            +P D +DP++CY+PN Y  YY G  G G+EW  Y  Y N +GV+M  PG+YG+N S+VY
Sbjct  62   LPSDALDPSVCYVPNAYQPYYFGGYGNGHEWGEYTGYTNPDGVDMTSPGIYGENGSVVY  120



>gb|KDO54490.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=710

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 90/128 (70%), Gaps = 13/128 (10%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAA-NGQIQPAD  303
            MA  VAP A +TS+LLQ LSLDSQTK+LEI E TKK       SVDS +AA NGQI P++
Sbjct  1    MATTVAP-AVETSDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQI-PSE  58

Query  304  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEMPGV-YGD  471
            RS +P + DFMDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  V YGD
Sbjct  59   RSGTPFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSVMYGD  118

Query  472  NSSLVYQH  495
            N SL+Y H
Sbjct  119  NGSLMYHH  126



>ref|XP_008779460.1| PREDICTED: YTH domain-containing family protein 1-like isoform 
X1 [Phoenix dactylifera]
Length=700

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 88/121 (73%), Gaps = 10/121 (8%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQ----PADRSFSP  318
            AAVAPTADQ ++LLQ LS+DSQ K  +  E TKK S      ANG++     P++RS +P
Sbjct  2    AAVAPTADQAADLLQKLSMDSQAKTNDAVEATKKPSAIQFGPANGEVPNMLIPSERSLTP  61

Query  319  LIPDFMDPTLCYLPNgypyyyggydgtgNEW-EGYPRYVNAEGVEM-PGVYGDNSSLVYQ  492
            L+PDFMDP++CYLPNGYPYYYGG+DG+ NEW + Y RY+N +GVEM PG YGD    +Y 
Sbjct  62   LLPDFMDPSMCYLPNGYPYYYGGFDGSVNEWGDDYSRYLNHDGVEMPPGFYGD----MYH  117

Query  493  H  495
            H
Sbjct  118  H  118



>gb|EYU32828.1| hypothetical protein MIMGU_mgv1a002229mg [Erythranthe guttata]
 gb|EYU32829.1| hypothetical protein MIMGU_mgv1a002229mg [Erythranthe guttata]
Length=698

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  330
            A VAP ADQ ++++Q LSLDSQ K  + P+ T+K SVDS +AANG IQ +DRS +P++ D
Sbjct  2    ATVAPPADQAADIMQKLSLDSQAKTFDAPDATRKPSVDSNNAANGGIQ-SDRSVTPVLTD  60

Query  331  FMDPTLCYLPNgypyy---yggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            F DP++ Y+ + YP      GGY+G+ NEWE Y +Y++ +G EM PG+YGDN SL+Y H
Sbjct  61   FTDPSMYYVQSSYPSAYYYAGGYEGSVNEWEDYAKYMSQDGAEMTPGIYGDN-SLMYHH  118



>gb|KCW87046.1| hypothetical protein EUGRSUZ_B03591 [Eucalyptus grandis]
Length=744

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 83/129 (64%), Gaps = 16/129 (12%)
 Frame = +1

Query  133  IDRAMAAAVAP-TAdqtsellqslsldsqtKALEIPEPTKKVSVD------STHAANGQI  291
            I R + A VAP +A+QT++LLQ LSLD+Q K LEIPEPTKK S +      +  AANGQI
Sbjct  58   IHRRIMATVAPASANQTADLLQKLSLDAQPKTLEIPEPTKKTSANRLGSVINGKAANGQI  117

Query  292  QPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYG  468
            QP + S +P +P+F +P +C++P GY            EW+ + RY N EGV++  G YG
Sbjct  118  QPYEPSVTPSLPEF-EPPMCFVPTGYEGTGA-------EWDDFSRYTNTEGVDVASGFYG  169

Query  469  DNSSLVYQH  495
            +N SL+Y H
Sbjct  170  ENGSLMYHH  178



>ref|XP_008812836.1| PREDICTED: YTH domain-containing family protein 2-like [Phoenix 
dactylifera]
Length=702

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 88/122 (72%), Gaps = 11/122 (9%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQP-----ADRSFS  315
            AAVAP +DQ ++LLQ LSLDSQ K  +  E TKK S     +ANG   P     ++RS +
Sbjct  2    AAVAPASDQAADLLQKLSLDSQAKNHDAVEATKKPSAVQFGSANGGEVPNVPIPSERSLT  61

Query  316  PLIPDFMDPTLCYLPNgypyyyggydgtgNEW-EGYPRYVNAEGVEM-PGVYGDNSSLVY  489
            P++PDFMDP++CYLP+GYPYYYGGYDG+ NEW + YPRYVN +GVEM PGVYGD    +Y
Sbjct  62   PILPDFMDPSMCYLPSGYPYYYGGYDGSVNEWGDDYPRYVNHDGVEMPPGVYGD----MY  117

Query  490  QH  495
             H
Sbjct  118  HH  119



>ref|XP_010932747.1| PREDICTED: YTH domain-containing family protein 1-like [Elaeis 
guineensis]
Length=701

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 88/123 (72%), Gaps = 13/123 (11%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK---VSVDSTHAA---NGQIQPADRSF  312
            AAVAP +DQ ++LLQ LSLDSQ K  +  E TKK   +   S H     N  I P++RS 
Sbjct  2    AAVAPASDQAADLLQKLSLDSQAKTHDAVEATKKPPAIQFGSAHGGEVPNVSI-PSERSL  60

Query  313  SPLIPDFMDPTLCYLPNgypyyyggydgtgNEW-EGYPRYVNAEGVEM-PGVYGDNSSLV  486
            +P++PDFMDP++CYLP+GYPYYYGGYDG+ NEW + YPRYVN +GVEM PGVYGD    +
Sbjct  61   TPVLPDFMDPSMCYLPSGYPYYYGGYDGSVNEWGDDYPRYVNHDGVEMPPGVYGD----M  116

Query  487  YQH  495
            Y H
Sbjct  117  YHH  119



>ref|XP_010917720.1| PREDICTED: uncharacterized protein LOC105042282 [Elaeis guineensis]
Length=695

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 84/120 (70%), Gaps = 10/120 (8%)
 Frame = +1

Query  154  AVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQ----PADRSFSPL  321
            AVAPT DQ S+LLQ LS+DSQ K     E TKK S     +ANG++     P+ RS +PL
Sbjct  3    AVAPTTDQASDLLQKLSMDSQAKTNGAMEATKKPSAIQFGSANGEVPNMLIPSQRSLTPL  62

Query  322  IPDFMDPTLCYLPNgypyyyggydgtgNEW-EGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            +PDFMDP++CY PNGYP+YYGG+DG+ NEW + Y RY+N +GVEM PG YGD    +Y H
Sbjct  63   LPDFMDPSMCYFPNGYPFYYGGFDGSVNEWGDDYSRYLNQDGVEMPPGFYGD----MYHH  118



>gb|KCW87047.1| hypothetical protein EUGRSUZ_B03591 [Eucalyptus grandis]
Length=764

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 94/141 (67%), Gaps = 20/141 (14%)
 Frame = +1

Query  133  IDRAMAAAVAP-TAdqtsellqslsldsqtKALEIPEPTKKVSVD------STHAANGQI  291
            I R + A VAP +A+QT++LLQ LSLD+Q K LEIPEPTKK S +      +  AANGQI
Sbjct  58   IHRRIMATVAPASANQTADLLQKLSLDAQPKTLEIPEPTKKTSANRLGSVINGKAANGQI  117

Query  292  QPADRSFSPLIPDFM---------DPTLCYLPNg---ypyyyggydgtgNEWEGYPRYVN  435
            QP + S +P +P+F          +PT+C++P G   + YY+GGY+GTG EW+ + RY N
Sbjct  118  QPYEPSVTPSLPEFEPPMCFVPTGEPTMCFVPTGYPPHAYYHGGYEGTGAEWDDFSRYTN  177

Query  436  AEGVEM-PGVYGDNSSLVYQH  495
             EGV++  G YG+N SL+Y H
Sbjct  178  TEGVDVASGFYGENGSLMYHH  198



>ref|XP_006826301.1| hypothetical protein AMTR_s00004p00073360 [Amborella trichopoda]
 gb|ERM93538.1| hypothetical protein AMTR_s00004p00073360 [Amborella trichopoda]
Length=692

