BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF024F01

Length=456
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009609764.1|  PREDICTED: CSC1-like protein RXW8                  137   1e-37   Nicotiana tomentosiformis
ref|XP_009797746.1|  PREDICTED: CSC1-like protein RXW8                  137   1e-34   Nicotiana sylvestris
gb|EYU26139.1|  hypothetical protein MIMGU_mgv1a022719mg                136   4e-34   Erythranthe guttata [common monkey flower]
ref|XP_009619283.1|  PREDICTED: CSC1-like protein RXW8                  136   5e-34   Nicotiana tomentosiformis
emb|CDP00997.1|  unnamed protein product                                135   1e-33   Coffea canephora [robusta coffee]
gb|EYU34204.1|  hypothetical protein MIMGU_mgv1a001911mg                134   2e-33   Erythranthe guttata [common monkey flower]
gb|EPS73081.1|  hypothetical protein M569_01675                         126   2e-33   Genlisea aurea
ref|XP_010320285.1|  PREDICTED: CSC1-like protein RXW8                  133   6e-33   Solanum lycopersicum
ref|XP_006356826.1|  PREDICTED: uncharacterized protein RSN1-like       133   6e-33   
gb|AAQ17609.1|AF167425_2  unknown                                       127   1e-32   Solanum lycopersicum
gb|AFK42839.1|  unknown                                                 122   1e-31   Lotus japonicus
ref|XP_008352127.1|  PREDICTED: uncharacterized protein LOC103415586    122   1e-31   
ref|XP_007018411.1|  Lipases,hydrolases, acting on ester bonds is...    128   3e-31   
gb|KHN36998.1|  Putative membrane protein                               127   5e-31   Glycine soja [wild soybean]
ref|XP_007018410.1|  Lipases,hydrolases, acting on ester bonds is...    127   5e-31   Theobroma cacao [chocolate]
ref|XP_003556958.1|  PREDICTED: uncharacterized membrane protein ...    127   7e-31   Glycine max [soybeans]
ref|XP_010664474.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       126   9e-31   Vitis vinifera
ref|XP_007160961.1|  hypothetical protein PHAVU_001G031900g             126   1e-30   Phaseolus vulgaris [French bean]
emb|CBI19350.3|  unnamed protein product                                126   1e-30   Vitis vinifera
ref|XP_007160962.1|  hypothetical protein PHAVU_001G031900g             126   1e-30   Phaseolus vulgaris [French bean]
ref|XP_002283520.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       126   1e-30   Vitis vinifera
ref|XP_007225157.1|  hypothetical protein PRUPE_ppa002376mg             126   1e-30   
ref|XP_003545361.2|  PREDICTED: uncharacterized membrane protein ...    126   2e-30   Glycine max [soybeans]
ref|XP_008220418.1|  PREDICTED: uncharacterized membrane protein ...    126   2e-30   Prunus mume [ume]
ref|XP_007136794.1|  hypothetical protein PHAVU_009G074900g             125   4e-30   Phaseolus vulgaris [French bean]
ref|XP_009776499.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       124   1e-29   Nicotiana sylvestris
ref|XP_010109429.1|  putative membrane protein                          124   1e-29   
gb|EPS67708.1|  hypothetical protein M569_07066                         118   2e-29   Genlisea aurea
ref|XP_004501797.1|  PREDICTED: uncharacterized membrane protein ...    123   2e-29   
gb|KHN29744.1|  Putative membrane protein C2G11.09                      122   3e-29   Glycine soja [wild soybean]
ref|XP_004159572.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    122   3e-29   
gb|KHN17195.1|  Putative membrane protein                               122   3e-29   Glycine soja [wild soybean]
ref|XP_010670325.1|  PREDICTED: CSC1-like protein RXW8                  122   4e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004142910.1|  PREDICTED: uncharacterized membrane protein ...    122   4e-29   
ref|XP_008444513.1|  PREDICTED: uncharacterized membrane protein ...    122   5e-29   Cucumis melo [Oriental melon]
ref|XP_003523635.1|  PREDICTED: uncharacterized membrane protein ...    122   7e-29   