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 77/119 (65%), Gaps = 11/119 (9%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKK------VSVDSTHAANGQIQPADR  306
            MAA VAP ADQ +ELLQ LSL+SQ K  E+ E TKK       SVD+    N QI  +DR
Sbjct  1    MAAVVAP-ADQATELLQKLSLESQGKPKEVSEATKKPSSVQYGSVDARDITNVQIPSSDR  59

Query  307  SFSPLIPDFMDPTLCYLPNgypyyyggydgtg--NEWEGYPRYVNAEGVEM--PGVYGD  471
            S +P++ +FMDP +CYLPNGY   Y         +EWE YPRYV+ +GV+M  PGVYGD
Sbjct  60   STTPVLQEFMDPNMCYLPNGYASSYYYGSYEVPISEWEDYPRYVHPDGVDMPPPGVYGD  118



>ref|XP_006407213.1| hypothetical protein EUTSA_v10020224mg [Eutrema salsugineum]
 gb|ESQ48666.1| hypothetical protein EUTSA_v10020224mg [Eutrema salsugineum]
Length=648

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 80/117 (68%), Gaps = 4/117 (3%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  324
            A VAP ADQ +++LQ L+LDSQ KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQATDMLQKLTLDSQAKASEIPEPNKKTAVYQYGGVDTHGQVPSFDRSLTPIL  61

Query  325  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
            P D +DP++CY+PN Y  YY G  G+G+EW  Y  Y N EGV+M  G+YG+N SL+Y
Sbjct  62   PSDAVDPSVCYVPNAYQPYYYGGYGSGHEWSDYTGYPNPEGVDMNSGIYGENGSLMY  118



>ref|XP_006297132.1| hypothetical protein CARUB_v10013133mg [Capsella rubella]
 gb|EOA30030.1| hypothetical protein CARUB_v10013133mg [Capsella rubella]
Length=671

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 79/119 (66%), Gaps = 6/119 (5%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLI  324
            A VAP ADQ ++LLQ LSLDSQ KA EIPEP KK +V       A+GQ+   DRS +PL+
Sbjct  2    ATVAPPADQAADLLQKLSLDSQAKASEIPEPNKKTAVYQYGGVDAHGQVPSYDRSLTPLL  61

Query  325  P-DFMDPTLCYLPNgyp--yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
            P D  DP++CYLPN Y   YY     G+G EW  Y  Y N+EGV+M  G+YG+N ++VY
Sbjct  62   PSDAADPSVCYLPNPYTPYYYNVSAYGSGQEWTDYAAYTNSEGVDMNSGIYGENGTVVY  120



>ref|XP_011048156.1| PREDICTED: uncharacterized protein LOC105142292 isoform X1 [Populus 
euphratica]
Length=614

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 56/92 (61%), Gaps = 15/92 (16%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgt  399
            K LE+PEPT K            IQP+DRS +P++ +FMDPT+CYLPNGYP YY G    
Sbjct  25   KTLEMPEPTNK------------IQPSDRSVTPVLSNFMDPTVCYLPNGYPSYYYGGYNG  72

Query  400  gNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQH  495
              EW+ Y +Y+N EGV+M      N S +Y H
Sbjct  73   TGEWDDYSKYLNTEGVDMT---SGNGSAMYPH  101



>ref|XP_010487108.1| PREDICTED: uncharacterized protein LOC104765132 isoform X3 [Camelina 
sativa]
Length=671

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 4/117 (3%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  324
            A VAP ADQ ++LLQ LSLDSQ KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQAADLLQKLSLDSQAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  325  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
            P D  DP++CYLP  Y  YY    G+G EW  Y  Y N EGV+M  G+YG+N ++VY
Sbjct  62   PSDAADPSVCYLPTPYTPYYYNAYGSGQEWTDYAAYTNPEGVDMNSGIYGENGTVVY  118



>ref|XP_010500586.1| PREDICTED: uncharacterized protein LOC104777950 isoform X2 [Camelina 
sativa]
Length=672

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 4/117 (3%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  324
            A VAP ADQ ++LLQ LSLDSQ KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQAADLLQKLSLDSQAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  325  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
            P D  DP++CYLP  Y  YY    G+G EW  Y  Y N EGV+M  G+YG+N ++VY
Sbjct  62   PSDAADPSVCYLPTPYTPYYYNAYGSGQEWTDYAAYTNPEGVDMNSGIYGENGTVVY  118



>ref|XP_010465188.1| PREDICTED: uncharacterized protein LOC104745597 [Camelina sativa]
Length=672

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 4/117 (3%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  324
            A VAP ADQ ++LLQ LSLDSQ KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQAADLLQKLSLDSQAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  325  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
            P D  DP++CYLP  Y  YY    G+G EW  Y  Y N EGV+M  G+YG+N ++VY
Sbjct  62   PSDAADPSVCYLPTPYTPYYYNAYGSGQEWTDYSAYTNPEGVDMNSGIYGENGTVVY  118



>ref|XP_002299095.2| hypothetical protein POPTR_0001s039401g, partial [Populus trichocarpa]
 gb|EEE83900.2| hypothetical protein POPTR_0001s039401g, partial [Populus trichocarpa]
Length=549

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 56/92 (61%), Gaps = 15/92 (16%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgt  399
            K L++PEPT K            IQP+DRS +P++ +FMDPT+CYLPNGYP YY G    
Sbjct  25   KTLDMPEPTNK------------IQPSDRSVTPVLSNFMDPTVCYLPNGYPSYYYGGYNG  72

Query  400  gNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQH  495
              EW+ Y +Y+N EGV+M      N S +Y H
Sbjct  73   TGEWDDYSKYLNTEGVDMT---SGNGSAMYPH  101



>ref|XP_010044924.1| PREDICTED: uncharacterized protein LOC104433761 [Eucalyptus grandis]
Length=702

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 71/111 (64%), Gaps = 19/111 (17%)
 Frame = +1

Query  220  KALEIPEPTKKVSVD------STHAANGQIQPADRSFSPLIPDFM---------DPTLCY  354
            K LEIPEPTKK S +      +  AANGQIQP + S +P +P+F          +PT+C+
Sbjct  26   KTLEIPEPTKKTSANRLGSVINGKAANGQIQPYEPSVTPSLPEFEPPMCFVPTGEPTMCF  85

Query  355  LPNg---ypyyyggydgtgNEWEGYPRYVNAEGVEMP-GVYGDNSSLVYQH  495
            +P G   + YY+GGY+GTG EW+ + RY N EGV++  G YG+N SL+Y H
Sbjct  86   VPTGYPPHAYYHGGYEGTGAEWDDFSRYTNTEGVDVASGFYGENGSLMYHH  136



>gb|ABK96645.1| unknown [Populus trichocarpa x Populus deltoides]
Length=615

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 56/92 (61%), Gaps = 15/92 (16%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgt  399
            K L++PEPT K            IQP+DRS +P++ +FMDPT+CYLPNGYP YY G    
Sbjct  25   KTLDMPEPTNK------------IQPSDRSVTPVLSNFMDPTVCYLPNGYPSYYYGGYNG  72

Query  400  gNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQH  495
              EW+ Y +Y+N EGV+M      N S +Y H
Sbjct  73   TGEWDDYSKYLNTEGVDMT---SGNGSAMYPH  101



>ref|XP_006407214.1| hypothetical protein EUTSA_v10020224mg [Eutrema salsugineum]
 gb|ESQ48667.1| hypothetical protein EUTSA_v10020224mg [Eutrema salsugineum]
Length=666

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 62/94 (66%), Gaps = 4/94 (4%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggy  390
            KA EIPEP KK +V      +  GQ+   DRS +P++P D +DP++CY+PN Y  YY G 
Sbjct  24   KASEIPEPNKKTAVYQYGGVDTHGQVPSFDRSLTPILPSDAVDPSVCYVPNAYQPYYYGG  83

Query  391  dgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
             G+G+EW  Y  Y N EGV+M  G+YG+N SL+Y
Sbjct  84   YGSGHEWSDYTGYPNPEGVDMNSGIYGENGSLMY  117



>emb|CAN81999.1| hypothetical protein VITISV_031582 [Vitis vinifera]
Length=147

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 50/68 (74%), Gaps = 2/68 (3%)
 Frame = +1

Query  298  ADRSFSPLIPDFMDPTLCYLPNgypyyyggyd-gtgNEWEGYPRYVNAEGVEMP-GVYGD  471
             +R  +PL+ +FMDP++CY+PNGY  YY G   GT NEWE Y RY+N EGVE+P GVYGD
Sbjct  51   CERFVTPLLQEFMDPSVCYVPNGYSSYYYGGYDGTTNEWEDYSRYMNLEGVEIPVGVYGD  110