gb|AAC34340.1|  Hypothetical protein                                    117   7e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010548610.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       122   8e-29   Tarenaya hassleriana [spider flower]
ref|XP_010548636.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       121   8e-29   Tarenaya hassleriana [spider flower]
ref|XP_002510037.1|  conserved hypothetical protein                     121   1e-28   Ricinus communis
ref|XP_011078463.1|  PREDICTED: CSC1-like protein RXW8                  121   1e-28   
ref|XP_009623866.1|  PREDICTED: CSC1-like protein RXW8                  121   1e-28   Nicotiana tomentosiformis
ref|XP_010553666.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       120   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_009361350.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       120   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_009361345.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       120   3e-28   Pyrus x bretschneideri [bai li]
gb|KDP41570.1|  hypothetical protein JCGZ_15977                         119   4e-28   Jatropha curcas
ref|XP_002302379.1|  early-responsive to dehydration family protein     119   5e-28   Populus trichocarpa [western balsam poplar]
ref|XP_009337131.1|  PREDICTED: CSC1-like protein RXW8 isoform X3       118   7e-28   Pyrus x bretschneideri [bai li]
ref|XP_011017061.1|  PREDICTED: CSC1-like protein RXW8                  119   9e-28   Populus euphratica
ref|XP_004252733.1|  PREDICTED: CSC1-like protein RXW8                  119   1e-27   Solanum lycopersicum
ref|XP_002888209.1|  hypothetical protein ARALYDRAFT_893642             118   2e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_010470242.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       118   2e-27   Camelina sativa [gold-of-pleasure]
emb|CDY45880.1|  BnaC01g28160D                                          117   2e-27   Brassica napus [oilseed rape]
ref|XP_009102869.1|  PREDICTED: CSC1-like protein RXW8                  117   3e-27   Brassica rapa
ref|XP_009337128.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       117   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_009337130.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       117   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_006392284.1|  hypothetical protein EUTSA_v10023298mg             116   5e-27   Eutrema salsugineum [saltwater cress]
ref|NP_683440.2|  protein RXW8                                          116   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004498938.1|  PREDICTED: uncharacterized membrane protein ...    116   6e-27   
ref|XP_006300402.1|  hypothetical protein CARUB_v10019848mg             116   6e-27   Capsella rubella
ref|XP_010480405.1|  PREDICTED: CSC1-like protein At1g10090             112   7e-27   Camelina sativa [gold-of-pleasure]
gb|KJB14673.1|  hypothetical protein B456_002G137000                    115   8e-27   Gossypium raimondii
emb|CDY44554.1|  BnaA01g21850D                                          115   9e-27   Brassica napus [oilseed rape]
emb|CDY27274.1|  BnaC04g18540D                                          115   1e-26   Brassica napus [oilseed rape]
dbj|BAD43330.1|  unnamed protein product                                115   1e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KJB14675.1|  hypothetical protein B456_002G137000                    115   1e-26   Gossypium raimondii
ref|NP_172480.2|  Early-responsive to dehydration stress protein ...    115   1e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KJB14674.1|  hypothetical protein B456_002G137000                    115   1e-26   Gossypium raimondii
gb|AAM63909.1|  unknown                                                 115   1e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KHG29773.1|  Membrane protein                                        115   2e-26   Gossypium arboreum [tree cotton]
ref|XP_006342673.1|  PREDICTED: transmembrane protein 63B-like is...    115   2e-26   Solanum tuberosum [potatoes]
ref|XP_009124465.1|  PREDICTED: CSC1-like protein RXW8                  115   2e-26   
ref|XP_006303157.1|  hypothetical protein CARUB_v10008381mg             114   3e-26   Capsella rubella
gb|KEH39975.1|  ERD (early-responsive to dehydration stress) fami...    114   3e-26   Medicago truncatula
ref|XP_006855764.1|  hypothetical protein AMTR_s00044p00184510          114   4e-26   Amborella trichopoda
gb|KEH35861.1|  ERD (early-responsive to dehydration stress) fami...    114   4e-26   Medicago truncatula
ref|XP_010480404.1|  PREDICTED: CSC1-like protein At1g10090             111   4e-26   Camelina sativa [gold-of-pleasure]
emb|CDY20660.1|  BnaC08g13980D                                          114   5e-26   Brassica napus [oilseed rape]
ref|XP_009397320.1|  PREDICTED: CSC1-like protein RXW8                  113   6e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009144475.1|  PREDICTED: CSC1-like protein At1g10090             113   7e-26   Brassica rapa
emb|CDY04434.1|  BnaA03g59260D                                          113   7e-26   
gb|KEH39976.1|  ERD (early-responsive to dehydration stress) fami...    113   7e-26   Medicago truncatula
ref|XP_010458341.1|  PREDICTED: CSC1-like protein At1g10090             112   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006417497.1|  hypothetical protein EUTSA_v10006880mg             112   1e-25   Eutrema salsugineum [saltwater cress]
ref|XP_010490656.1|  PREDICTED: CSC1-like protein At1g10090             112   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_009396675.1|  PREDICTED: CSC1-like protein RXW8                  112   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO81403.1|  hypothetical protein CISIN_1g039780mg                   112   2e-25   Citrus sinensis [apfelsine]
ref|XP_006433681.1|  hypothetical protein CICLE_v10000392mg             112   2e-25   Citrus clementina [clementine]
ref|XP_006472346.1|  PREDICTED: uncharacterized membrane protein ...    111   3e-25   Citrus sinensis [apfelsine]
gb|KJB58719.1|  hypothetical protein B456_009G222800                    110   8e-25   Gossypium raimondii
gb|KJB58718.1|  hypothetical protein B456_009G222800                    110   8e-25   Gossypium raimondii
ref|XP_002892546.1|  hypothetical protein ARALYDRAFT_471124             110   1e-24   
ref|XP_010943525.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       109   1e-24   Elaeis guineensis
ref|XP_011458884.1|  PREDICTED: CSC1-like protein RXW8                  109   2e-24   Fragaria vesca subsp. vesca
ref|XP_010943516.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       108   2e-24   Elaeis guineensis
gb|KJB64003.1|  hypothetical protein B456_010G028700                    105   2e-23   Gossypium raimondii
ref|XP_008798900.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       106   2e-23   Phoenix dactylifera
ref|XP_008798903.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       106   2e-23   
gb|KJB64004.1|  hypothetical protein B456_010G028700                    105   3e-23   Gossypium raimondii
gb|KJB64002.1|  hypothetical protein B456_010G028700                    105   5e-23   Gossypium raimondii
ref|XP_010061607.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       105   6e-23   Eucalyptus grandis [rose gum]
gb|KCW68598.1|  hypothetical protein EUGRSUZ_F02209                     105   6e-23   Eucalyptus grandis [rose gum]
ref|XP_010061609.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       105   6e-23   Eucalyptus grandis [rose gum]
ref|XP_006471294.1|  PREDICTED: uncharacterized membrane protein ...    104   7e-23   
ref|NP_001168247.1|  hypothetical protein                               104   1e-22   Zea mays [maize]
ref|XP_008643723.1|  PREDICTED: uncharacterized protein LOC100382...    104   1e-22   Zea mays [maize]
ref|XP_010274545.1|  PREDICTED: uncharacterized protein LOC104609841    103   1e-22   
tpg|DAA54769.1|  TPA: hypothetical protein ZEAMMB73_421656              102   2e-22   
ref|XP_004963302.1|  PREDICTED: uncharacterized protein RSN1-like...    103   3e-22   Setaria italica