Query  472  NSSLVYQH  495
            N S +Y H
Sbjct  111  NGSFMYHH  118



>ref|NP_001030689.1| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
 gb|AEE75360.1| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
Length=508

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 77/118 (65%), Gaps = 5/118 (4%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  324
            A VAP ADQ ++LLQ LSLDS  KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQATDLLQKLSLDSPAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  325  P-DFMDPTLCYLPNgyp-yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
            P D  DP++CY+PN Y  Y Y    G+G EW  YP Y N EGV+M  G+YG+N ++VY
Sbjct  62   PSDAADPSVCYVPNPYNPYQYYNVYGSGQEWTDYPAYTNPEGVDMNSGIYGENGTVVY  119



>gb|AAN72190.1| Unknown protein [Arabidopsis thaliana]
 dbj|BAE99285.1| hypothetical protein [Arabidopsis thaliana]
Length=667

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 77/118 (65%), Gaps = 5/118 (4%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  324
            A VAP ADQ ++LLQ LSLDS  KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQATDLLQKLSLDSPAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  325  P-DFMDPTLCYLPNgyp-yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
            P D  DP++CY+PN Y  Y Y    G+G EW  YP Y N EGV+M  G+YG+N ++VY
Sbjct  62   PSDAADPSVCYVPNPYNPYQYYNVYGSGQEWTDYPAYTNPEGVDMNSGIYGENGTVVY  119



>ref|NP_187955.2| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
 dbj|BAB01753.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM74503.1| AT3g13460/MRP15_10 [Arabidopsis thaliana]
 gb|AEE75358.1| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
Length=667

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 77/118 (65%), Gaps = 5/118 (4%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  324
            A VAP ADQ ++LLQ LSLDS  KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQATDLLQKLSLDSPAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  325  P-DFMDPTLCYLPNgyp-yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
            P D  DP++CY+PN Y  Y Y    G+G EW  YP Y N EGV+M  G+YG+N ++VY
Sbjct  62   PSDAADPSVCYVPNPYNPYQYYNVYGSGQEWTDYPAYTNPEGVDMNSGIYGENGTVVY  119



>ref|XP_010044923.1| PREDICTED: uncharacterized protein LOC104433760 [Eucalyptus grandis]
 gb|KCW87045.1| hypothetical protein EUGRSUZ_B03590 [Eucalyptus grandis]
Length=690

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 85/121 (70%), Gaps = 14/121 (12%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTK-----KVSVDSTHAANGQIQPADRSFS  315
            AAVAP+ADQ ++L+Q LSLD+Q+K LE+PE  K       SVD  +AANGQIQ  D + +
Sbjct  2    AAVAPSADQPTDLMQKLSLDAQSKTLEMPEVAKMSSNQNGSVDGVNAANGQIQSYDGAVT  61

Query  316  PLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAE-GVEM-PGVYGDNSSLVY  489
                   +PT+C++PN YPYYYGGYDGTG +W+ +PRY N E GV+M  G YGDN SL+Y
Sbjct  62   -------EPTVCFVPNSYPYYYGGYDGTGGDWDNFPRYANVEGGVDMSSGFYGDNGSLMY  114

Query  490  Q  492
             
Sbjct  115  H  115



>ref|XP_010487109.1| PREDICTED: uncharacterized protein LOC104765132 isoform X4 [Camelina 
sativa]
Length=670

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 58/94 (62%), Gaps = 4/94 (4%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggy  390
            KA EIPEP KK +V      +  GQ+   DRS +P++P D  DP++CYLP  Y  YY   
Sbjct  24   KASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPMLPSDAADPSVCYLPTPYTPYYYNA  83

Query  391  dgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
             G+G EW  Y  Y N EGV+M  G+YG+N ++VY
Sbjct  84   YGSGQEWTDYAAYTNPEGVDMNSGIYGENGTVVY  117



>ref|NP_850578.1| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
 gb|AEE75359.1| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
Length=664

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 5/95 (5%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgyp-yyygg  387
            KA EIPEP KK +V      +  GQ+   DRS +P++P D  DP++CY+PN Y  Y Y  
Sbjct  22   KASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPMLPSDAADPSVCYVPNPYNPYQYYN  81

Query  388  ydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
              G+G EW  YP Y N EGV+M  G+YG+N ++VY
Sbjct  82   VYGSGQEWTDYPAYTNPEGVDMNSGIYGENGTVVY  116



>ref|NP_001030690.1| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
 gb|AEE75361.1| CIPK1 interacting protein ECT2 [Arabidopsis thaliana]
Length=666

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 5/95 (5%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgyp-yyygg  387
            KA EIPEP KK +V      +  GQ+   DRS +P++P D  DP++CY+PN Y  Y Y  
Sbjct  24   KASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPMLPSDAADPSVCYVPNPYNPYQYYN  83

Query  388  ydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
              G+G EW  YP Y N EGV+M  G+YG+N ++VY
Sbjct  84   VYGSGQEWTDYPAYTNPEGVDMNSGIYGENGTVVY  118



>ref|XP_011048157.1| PREDICTED: uncharacterized protein LOC105142292 isoform X2 [Populus 
euphratica]
Length=612

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 54/92 (59%), Gaps = 17/92 (18%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgypyyyggydgt  399
            K LE+PEPT K              P+DRS +P++ +FMDPT+CYLPNGYP YY G    
Sbjct  25   KTLEMPEPTNK--------------PSDRSVTPVLSNFMDPTVCYLPNGYPSYYYGGYNG  70

Query  400  gNEWEGYPRYVNAEGVEMPGVYGDNSSLVYQH  495
              EW+ Y +Y+N EGV+M      N S +Y H
Sbjct  71   TGEWDDYSKYLNTEGVDMT---SGNGSAMYPH  99



>ref|XP_010500580.1| PREDICTED: uncharacterized protein LOC104777950 isoform X1 [Camelina 
sativa]
Length=675

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 75/120 (63%), Gaps = 7/120 (6%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  324
            A VAP ADQ ++LLQ LSLDSQ KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQAADLLQKLSLDSQAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  325  P-DFMDPTLCYLPNgyp---yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
            P D  DP++CYLP  Y    Y      G+G EW  Y  Y N EGV+M  G+YG+N ++VY
Sbjct  62   PSDAADPSVCYLPTPYTPYYYNVSSAYGSGQEWTDYAAYTNPEGVDMNSGIYGENGTVVY  121



>ref|XP_010487106.1| PREDICTED: uncharacterized protein LOC104765132 isoform X1 [Camelina 
sativa]
Length=674

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 75/120 (63%), Gaps = 7/120 (6%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  324
            A VAP ADQ ++LLQ LSLDSQ KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQAADLLQKLSLDSQAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  325  P-DFMDPTLCYLPNgyp---yyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
            P D  DP++CYLP  Y    Y      G+G EW  Y  Y N EGV+M  G+YG+N ++VY
Sbjct  62   PSDAADPSVCYLPTPYTPYYYNVSSAYGSGQEWTDYAAYTNPEGVDMNSGIYGENGTVVY  121



>ref|XP_009146490.1| PREDICTED: uncharacterized protein LOC103870130 [Brassica rapa]
Length=644

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 56/94 (60%), Gaps = 5/94 (5%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggy  390
            KA EIPEP KK +V       ++GQ+   DRS +PL+P D +DP++CY+PN     +   
Sbjct  22   KASEIPEPNKKTAVYQYGGVDSHGQVPTYDRSLTPLLPSDAVDPSVCYVPN-AYPQFYYG  80

Query  391  dgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
                 +W  Y  Y N EGV+M  G+YG+N S+VY
Sbjct  81   GYGNGDWSEYTGYQNPEGVDMSSGIYGENGSIVY  114



>emb|CDY43989.1| BnaA05g25840D [Brassica napus]
Length=634

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 56/94 (60%), Gaps = 5/94 (5%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggy  390
            KA EIPEP KK +V       ++GQ+   DRS +PL+P D +DP++CY+PN     +   
Sbjct  12   KASEIPEPNKKTAVYQYGGVDSHGQVPTYDRSLTPLLPSDAVDPSVCYVPN-AYPQFYYG  70

Query  391  dgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
                 +W  Y  Y N EGV+M  G+YG+N S+VY
Sbjct  71   GYGNGDWSEYTGYQNPEGVDMSSGIYGENGSIVY  104



>emb|CDY23602.1| BnaC05g39920D [Brassica napus]
Length=624

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 5/94 (5%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggy  390
            KA EIPEP KK +V       ++GQ+   DRS +PL+P D +DP++CY+PN    ++   
Sbjct  12   KASEIPEPNKKTAVYQYGGVDSHGQVPTYDRSLTPLLPTDAVDPSVCYVPN-AYPHFYYG  70

Query  391  dgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
                 +W  Y  Y N EGV+M  G+YG+N S+VY
Sbjct  71   GYGNGDWSEYTGYQNPEGVDMSSGIYGENGSIVY  104



>ref|XP_010542475.1| PREDICTED: uncharacterized protein LOC104815674 [Tarenaya hassleriana]
Length=683

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 65/98 (66%), Gaps = 6/98 (6%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggy  390
            K LEI EP+KK +V    A  +NGQ+   DRS +PL+P D +DP++C++P+GY  YY G 
Sbjct  25   KTLEISEPSKKTAVYKYGAVDSNGQLSSFDRSLTPLLPSDALDPSVCFVPSGYQPYYFGG  84

Query  391  dgtgNEWE--GYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
             G G++W    Y  Y N +GV++  G+YG+N S+VYQ 
Sbjct  85   YGNGHDWTEYEYTGYANPDGVDVTSGIYGENGSIVYQQ  122



>ref|XP_010534849.1| PREDICTED: uncharacterized protein LOC104810317 [Tarenaya hassleriana]
Length=678

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 78/117 (67%), Gaps = 4/117 (3%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLI  324
            A VAP ADQ ++LLQ LSL+ Q K+L+IPEP KK +V       +NGQ    DRS +PL+
Sbjct  2    ATVAPPADQATDLLQKLSLNPQPKSLDIPEPIKKTAVYHYGVVDSNGQPPSFDRSLTPLL  61

Query  325  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEMP-GVYGDNSSLVY  489
            P D +DP++C++PNGY  YY G  G G EW     Y N +GV++  G+YG+N SLVY
Sbjct  62   PSDALDPSVCFIPNGYQPYYFGGYGNGLEWNESTGYTNPDGVDLSSGIYGENGSLVY  118



>ref|NP_001185240.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE33254.1| uncharacterized protein AT1G55500 [Arabidopsis thaliana]
Length=599

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 76/117 (65%), Gaps = 9/117 (8%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLI  324
            + VAP ADQ +++L+ LSLDS+++ LEIPEPTKK  V    A  +NGQ+   DRS SP++
Sbjct  2    STVAPPADQAADVLKKLSLDSKSRTLEIPEPTKKTGVYQYGAMDSNGQVPSFDRSLSPML  61

Query  325  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
            P D +DP++ Y+PN Y   Y    G+      Y  Y N+E V+M  G YG+N+SLVY
Sbjct  62   PSDALDPSVFYVPNVYQQPYYYGYGSD-----YTGYTNSESVDMTSGAYGENASLVY  113



>ref|XP_002884968.1| hypothetical protein ARALYDRAFT_478733 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61227.1| hypothetical protein ARALYDRAFT_478733 [Arabidopsis lyrata subsp. 
lyrata]
Length=677

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  324
            A VAP ADQ ++LLQ LSLDSQ KA EIPEP KK +V      +  GQ+   DRS +P+I
Sbjct  2    ATVAPPADQAADLLQKLSLDSQAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPMI  61

Query  325  P-DFMDPTLCYLPN-gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
            P D  DP++CY+P    PY Y    G+G +W  Y  Y N EGV+M  G+YG+N ++VY
Sbjct  62   PSDAADPSVCYVPTPYNPYQYYNAYGSGQDWTDYAAYTNPEGVDMNSGIYGENGTVVY  119



>ref|XP_010487107.1| PREDICTED: uncharacterized protein LOC104765132 isoform X2 [Camelina 
sativa]
Length=673

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 57/97 (59%), Gaps = 7/97 (7%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgyp---yyy  381
            KA EIPEP KK +V      +  GQ+   DRS +P++P D  DP++CYLP  Y    Y  
Sbjct  24   KASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPMLPSDAADPSVCYLPTPYTPYYYNV  83

Query  382  ggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
                G+G EW  Y  Y N EGV+M  G+YG+N ++VY
Sbjct  84   SSAYGSGQEWTDYAAYTNPEGVDMNSGIYGENGTVVY  120



>ref|XP_010653842.1| PREDICTED: uncharacterized protein LOC100245287 isoform X1 [Vitis 
vinifera]
 emb|CBI29937.3| unnamed protein product [Vitis vinifera]
Length=694

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 74/120 (62%), Gaps = 17/120 (14%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK-VSVDSTHAANGQIQPADRSFSPLIP  327
            A VAP +DQ ++LLQ LSLD Q K+LE+ E  KK VSVDS   ANG  +P +RS + L  
Sbjct  2    ATVAPPSDQAADLLQKLSLDPQAKSLEVSEQAKKFVSVDSGDLANGLGKPFERSATHLHQ  61

Query  328  DFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            DF+DP +CYLPN      Y+  GYDG  NEW         +GVEM PGVYGD    +Y H
Sbjct  62   DFVDPNMCYLPNGYPSTYYFAPGYDGQMNEW--------GDGVEMPPGVYGD----IYHH  109



>ref|XP_010653843.1| PREDICTED: uncharacterized protein LOC100245287 isoform X2 [Vitis 
vinifera]
Length=690

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 74/120 (62%), Gaps = 17/120 (14%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKK-VSVDSTHAANGQIQPADRSFSPLIP  327
            A VAP +DQ ++LLQ LSLD Q K+LE+ E  KK VSVDS   ANG  +P +RS + L  
Sbjct  2    ATVAPPSDQAADLLQKLSLDPQAKSLEVSEQAKKFVSVDSGDLANGLGKPFERSATHLHQ  61

Query  328  DFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            DF+DP +CYLPN      Y+  GYDG  NEW         +GVEM PGVYGD    +Y H
Sbjct  62   DFVDPNMCYLPNGYPSTYYFAPGYDGQMNEW--------GDGVEMPPGVYGD----IYHH  109



>ref|XP_010910310.1| PREDICTED: YTH domain-containing family protein 2-like [Elaeis 
guineensis]
Length=692

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 61/103 (59%), Gaps = 15/103 (15%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAANGQIQPA------DRSFSPLIPDFMDPTLCYLPN---gyp  372
            K  + PE TKK S      A+G + P+      +RS +PL+ + MD ++CYLPN      
Sbjct  25   KTHDSPEVTKKPSGIQHAPADGAVVPSAPVPPQERSVTPLLQEVMDASMCYLPNGYPSTT  84

Query  373  yyyggydgtgNEWEGYPRYVNAEGVEM--PGVYGDNSSLVYQH  495
            YYYGGYDG  NEWE + RY N +GVEM  PGVYGD    +Y H
Sbjct  85   YYYGGYDGAMNEWEDFARYANPDGVEMPPPGVYGD----LYHH  123



>emb|CAN81896.1| hypothetical protein VITISV_009052 [Vitis vinifera]
Length=696

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 57/97 (59%), Gaps = 17/97 (18%)
 Frame = +1

Query  220  KALEIPEPTKK-VSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPN---gypyyygg  387
            K+LE+ E  KK VSVDS   ANG  +P +RS + L  DF+DP +CYLPN      Y+  G
Sbjct  80   KSLEVSEQAKKFVSVDSGDLANGLGKPFERSATHLHQDFVDPNMCYLPNGYPSTYYFAPG  139

Query  388  ydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            YDG  NEW         +GVEM PGVYGD    +Y H
Sbjct  140  YDGQMNEW--------GDGVEMPPGVYGD----IYHH  164



>emb|CDY07089.1| BnaCnng01040D [Brassica napus]
Length=636

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 80/121 (66%), Gaps = 7/121 (6%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSP  318
            MA  VA TADQ++++LQ L+LDSQ KA EIPEP KK +V      +  GQ+   DRS +P
Sbjct  1    MATTVAQTADQSADMLQKLTLDSQPKASEIPEP-KKAAVYQYGGVDVHGQVPSYDRSLTP  59

Query  319  LIP-DFMDPTLCYLPNgypy-yyggydgtgNEWEGYPRYV-NAEGVEMP-GVYGDNSSLV  486
            L+P D  DP++CY+PN Y   +Y GY  +G +W  +  Y  + EGV+M  GVYG+N SLV
Sbjct  60   LLPSDAADPSVCYVPNAYQQPFYYGYGASGQDWSEFTGYNPSLEGVDMSAGVYGENGSLV  119