ref|XP_006432542.1|  hypothetical protein CICLE_v10000536mg             102   4e-22   
ref|XP_008674128.1|  PREDICTED: uncharacterized protein LOC103650...    102   4e-22   Zea mays [maize]
ref|XP_006664233.1|  PREDICTED: uncharacterized protein RSN1-like       102   5e-22   Oryza brachyantha
ref|XP_002443649.1|  hypothetical protein SORBIDRAFT_08g022840          102   7e-22   Sorghum bicolor [broomcorn]
ref|XP_002463956.1|  hypothetical protein SORBIDRAFT_01g009540          101   9e-22   
ref|XP_003561326.1|  PREDICTED: CSC1-like protein At1g10090 isofo...    101   1e-21   Brachypodium distachyon [annual false brome]
ref|XP_003561325.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       101   1e-21   Brachypodium distachyon [annual false brome]
ref|XP_010231660.1|  PREDICTED: CSC1-like protein RXW8 isoform X3       100   1e-21   Brachypodium distachyon [annual false brome]
gb|EMT10348.1|  Putative membrane protein                               101   2e-21   
gb|EMS66678.1|  Uncharacterized membrane protein C2G11.09               100   2e-21   Triticum urartu
ref|XP_004982193.1|  PREDICTED: uncharacterized membrane protein ...    100   2e-21   
ref|XP_004982191.1|  PREDICTED: uncharacterized membrane protein ...    100   2e-21   Setaria italica
dbj|BAJ92039.1|  predicted protein                                      100   2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008644541.1|  PREDICTED: calcium permeable stress-gated ca...    100   3e-21   Zea mays [maize]
dbj|BAJ86319.1|  predicted protein                                    99.8    4e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004981918.1|  PREDICTED: uncharacterized membrane protein ...  99.8    5e-21   Setaria italica
ref|NP_001067352.1|  Os12g0633600                                     99.8    5e-21   
gb|EMT19397.1|  Putative membrane protein                             99.4    6e-21   
ref|XP_010936200.1|  PREDICTED: CSC1-like protein RXW8                99.4    6e-21   Elaeis guineensis
gb|KHG12367.1|  Membrane protein                                      99.0    7e-21   Gossypium arboreum [tree cotton]
dbj|BAJ90247.1|  predicted protein                                    98.6    1e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002464091.1|  hypothetical protein SORBIDRAFT_01g012190        98.6    1e-20   
ref|XP_003575997.1|  PREDICTED: CSC1-like protein RXW8                97.8    2e-20   Brachypodium distachyon [annual false brome]
ref|XP_008790275.1|  PREDICTED: CSC1-like protein RXW8                97.4    2e-20   
gb|AAR87202.1|  expressed protein (with alternative splicing)         96.7    6e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75908.1|  hypothetical protein OsI_12978                        96.7    6e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_010470241.1|  PREDICTED: CSC1-like protein RXW8 isoform X1     96.3    1e-19   
ref|XP_010414723.1|  PREDICTED: CSC1-like protein RXW8 isoform X1     95.5    2e-19   
gb|KDP41246.1|  hypothetical protein JCGZ_15653                       94.7    2e-19   Jatropha curcas
ref|XP_006650401.1|  PREDICTED: uncharacterized membrane protein ...  94.7    2e-19   Oryza brachyantha
ref|XP_006650399.1|  PREDICTED: uncharacterized membrane protein ...  95.1    2e-19   Oryza brachyantha
ref|XP_003559478.1|  PREDICTED: CSC1-like protein RXW8                93.6    6e-19   Brachypodium distachyon [annual false brome]
gb|EMS66677.1|  Uncharacterized membrane protein C2G11.09             93.2    9e-19   Triticum urartu
ref|XP_010044468.1|  PREDICTED: CSC1-like protein At1g69450           92.0    2e-18   Eucalyptus grandis [rose gum]
ref|XP_006650400.1|  PREDICTED: uncharacterized membrane protein ...  92.0    2e-18   Oryza brachyantha
gb|EMT18535.1|  Putative membrane protein                             92.0    2e-18   
dbj|BAK06091.1|  predicted protein                                    91.7    3e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010683104.1|  PREDICTED: CSC1-like protein At1g69450           91.7    3e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006650526.1|  PREDICTED: uncharacterized membrane protein ...  91.3    4e-18   Oryza brachyantha