Query  487  Y  489
            Y
Sbjct  120  Y  120



>ref|XP_004985631.1| PREDICTED: uncharacterized protein LOC101767723 isoform X3 [Setaria 
italica]
Length=696

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P +RS +P++ DFMDP L YLP    YYYGGYDG+ NEW+ YPRY+N +GVE+ P VYGD
Sbjct  75   PPERSITPVLQDFMDPNLFYLP---AYYYGGYDGSMNEWDDYPRYLNQDGVEIAPAVYGD  131



>ref|XP_004985629.1| PREDICTED: uncharacterized protein LOC101767723 isoform X1 [Setaria 
italica]
Length=697

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P +RS +P++ DFMDP L YLP    YYYGGYDG+ NEW+ YPRY+N +GVE+ P VYGD
Sbjct  76   PPERSITPVLQDFMDPNLFYLP---AYYYGGYDGSMNEWDDYPRYLNQDGVEIAPAVYGD  132



>ref|XP_004985632.1| PREDICTED: uncharacterized protein LOC101767723 isoform X4 [Setaria 
italica]
Length=695

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P +RS +P++ DFMDP L YLP    YYYGGYDG+ NEW+ YPRY+N +GVE+ P VYGD
Sbjct  75   PPERSITPVLQDFMDPNLFYLP---AYYYGGYDGSMNEWDDYPRYLNQDGVEIAPAVYGD  131



>ref|XP_004985630.1| PREDICTED: uncharacterized protein LOC101767723 isoform X2 [Setaria 
italica]
Length=696

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P +RS +P++ DFMDP L YLP    YYYGGYDG+ NEW+ YPRY+N +GVE+ P VYGD
Sbjct  76   PPERSITPVLQDFMDPNLFYLP---AYYYGGYDGSMNEWDDYPRYLNQDGVEIAPAVYGD  132



>gb|KGN66348.1| hypothetical protein Csa_1G599420 [Cucumis sativus]
Length=674

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 56/91 (62%), Gaps = 27/91 (30%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgy-pyyyggydg  396
            K +EIPEPTKK                         +FMDP++CYLPNGY  YYYGG+DG
Sbjct  27   KPVEIPEPTKK-------------------------EFMDPSMCYLPNGYPSYYYGGFDG  61

Query  397  tgNEWEGYPRYVNAEGVEM-PGVYGDNSSLV  486
            T N+W+ Y RY N++GVEM  GVYGDN SL+
Sbjct  62   TANDWDDYSRYTNSDGVEMTSGVYGDNGSLM  92



>ref|XP_008451003.1| PREDICTED: uncharacterized protein LOC103492414 isoform X3 [Cucumis 
melo]
Length=674

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 56/91 (62%), Gaps = 27/91 (30%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPDFMDPTLCYLPNgy-pyyyggydg  396
            K +EIPEPTKK                         +FMDP++CYLPNGY  YYYGG+DG
Sbjct  27   KPVEIPEPTKK-------------------------EFMDPSMCYLPNGYPSYYYGGFDG  61

Query  397  tgNEWEGYPRYVNAEGVEM-PGVYGDNSSLV  486
            T N+W+ Y RY N++GVEM  GVYGDN SL+
Sbjct  62   TANDWDDYSRYTNSDGVEMTSGVYGDNGSLM  92



>gb|KFK38676.1| hypothetical protein AALP_AA3G146000 [Arabis alpina]
Length=685

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 60/97 (62%), Gaps = 7/97 (7%)
 Frame = +1

Query  220  KALEIPEPTKKVSVDSTHAA--NGQIQPADRSFSPLIP-DFMDPTLCYLP--Ngypyyyg  384
            KA EIPEP KK +V        NGQ+   DRS +P+ P D +DP++CY+P  N YP+YY 
Sbjct  25   KASEIPEPNKKTAVYQYGGVDLNGQVPSYDRSLTPMQPGDVVDPSVCYVPGMNAYPHYYY  84

Query  385  gydgtgNEWEGY-PRYVNAEGVEM-PGVYGDNSSLVY  489
            G  GT  +W  Y   Y N EGV+M   +YG+N S+VY
Sbjct  85   GAYGTSQDWSEYTAAYPNPEGVDMNTAIYGENGSVVY  121



>ref|XP_009124755.1| PREDICTED: uncharacterized protein LOC103849773 [Brassica rapa]
Length=655

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 78/119 (66%), Gaps = 7/119 (6%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  324
            A VA TADQ++++LQ L+LDSQ K  EIPEP KK +V      +  GQ+   DRS +PL+
Sbjct  2    ATVAQTADQSADMLQKLTLDSQPKGSEIPEP-KKAAVYQYGGVDMHGQVPSYDRSLTPLL  60

Query  325  P-DFMDPTLCYLPNgypy-yyggydgtgNEWEGYPRYV-NAEGVEMP-GVYGDNSSLVY  489
            P D  DP++CY+PN Y   +Y GY  +G +W  +  Y  N EGV+M  GVYG+N SLVY
Sbjct  61   PSDAADPSVCYVPNAYQQPFYYGYGASGQDWSEFTGYNPNLEGVDMSAGVYGENGSLVY  119



>gb|AAY44715.1| unknown [Arabidopsis thaliana]
Length=652

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 69/117 (59%), Gaps = 18/117 (15%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLI  324
            A VAP ADQ ++LLQ LSLDS  KA EIPEP KK +V      +  GQ+   DRS +P++
Sbjct  2    ATVAPPADQATDLLQKLSLDSPAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPML  61

Query  325  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVY  489
            P D  DP++               G+G EW  YP Y N EGV+M  G+YG+N ++VY
Sbjct  62   PSDAADPSVY--------------GSGQEWTDYPAYTNPEGVDMNSGIYGENGTVVY  104



>ref|XP_009411291.1| PREDICTED: uncharacterized protein LOC103993077 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=671

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = +1

Query  298  ADRSFSPLIPDFMDPTLCYLPNgypyyy---ggydgtgNEWEGYPRYVNAEGVE-MPGVY  465
            ++RS +PL+PDF+DP++CY+P GY       GGYD   N+W  Y RY N +GVE +PGVY
Sbjct  58   SERSLTPLLPDFVDPSMCYVPGGYASPAYFYGGYDRAVNKWGDYSRYTNNDGVEILPGVY  117

Query  466  GD  471
            GD
Sbjct  118  GD  119



>ref|XP_009408492.1| PREDICTED: uncharacterized protein LOC103990922 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=679

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 8/73 (11%)
 Frame = +1

Query  289  IQPADRSFSPLIPDFMDPTLCYLPNgypyyy--ggydgtgNEWEGYPRYVNAEGVEMP--  456
            I  A+RS +PL+ + MD ++CY+PNGY   +  GGYDG+  EWE YPRYV   GVE+P  
Sbjct  56   IPTAERSLTPLLHEHMDASMCYIPNGYASSFYYGGYDGSMTEWEDYPRYVTPNGVEVPPL  115

Query  457  GVYGDNSSLVYQH  495
            GVYGD    +YQH
Sbjct  116  GVYGD----MYQH  124



>ref|XP_009411292.1| PREDICTED: uncharacterized protein LOC103993077 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=668

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = +1

Query  298  ADRSFSPLIPDFMDPTLCYLPNgypyyy---ggydgtgNEWEGYPRYVNAEGVE-MPGVY  465
            ++RS +PL+PDF+DP++CY+P GY       GGYD   N+W  Y RY N +GVE +PGVY
Sbjct  55   SERSLTPLLPDFVDPSMCYVPGGYASPAYFYGGYDRAVNKWGDYSRYTNNDGVEILPGVY  114

Query  466  GD  471
            GD
Sbjct  115  GD  116



>ref|XP_009408493.1| PREDICTED: uncharacterized protein LOC103990922 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=678

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 8/73 (11%)
 Frame = +1

Query  289  IQPADRSFSPLIPDFMDPTLCYLPNgypyyy--ggydgtgNEWEGYPRYVNAEGVEMP--  456
            I  A+RS +PL+ + MD ++CY+PNGY   +  GGYDG+  EWE YPRYV   GVE+P  
Sbjct  55   IPTAERSLTPLLHEHMDASMCYIPNGYASSFYYGGYDGSMTEWEDYPRYVTPNGVEVPPL  114