gb|ABR16200.1|  unknown                                               90.9    4e-18   Picea sitchensis
ref|XP_007045993.1|  Early-responsive to dehydration stress prote...  90.1    1e-17   Theobroma cacao [chocolate]
gb|EEC76105.1|  hypothetical protein OsI_13363                        89.7    1e-17   Oryza sativa Indica Group [Indian rice]
gb|EEE59847.1|  hypothetical protein OsJ_12422                        89.4    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051134.1|  Os03g0726300                                     89.4    2e-17   
ref|XP_003613914.1|  Membrane protein, putative                       89.0    2e-17   Medicago truncatula
ref|XP_002522488.1|  conserved hypothetical protein                   89.0    3e-17   Ricinus communis
ref|XP_006574919.1|  PREDICTED: uncharacterized membrane protein ...  88.6    3e-17   
gb|KEH30798.1|  ERD (early-responsive to dehydration stress) fami...  89.0    3e-17   Medicago truncatula
ref|XP_004516572.1|  PREDICTED: uncharacterized membrane protein ...  88.6    3e-17   Cicer arietinum [garbanzo]
gb|KEH30800.1|  ERD (early-responsive to dehydration stress) fami...  88.6    3e-17   Medicago truncatula
ref|XP_006574918.1|  PREDICTED: uncharacterized membrane protein ...  88.2    3e-17   Glycine max [soybeans]
ref|XP_006574916.1|  PREDICTED: uncharacterized membrane protein ...  88.6    4e-17   Glycine max [soybeans]
gb|KJB80261.1|  hypothetical protein B456_013G089300                  88.2    4e-17   Gossypium raimondii
gb|KJB80260.1|  hypothetical protein B456_013G089300                  88.2    4e-17   Gossypium raimondii
gb|KJB80259.1|  hypothetical protein B456_013G089300                  88.2    4e-17   Gossypium raimondii
ref|XP_004490117.1|  PREDICTED: uncharacterized membrane protein ...  87.8    6e-17   Cicer arietinum [garbanzo]
ref|XP_006483098.1|  PREDICTED: uncharacterized membrane protein ...  87.8    7e-17   
gb|KEH30801.1|  ERD (early-responsive to dehydration stress) fami...  87.0    1e-16   Medicago truncatula
ref|XP_011017881.1|  PREDICTED: CSC1-like protein At1g69450 isofo...  86.7    1e-16   Populus euphratica
gb|KEH30803.1|  ERD (early-responsive to dehydration stress) fami...  86.3    2e-16   Medicago truncatula
ref|XP_010525100.1|  PREDICTED: CSC1-like protein HYP1                86.3    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_011017887.1|  PREDICTED: CSC1-like protein At1g69450 isofo...  85.9    3e-16   Populus euphratica
ref|XP_002311322.1|  hypothetical protein POPTR_0008s09070g           85.5    3e-16   
ref|XP_004297274.1|  PREDICTED: CSC1-like protein At1g69450           85.1    5e-16   Fragaria vesca subsp. vesca
ref|XP_010670229.1|  PREDICTED: CSC1-like protein HYP1 isoform X2     84.7    7e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010670228.1|  PREDICTED: CSC1-like protein HYP1 isoform X1     84.3    8e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|AEM36349.1|  At1g58520                                             84.3    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001154436.1|  protein RXW8                                     84.3    1e-15   
ref|XP_007226980.1|  hypothetical protein PRUPE_ppa002249mg           82.0    6e-15   
ref|XP_008339854.1|  PREDICTED: uncharacterized membrane protein ...  82.0    6e-15   
ref|XP_011012741.1|  PREDICTED: CSC1-like protein At1g69450           81.6    8e-15   Populus euphratica
ref|XP_008221566.1|  PREDICTED: uncharacterized membrane protein ...  81.6    8e-15   Prunus mume [ume]
ref|XP_009356342.1|  PREDICTED: CSC1-like protein At1g69450           81.6    8e-15   Pyrus x bretschneideri [bai li]
ref|XP_002316110.2|  hypothetical protein POPTR_0010s17130g           81.3    9e-15   
gb|KDO83031.1|  hypothetical protein CISIN_1g0052163mg                80.9    1e-14   Citrus sinensis [apfelsine]
ref|XP_010661095.1|  PREDICTED: CSC1-like protein HYP1 isoform X4     80.9    1e-14   Vitis vinifera
ref|XP_010661093.1|  PREDICTED: CSC1-like protein HYP1 isoform X2     81.3    1e-14   Vitis vinifera
ref|XP_006438758.1|  hypothetical protein CICLE_v10030873mg           80.9    1e-14   
ref|XP_010661092.1|  PREDICTED: CSC1-like protein HYP1 isoform X1     80.9    1e-14   Vitis vinifera
ref|XP_010661094.1|  PREDICTED: CSC1-like protein HYP1 isoform X3     80.9    1e-14   Vitis vinifera
ref|XP_006483099.1|  PREDICTED: uncharacterized membrane protein ...  80.9    1e-14   Citrus sinensis [apfelsine]
gb|KJB75678.1|  hypothetical protein B456_012G051600                  80.9    1e-14   Gossypium raimondii
emb|CDP02261.1|  unnamed protein product                              80.9    2e-14   Coffea canephora [robusta coffee]
ref|XP_007032617.1|  Early-responsive to dehydration stress prote...  80.5    2e-14   
ref|XP_006844825.1|  hypothetical protein AMTR_s00058p00059520        80.5    2e-14   Amborella trichopoda
emb|CBI22257.3|  unnamed protein product                              80.5    2e-14   Vitis vinifera
ref|XP_006408462.1|  hypothetical protein EUTSA_v10020163mg           80.1    3e-14   Eutrema salsugineum [saltwater cress]
ref|XP_009147396.1|  PREDICTED: CSC1-like protein HYP1                80.1    3e-14   Brassica rapa
ref|XP_007151261.1|  hypothetical protein PHAVU_004G031700g           80.1    3e-14   Phaseolus vulgaris [French bean]
emb|CDY37544.1|  BnaA05g34090D                                        80.1    3e-14   Brassica napus [oilseed rape]
ref|XP_002269926.1|  PREDICTED: CSC1-like protein HYP1                79.7    4e-14   Vitis vinifera
emb|CBI38238.3|  unnamed protein product                              79.3    6e-14   Vitis vinifera
ref|XP_010467963.1|  PREDICTED: CSC1-like protein HYP1                77.4    6e-14   
ref|XP_010108715.1|  Uncharacterized membrane protein                 78.6    8e-14   Morus notabilis
ref|XP_002882200.1|  hypothetical protein ARALYDRAFT_477418           78.6    8e-14   
gb|AES74767.2|  ERD (early-responsive to dehydration stress) fami...  78.2    8e-14   Medicago truncatula
ref|XP_010258239.1|  PREDICTED: CSC1-like protein HYP1                78.6    9e-14   Nelumbo nucifera [Indian lotus]
ref|XP_004135445.1|  PREDICTED: uncharacterized membrane protein ...  78.6    1e-13   Cucumis sativus [cucumbers]
ref|XP_004155380.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  78.2    1e-13   
emb|CAA56144.1|  unnamed protein product                              75.1    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006338419.1|  PREDICTED: uncharacterized membrane protein ...  78.2    1e-13   Solanum tuberosum [potatoes]
gb|AES74766.2|  ERD (early-responsive to dehydration stress) fami...  78.2    1e-13   Medicago truncatula
ref|XP_010258592.1|  PREDICTED: CSC1-like protein HYP1 isoform X2     77.8    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_003618548.1|  Membrane protein, putative                       78.2    1e-13   
ref|XP_010463578.1|  PREDICTED: CSC1-like protein HYP1                77.4    2e-13   Camelina sativa [gold-of-pleasure]
gb|KDP27183.1|  hypothetical protein JCGZ_19882                       77.8    2e-13   Jatropha curcas
emb|CDY43268.1|  BnaC05g48610D                                        77.8    2e-13   Brassica napus [oilseed rape]
ref|XP_010258582.1|  PREDICTED: CSC1-like protein HYP1 isoform X1     77.4    2e-13   Nelumbo nucifera [Indian lotus]
gb|AAF26163.1|AC008261_20  hypothetical protein                       74.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134634.1|  PREDICTED: CSC1-like protein HYP1                77.4    2e-13   Brassica rapa
ref|XP_009360589.1|  PREDICTED: CSC1-like protein HYP1                77.4    2e-13   
ref|XP_007157718.1|  hypothetical protein PHAVU_002G092500g           77.4    2e-13   Phaseolus vulgaris [French bean]
ref|XP_009105488.1|  PREDICTED: CSC1-like protein At1g69450           77.4    2e-13   Brassica rapa