Query  457  GVYGDNSSLVYQH  495
            GVYGD    +YQH
Sbjct  115  GVYGD----MYQH  123



>ref|XP_009339199.1| PREDICTED: uncharacterized protein LOC103931442 isoform X2 [Pyrus 
x bretschneideri]
Length=675

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 45/69 (65%), Gaps = 4/69 (6%)
 Frame = +1

Query  301  DRSFSPLIPDFMDPTLCYLPNgypyyy---ggydgtgNEWEGYPRYVNAEGVEM-PGVYG  468
            DRS +PL  +FMDP+ CYLPNGY       GGYDGTGNEW G   YVN  G ++   VYG
Sbjct  50   DRSTAPLRKNFMDPSACYLPNGYTSSAYYYGGYDGTGNEWGGISSYVNPNGNDVNSAVYG  109

Query  469  DNSSLVYQH  495
            DN S +Y H
Sbjct  110  DNGSFMYHH  118



>emb|CDY24182.1| BnaC01g37620D [Brassica napus]
Length=541

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 78/121 (64%), Gaps = 7/121 (6%)
 Frame = +1

Query  145  MAAAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSP  318
            MA  VA +ADQ++++LQ L+LDSQ K  EIPEP KK +V      +   Q+   DRS +P
Sbjct  1    MATTVAQSADQSADMLQKLTLDSQPKGSEIPEP-KKAAVYQYGGVDVHSQVPSYDRSLTP  59

Query  319  LIP-DFMDPTLCYLPNgypy-yyggydgtgNEWEGYPRYV-NAEGVEMP-GVYGDNSSLV  486
            L+P D  DP++CY+PN Y   +Y GY  +G +W  +  Y  N EGV+M  GVYG+N SLV
Sbjct  60   LLPSDAADPSVCYVPNAYQQPFYYGYGASGQDWSEFTGYNPNLEGVDMSAGVYGENGSLV  119

Query  487  Y  489
            Y
Sbjct  120  Y  120



>ref|NP_001169286.1| hypothetical protein [Zea mays]
 gb|ACN33287.1| unknown [Zea mays]
 gb|AFW89695.1| hypothetical protein ZEAMMB73_168477 [Zea mays]
Length=701

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P +RS +P++ DFMDP L YLP    YYYGGYD + +EW+ YPRY+N++GVE+ P VYGD
Sbjct  78   PPERSITPVLQDFMDPNLFYLP---AYYYGGYDSSMSEWDDYPRYLNSDGVEIAPAVYGD  134



>gb|AFW89696.1| hypothetical protein ZEAMMB73_168477 [Zea mays]
Length=702

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P +RS +P++ DFMDP L YLP    YYYGGYD + +EW+ YPRY+N++GVE+ P VYGD
Sbjct  78   PPERSITPVLQDFMDPNLFYLP---AYYYGGYDSSMSEWDDYPRYLNSDGVEIAPAVYGD  134



>ref|XP_009398525.1| PREDICTED: YTH domain-containing family protein 2-like [Musa 
acuminata subsp. malaccensis]
Length=695

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 14/124 (11%)
 Frame = +1

Query  154  AVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPA------DRSFS  315
            A  P+ADQ ++L+Q LSLD+  K+ +  E  KK S     +ANG   P       +RS +
Sbjct  5    ATPPSADQATDLIQKLSLDTANKSNDSSEVKKKPSGVQYGSANGGEAPIASIPTYERSLT  64

Query  316  PLIPDFMDPTLCYLPNgypyyyggydgtgN--EWEGYPRYVNAEGVEM--PGVYGDNSSL  483
            PL+ + MD  +CY+PNGY   +      G+  EWE YPRYVN++GVE+  PGVYGD    
Sbjct  65   PLLQEHMDAGMCYVPNGYTPSFYYGGYDGSMAEWEDYPRYVNSDGVEVPPPGVYGD----  120

Query  484  VYQH  495
            +Y H
Sbjct  121  MYHH  124



>gb|ABF94073.1| YT521-B-like family protein, expressed [Oryza sativa Japonica 
Group]
 gb|AGT42303.1| YT521-B-like family protein [Oryza sativa Japonica Group]
Length=708

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  81   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSVSEWDDYPRYVNPDGVEITPAVYGD  137



>ref|XP_009339198.1| PREDICTED: uncharacterized protein LOC103931442 isoform X1 [Pyrus 
x bretschneideri]
Length=676

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 45/69 (65%), Gaps = 4/69 (6%)
 Frame = +1

Query  301  DRSFSPLIPDFMDPTLCYLPNgypyyy---ggydgtgNEWEGYPRYVNAEGVEM-PGVYG  468
            DRS +PL  +FMDP+ CYLPNGY       GGYDGTGNEW G   YVN  G ++   VYG
Sbjct  51   DRSTAPLRKNFMDPSACYLPNGYTSSAYYYGGYDGTGNEWGGISSYVNPNGNDVNSAVYG  110

Query  469  DNSSLVYQH  495
            DN S +Y H
Sbjct  111  DNGSFMYHH  119



>gb|ABF94076.1| YT521-B-like family protein, expressed [Oryza sativa Japonica 
Group]
Length=648

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  80   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSVSEWDDYPRYVNPDGVEITPAVYGD  136



>ref|NP_001049022.1| Os03g0158500 [Oryza sativa Japonica Group]
 gb|ABF94075.1| YT521-B-like family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10936.1| Os03g0158500 [Oryza sativa Japonica Group]
 gb|EEE58351.1| hypothetical protein OsJ_09476 [Oryza sativa Japonica Group]
Length=707

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  80   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSVSEWDDYPRYVNPDGVEITPAVYGD  136



>gb|EEC74554.1| hypothetical protein OsI_10095 [Oryza sativa Indica Group]
Length=707

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  80   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSVSEWDDYPRYVNPDGVEITPAVYGD  136



>ref|XP_010229176.1| PREDICTED: uncharacterized protein LOC100841677 isoform X3 [Brachypodium 
distachyon]
Length=750

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  72   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSMSEWDEYPRYVNQDGVEVAPAVYGD  128



>ref|XP_003558773.1| PREDICTED: uncharacterized protein LOC100841677 isoform X1 [Brachypodium 
distachyon]
Length=751

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  73   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSMSEWDEYPRYVNQDGVEVAPAVYGD  129



>gb|AAD10646.1| Hypothetical protein [Arabidopsis thaliana]
Length=580

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 68/109 (62%), Gaps = 8/109 (7%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLI  324
            + VAP ADQ +++L+ LSLDS+++ LEIPEPTKK  V    A  +NGQ+   DRS SP++
Sbjct  2    STVAPPADQAADVLKKLSLDSKSRTLEIPEPTKKTGVYQYGAMDSNGQVPSFDRSLSPML  61

Query  325  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEMPGVYG  468
            P D +DP++ Y+PN Y   Y    G+      Y  Y N+E V+M   YG
Sbjct  62   PSDALDPSVFYVPNVYQQPYYYGYGSD-----YTGYTNSESVDMTSGYG  105



>ref|NP_001185241.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE33255.1| uncharacterized protein AT1G55500 [Arabidopsis thaliana]
Length=592

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 68/109 (62%), Gaps = 8/109 (7%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHA--ANGQIQPADRSFSPLI  324
            + VAP ADQ +++L+ LSLDS+++ LEIPEPTKK  V    A  +NGQ+   DRS SP++
Sbjct  2    STVAPPADQAADVLKKLSLDSKSRTLEIPEPTKKTGVYQYGAMDSNGQVPSFDRSLSPML  61

Query  325  P-DFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEMPGVYG  468
            P D +DP++ Y+PN Y   Y    G+      Y  Y N+E V+M   YG
Sbjct  62   PSDALDPSVFYVPNVYQQPYYYGYGSD-----YTGYTNSESVDMTSGYG  105



>ref|XP_006651059.1| PREDICTED: uncharacterized protein LOC102715747, partial [Oryza 
brachyantha]
Length=680

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  50   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSVSEWDDYPRYVNPDGVEIAPAVYGD  106



>ref|XP_010229175.1| PREDICTED: uncharacterized protein LOC100841677 isoform X2 [Brachypodium 
distachyon]
Length=750

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P +RS +P++ DFMDP + YLP    YYYGGYDG+ +EW+ YPRYVN +GVE+ P VYGD
Sbjct  72   PPERSITPVLQDFMDPNMFYLP---AYYYGGYDGSMSEWDEYPRYVNQDGVEVAPAVYGD  128



>ref|XP_009398364.1| PREDICTED: YTH domain-containing family protein 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=688

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 8/68 (12%)
 Frame = +1

Query  304  RSFSPLIPDFMDPTLCYLPNgypy--yyggydgtgNEWEGYPRYVNAEGVEMP--GVYGD  471
            RS +PL+ + MD ++CY PNGY    YYGGYD +  EWE YPRYV+ +G+E+P  GVYGD
Sbjct  61   RSLTPLLQEHMDASMCYFPNGYTSPFYYGGYDASITEWEDYPRYVSPDGMEVPPLGVYGD  120

Query  472  NSSLVYQH  495
                +YQH
Sbjct  121  ----MYQH  124



>emb|CDX82538.1| BnaA03g32830D [Brassica napus]
Length=640

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 46/85 (54%), Gaps = 4/85 (5%)
 Frame = +1

Query  223  ALEIPEPTKKVSVDSTHAA--NGQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggyd  393
            A EIPEP KK +V        NGQ+   DRS +PL+P D +DP++CY+PN Y   +    
Sbjct  28   ASEIPEP-KKTAVYQYGGVDLNGQVPSFDRSLTPLLPSDAVDPSVCYVPNAYQQPFYYGG  86

Query  394  gtgNEWEGYPRYVNAEGVEMPGVYG  468
                +W  Y  Y   EGV+M   YG
Sbjct  87   YGTGDWSEYTGYQTPEGVDMTSGYG  111



>ref|NP_001280979.1| uncharacterized LOC103446969 [Malus domestica]
 gb|AHN05778.1| YTH domain-contained RNA binding protein 1 [Malus domestica]
Length=676

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 45/68 (66%), Gaps = 4/68 (6%)
 Frame = +1

Query  304  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            RS +PL  +FMDP+ CYLPN      YYYGGYDGTGNEW G   YVN  G ++   VYGD
Sbjct  52   RSTAPLRKNFMDPSACYLPNGYTSSAYYYGGYDGTGNEWGGISSYVNPNGNDVNSAVYGD  111

Query  472  NSSLVYQH  495
            N S +Y H
Sbjct  112  NGSFMYHH  119



>ref|XP_008351306.1| PREDICTED: uncharacterized protein LOC103414704 isoform X3 [Malus 
domestica]
Length=663

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 4/70 (6%)
 Frame = +1

Query  298  ADRSFSPLIPDFMDPTLCYLPNg---ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVY  465
            A +S +PL  DFM+P+ CYLPNG     YYYGGY GTGNEW G   YVN  G ++   VY
Sbjct  37   ARKSTAPLHKDFMNPSACYLPNGYTPSAYYYGGYGGTGNEWGGISSYVNPNGSDVNSAVY  96

Query  466  GDNSSLVYQH  495
            GDN S +Y H
Sbjct  97   GDNGSFMYHH  106



>ref|XP_009399331.1| PREDICTED: YTH domain-containing family protein 1-like [Musa 
acuminata subsp. malaccensis]
Length=698

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 8/69 (12%)
 Frame = +1

Query  301  DRSFSPLIPDFMDPTLCYLPNgypyyy--ggydgtgNEWEGYPRYVNAEGVEM--PGVYG  468
            +RS +PL+ + MD ++CYLPNGY   +  GGY+G   EWE YPRY N +G E+  PGVYG
Sbjct  60   ERSLTPLLQEHMDASMCYLPNGYTSSFYYGGYNGLMTEWEDYPRYANPDGAEVPPPGVYG  119

Query  469  DNSSLVYQH  495
            D    +Y H
Sbjct  120  D----MYHH  124



>emb|CDX75712.1| BnaC03g37950D [Brassica napus]
Length=634

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 46/85 (54%), Gaps = 5/85 (6%)
 Frame = +1

Query  223  ALEIPEPTKKVSVDSTHAA--NGQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggyd  393
            A EIPEP KK +V        NGQ+   DRS SPL+P D +DP++CY+PN        Y 
Sbjct  28   ASEIPEP-KKTAVYQYGGVDLNGQVPSFDRSLSPLLPSDAVDPSVCYVPN-AYQQPFYYG  85

Query  394  gtgNEWEGYPRYVNAEGVEMPGVYG  468
                +W  Y  Y N EGV+M   YG
Sbjct  86   YGNGDWSEYTGYQNPEGVDMNSGYG  110



>dbj|BAJ96028.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=758

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P DRS +P++ DF DP + YLP    YYYGGYDGT +EW+ Y RYVN +GVE+ P VYGD
Sbjct  77   PQDRSITPVVQDFTDPNMFYLP---AYYYGGYDGTMSEWDEYTRYVNQDGVEVAPAVYGD  133



>dbj|BAK04671.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=757

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P DRS +P++ DF DP + YLP    YYYGGYDGT +EW+ Y RYVN +GVE+ P VYGD
Sbjct  76   PQDRSITPVVQDFTDPNMFYLP---AYYYGGYDGTMSEWDEYTRYVNQDGVEVAPAVYGD  132



>gb|EMT25443.1| hypothetical protein F775_28207 [Aegilops tauschii]
Length=717

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P DRS +P++ DF DP + YLP    YYYGGYDGT +EW+ Y RYVN +GVE+ P VYGD
Sbjct  36   PQDRSITPVVQDFTDPNMFYLP---AYYYGGYDGTMSEWDEYTRYVNQDGVEVTPAVYGD  92



>ref|XP_008351300.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X2 [Malus domestica]
Length=675

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 45/68 (66%), Gaps = 4/68 (6%)
 Frame = +1

Query  304  RSFSPLIPDFMDPTLCYLPNg---ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            +S +PL  DFM+P+ CYLPNG     YYYGGY GTGNEW G   YVN  G ++   VYGD
Sbjct  51   QSTAPLHKDFMNPSACYLPNGYTPSAYYYGGYGGTGNEWGGISSYVNPNGSDVNSAVYGD  110

Query  472  NSSLVYQH  495
            N S +Y H
Sbjct  111  NGSFMYHH  118



>gb|AAN06837.1| Putative RNA-binding protein [Oryza sativa Japonica Group]
Length=716

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 43/66 (65%), Gaps = 7/66 (11%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgy------pyyyggydgtgNEWEGYPRYVNAEGVEM-  453
            P +RS +P++ DFMDP + YLP  Y           GYDG+ +EW+ YPRYVN +GVE+ 
Sbjct  80   PPERSITPVLQDFMDPNMFYLPAYYYGELCWFAKLPGYDGSVSEWDDYPRYVNPDGVEIT  139

Query  454  PGVYGD  471
            P VYGD
Sbjct  140  PAVYGD  145



>ref|XP_008645292.1| PREDICTED: uncharacterized protein LOC100383598 isoform X2 [Zea 
mays]
 gb|ACN27699.1| unknown [Zea mays]
Length=687

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P + S +P+I DF DP L YLP    YYYGGYD + +EW+ YPRY+N++GVE+ P VYGD
Sbjct  71   PPEPSITPVIQDFTDPNLFYLP---AYYYGGYDSSMSEWDDYPRYLNSDGVEIAPAVYGD  127



>ref|XP_009398365.1| PREDICTED: YTH domain-containing family protein 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=684

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 8/66 (12%)
 Frame = +1

Query  304  RSFSPLIPDFMDPTLCYLPNgypy--yyggydgtgNEWEGYPRYVNAEGVEMPGVYGDNS  477
            RS +PL+ + MD ++CY PNGY    YYGGYD +  EWE YPRYV+ +G+E  GVYGD  
Sbjct  61   RSLTPLLQEHMDASMCYFPNGYTSPFYYGGYDASITEWEDYPRYVSPDGME--GVYGD--  116

Query  478  SLVYQH  495
              +YQH
Sbjct  117  --MYQH  120



>gb|EMS56337.1| YTH domain family protein 2 [Triticum urartu]
Length=947

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P DRS +P++ DF DP + YLP    YYYGGYDGT +EW+ Y RYVN +GVE+ P VYGD
Sbjct  34   PQDRSITPVVQDFTDPNMFYLP---AYYYGGYDGTMSEWDEYTRYVNQDGVEVTPAVYGD  90



>ref|XP_008645285.1| PREDICTED: uncharacterized protein LOC100383598 isoform X1 [Zea 
mays]
 tpg|DAA43448.1| TPA: hypothetical protein ZEAMMB73_193181 [Zea mays]
Length=691