ref|NP_177104.2|  Early-responsive to dehydration stress protein ...  77.0    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232200.1|  PREDICTED: CSC1-like protein HYP1 isoform X1     77.0    3e-13   Solanum lycopersicum
emb|CDX91963.1|  BnaC03g32650D                                        77.4    3e-13   
ref|XP_004491850.1|  PREDICTED: uncharacterized membrane protein ...  77.0    3e-13   Cicer arietinum [garbanzo]
ref|NP_001030613.1|  uncharacterized protein                          76.6    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888719.1|  hypothetical protein ARALYDRAFT_339179           77.0    3e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_010485425.1|  PREDICTED: CSC1-like protein HYP1                76.6    3e-13   Camelina sativa [gold-of-pleasure]
ref|XP_008379386.1|  PREDICTED: phosphate metabolism protein 7-like   76.6    4e-13   
ref|NP_186759.2|  uncharacterized protein                             76.6    4e-13   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94293.1|  hypothetical protein                                 76.6    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430647.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...  76.6    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_008446400.1|  PREDICTED: uncharacterized membrane protein ...  76.6    4e-13   Cucumis melo [Oriental melon]
ref|XP_011098669.1|  PREDICTED: CSC1-like protein HYP1 isoform X2     75.9    5e-13   Sesamum indicum [beniseed]
ref|XP_010511974.1|  PREDICTED: CSC1-like protein At1g69450           76.3    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_004489423.1|  PREDICTED: uncharacterized membrane protein ...  76.3    6e-13   Cicer arietinum [garbanzo]
ref|XP_011098667.1|  PREDICTED: CSC1-like protein HYP1 isoform X1     75.9    7e-13   Sesamum indicum [beniseed]
ref|XP_010911661.1|  PREDICTED: CSC1-like protein HYP1                71.2    8e-13   Elaeis guineensis
ref|XP_006299849.1|  hypothetical protein CARUB_v10016052mg           75.5    1e-12   Capsella rubella
ref|XP_009789223.1|  PREDICTED: CSC1-like protein HYP1 isoform X1     75.1    1e-12   Nicotiana sylvestris
emb|CDY40924.1|  BnaC06g30620D                                        75.1    1e-12   Brassica napus [oilseed rape]
ref|XP_002305383.1|  HYPOTHETICAL protein 1                           75.1    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_003551746.1|  PREDICTED: uncharacterized membrane protein ...  75.1    1e-12   Glycine max [soybeans]
ref|XP_006300796.1|  hypothetical protein CARUB_v10019875mg           75.1    1e-12   Capsella rubella
ref|XP_008780953.1|  PREDICTED: CSC1-like protein HYP1                75.1    1e-12   Phoenix dactylifera
ref|XP_010415590.1|  PREDICTED: CSC1-like protein At1g69450           75.1    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_007216321.1|  hypothetical protein PRUPE_ppa019884mg           75.1    1e-12   
ref|XP_011010302.1|  PREDICTED: CSC1-like protein HYP1                74.7    2e-12   Populus euphratica
ref|XP_010470930.1|  PREDICTED: CSC1-like protein At1g69450           74.7    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006482641.1|  PREDICTED: uncharacterized membrane protein ...  74.7    2e-12   Citrus sinensis [apfelsine]
ref|XP_006431218.1|  hypothetical protein CICLE_v10011183mg           74.7    2e-12   Citrus clementina [clementine]
ref|XP_006391015.1|  hypothetical protein EUTSA_v10018196mg           74.3    2e-12   Eutrema salsugineum [saltwater cress]
ref|XP_008230810.1|  PREDICTED: uncharacterized membrane protein ...  74.3    2e-12   Prunus mume [ume]
ref|XP_009625272.1|  PREDICTED: CSC1-like protein HYP1 isoform X1     74.3    3e-12   Nicotiana tomentosiformis
ref|XP_007139547.1|  hypothetical protein PHAVU_008G039200g           73.9    3e-12   Phaseolus vulgaris [French bean]
ref|XP_002530016.1|  conserved hypothetical protein                   73.6    4e-12   Ricinus communis
ref|XP_007011167.1|  Early-responsive to dehydration stress prote...  73.6    5e-12   
ref|XP_003554648.1|  PREDICTED: uncharacterized membrane protein ...  73.6    5e-12   Glycine max [soybeans]