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P + S +P+I DF DP L YLP    YYYGGYD + +EW+ YPRY+N++GVE+ P VYGD
Sbjct  71   PPEPSITPVIQDFTDPNLFYLP---AYYYGGYDSSMSEWDDYPRYLNSDGVEIAPAVYGD  127



>ref|NP_001169717.1| uncharacterized protein LOC100383598 [Zea mays]
 gb|ACN34636.1| unknown [Zea mays]
 tpg|DAA43447.1| TPA: hypothetical protein ZEAMMB73_193181 [Zea mays]
Length=690

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 4/60 (7%)
 Frame = +1

Query  295  PADRSFSPLIPDFMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            P + S +P+I DF DP L YLP    YYYGGYD + +EW+ YPRY+N++GVE+ P VYGD
Sbjct  70   PPEPSITPVIQDFTDPNLFYLP---AYYYGGYDSSMSEWDDYPRYLNSDGVEIAPAVYGD  126



>ref|XP_008384358.1| PREDICTED: uncharacterized protein LOC103446969 isoform X2 [Malus 
domestica]
 ref|XP_008366131.1| PREDICTED: uncharacterized protein LOC103429777 isoform X2 [Malus 
domestica]
Length=675

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 44/68 (65%), Gaps = 4/68 (6%)
 Frame = +1

Query  304  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            RS +PL  +FMDP+ CYLPN      YYYGGYDGTGNEW G   YVN  G ++   VYGD
Sbjct  51   RSTAPLRKNFMDPSACYLPNGYTSSAYYYGGYDGTGNEWGGISSYVNPNGNDVNSAVYGD  110

Query  472  NSSLVYQH  495
              S +Y H
Sbjct  111  XGSFMYHH  118



>ref|XP_008366130.1| PREDICTED: uncharacterized protein LOC103429777 isoform X1 [Malus 
domestica]
Length=676

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 44/68 (65%), Gaps = 4/68 (6%)
 Frame = +1

Query  304  RSFSPLIPDFMDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            RS +PL  +FMDP+ CYLPN      YYYGGYDGTGNEW G   YVN  G ++   VYGD
Sbjct  52   RSTAPLRKNFMDPSACYLPNGYTSSAYYYGGYDGTGNEWGGISSYVNPNGNDVNSAVYGD  111

Query  472  NSSLVYQH  495
              S +Y H
Sbjct  112  XGSFMYHH  119



>ref|XP_006445565.1| hypothetical protein CICLE_v10014439mg [Citrus clementina]
 gb|ESR58805.1| hypothetical protein CICLE_v10014439mg [Citrus clementina]
 gb|KDO54497.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
 gb|KDO54498.1| hypothetical protein CISIN_1g005158mg [Citrus sinensis]
Length=642

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 4/58 (7%)
 Frame = +1

Query  334  MDPTLCYLPN---gypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
            MDP +CY+PN      +YYGGYDG   EW+ Y RYV+ +GV+M  GVYGDN SL+Y H
Sbjct  1    MDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGDNGSLMYHH  58



>ref|XP_009603414.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009603416.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009603417.1| PREDICTED: YTH domain-containing family protein 2-like isoform 
X1 [Nicotiana tomentosiformis]
Length=662

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 77/131 (59%), Gaps = 24/131 (18%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVS------VDSTHAANGQIQPADRSF  312
            AAV P++DQT++LLQ L LDS+ K+L+  + TK+VS      V+    ANG  +P +RS 
Sbjct  2    AAVVPSSDQTADLLQDLHLDSENKSLQARDSTKQVSSVQYAPVEPGTMANGMNKPFERST  61

Query  313  SPLIPDFMDPTLCYLPNgypy---------yyggydgtgNEWEGYPRYVNAEGVEMP-GV  462
            SP   DF  P++ Y PNGY           Y G    +GNEW+G   + +A+GVEMP G+
Sbjct  62   SPFNQDFTGPSMFYSPNGYTSPTYPSSTYYYGGYDGSSGNEWDG---FASADGVEMPQGM  118

Query  463  YGDNSSLVYQH  495
            +GD     YQH
Sbjct  119  FGD-----YQH  124



>ref|XP_009397705.1| PREDICTED: uncharacterized protein LOC103982492 [Musa acuminata 
subsp. malaccensis]
Length=667

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 78/126 (62%), Gaps = 14/126 (11%)
 Frame = +1

Query  148  AAAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQP------ADRS  309
            A A AP ADQT++L++ LSLDS+  + +  E TKK S     + NG+  P      ++RS
Sbjct  3    AVAPAPLADQTTDLMRKLSLDSKNMSSDASEVTKKPSGVQYGSVNGREAPMVSIPTSERS  62

Query  310  FSPLIPDFMDPTLCYLPNgypyyy--ggydgtgNEWEGYPRYVNAEGVEMP--GVYGDNS  477
             +PL+ + +D ++ Y PNG+   +  GGYDG+  EWE YPRYV+ +G E+P  GVYGD  
Sbjct  63   LTPLLQEHLDTSMFYYPNGHASSFYYGGYDGSATEWEAYPRYVSPDGSEVPPLGVYGD--  120

Query  478  SLVYQH  495
              +Y H
Sbjct  121  --MYHH  124



>gb|EPS72124.1| hypothetical protein M569_02632, partial [Genlisea aurea]
Length=628

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 71/116 (61%), Gaps = 8/116 (7%)
 Frame = +1

Query  151  AAVAPTAdqtsellqslsldsqtKALEIPEPTKKVSVDSTHAANGQIQPADRSFSPLIPD  330
            A VAP ADQ  +++Q L+LD+Q  ++EIP PTKK S DS + ANG    A    + LI D
Sbjct  2    AVVAPPADQAVDMMQKLTLDTQPNSIEIPTPTKKQSADSNNMANGVQSVA----TTLISD  57

Query  331  FMDPTLCYLPNgypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGDNSSLVYQH  495
              D  + Y PNG+  YYGGYDG+  +     ++   EGVEM  G YG+N+ L+Y H
Sbjct  58   MTDKAVSYQPNGFTPYYGGYDGSERDLA---KFAGHEGVEMGAGAYGENAPLLYHH  110



>ref|NP_001280968.1| YTH domain-containing family protein 2-like [Malus domestica]
 gb|AHN05779.1| YTH domain-contained RNA binding protein 2 [Malus domestica]
Length=676

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 44/68 (65%), Gaps = 4/68 (6%)
 Frame = +1

Query  304  RSFSPLIPDFMDPTLCYLPNg---ypyyyggydgtgNEWEGYPRYVNAEGVEM-PGVYGD  471
            +S +PL  DFM+P+ CYLPNG     YYYGGY GTGNEW     YVN  G ++   VYGD
Sbjct  52   QSTAPLHKDFMNPSACYLPNGYTPSAYYYGGYGGTGNEWGRISSYVNPNGSDVNSAVYGD  111

Query  472  NSSLVYQH  495
            N S +Y H
Sbjct  112  NGSFMYHH  119



>ref|XP_009135306.1| PREDICTED: uncharacterized protein LOC103859518 [Brassica rapa]
Length=639

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 45/85 (53%), Gaps = 5/85 (6%)
 Frame = +1

Query  223  ALEIPEPTKKVSVDSTHAAN--GQIQPADRSFSPLIP-DFMDPTLCYLPNgypyyyggyd  393
            A EIPEP KK +V      +  GQ+   DRS +PL+P D +DP++CY+PN        Y 
Sbjct  28   ASEIPEP-KKTAVYQYGGVDLSGQVPSFDRSLTPLLPSDAVDPSVCYVPN-AYQQPFYYG  85

Query  394  gtgNEWEGYPRYVNAEGVEMPGVYG  468
                +W  Y  Y   EGV+M   YG
Sbjct  86   YGTGDWSEYTGYQTPEGVDMTSGYG  110



>ref|XP_009411293.1| PREDICTED: uncharacterized protein LOC103993077 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=493

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 4/58 (7%)
 Frame = +1

Query  298  ADRSFSPLIPDFMDPTLCYLPNgypyyy---ggydgtgNEWEGYPRYVNAEGVE-MPG  459
            ++RS +PL+PDF+DP++CY+P GY       GGYD   N+W  Y RY N +GVE +PG
Sbjct  58   SERSLTPLLPDFVDPSMCYVPGGYASPAYFYGGYDRAVNKWGDYSRYTNNDGVEILPG  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190