gb|KJB60233.1|  hypothetical protein B456_009G295700                  72.0    2e-11   Gossypium raimondii
ref|XP_008341608.1|  PREDICTED: phosphate metabolism protein 7-like   72.0    2e-11   Malus domestica [apple tree]
gb|KHG15757.1|  putative membrane C2G11.09                            70.9    4e-11   Gossypium arboreum [tree cotton]
emb|CDX74284.1|  BnaA03g27630D                                        70.5    5e-11   
ref|XP_009407408.1|  PREDICTED: CSC1-like protein HYP1                70.5    5e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW65937.1|  hypothetical protein EUGRSUZ_G03247                   69.3    1e-10   Eucalyptus grandis [rose gum]
ref|XP_010551412.1|  PREDICTED: CSC1-like protein At1g69450           69.3    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_010068951.1|  PREDICTED: CSC1-like protein At3g54510           69.3    1e-10   
ref|XP_004304272.1|  PREDICTED: CSC1-like protein HYP1                68.9    1e-10   Fragaria vesca subsp. vesca
ref|XP_010088119.1|  Uncharacterized membrane protein                 68.9    2e-10   
ref|XP_008230808.1|  PREDICTED: phosphate metabolism protein 7-li...  68.9    2e-10   Prunus mume [ume]
ref|XP_001764420.1|  predicted protein                                68.6    2e-10   
ref|XP_003598670.1|  Membrane protein, putative                       68.2    2e-10   
gb|EYU44140.1|  hypothetical protein MIMGU_mgv1a002119mg              68.2    3e-10   Erythranthe guttata [common monkey flower]
gb|AES68921.2|  ERD (early-responsive to dehydration stress) fami...  68.2    3e-10   Medicago truncatula
ref|XP_007217011.1|  hypothetical protein PRUPE_ppa002110mg           67.0    6e-10   Prunus persica
ref|XP_008446926.1|  PREDICTED: uncharacterized membrane protein ...  66.6    1e-09   
ref|XP_002876256.1|  hypothetical protein ARALYDRAFT_485854           65.9    1e-09   
emb|CAB77571.1|  putative protein                                     65.9    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001118837.1|  Early-responsive to dehydration stress prote...  65.9    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004157550.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.9    2e-09   
gb|KGN52299.1|  hypothetical protein Csa_5G623630                     65.9    2e-09   
ref|XP_004142485.1|  PREDICTED: uncharacterized membrane protein ...  65.9    2e-09   
ref|XP_010029368.1|  PREDICTED: CSC1-like protein HYP1                65.5    2e-09   
ref|XP_003621301.1|  Membrane protein, putative                       65.5    2e-09   
ref|XP_007148980.1|  hypothetical protein PHAVU_005G030600g           65.5    2e-09   
ref|XP_009383884.1|  PREDICTED: CSC1-like protein At3g54510           64.7    4e-09   
ref|XP_004308611.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  63.9    7e-09   
emb|CDP00377.1|  unnamed protein product                              63.5    8e-09   
ref|XP_006839160.1|  hypothetical protein AMTR_s00097p00060460        59.7    8e-09   
ref|XP_006591163.1|  PREDICTED: uncharacterized membrane protein ...  63.5    1e-08   
gb|KHN18831.1|  Putative membrane protein C2G11.09                    63.2    1e-08   
ref|XP_002303914.1|  early-responsive to dehydration family protein   63.2    1e-08   
ref|XP_004515571.1|  PREDICTED: uncharacterized membrane protein ...  63.2    1e-08   
ref|XP_002513083.1|  conserved hypothetical protein                   62.8    2e-08   
ref|XP_009354442.1|  PREDICTED: CSC1-like protein At3g54510           62.4    3e-08   
gb|EMT00332.1|  hypothetical protein F775_30137                       60.1    4e-08   
ref|XP_004229157.2|  PREDICTED: CSC1-like protein At3g54510           61.6    4e-08   
ref|XP_011042157.1|  PREDICTED: CSC1-like protein At3g54510           61.6    4e-08   
gb|EYU38264.1|  hypothetical protein MIMGU_mgv1a020907mg              61.2    5e-08   
ref|XP_008362476.1|  PREDICTED: beta-amyrin synthase-like             61.2    6e-08   
ref|XP_009336442.1|  PREDICTED: CSC1-like protein At3g54510           61.2    6e-08   
ref|XP_010273235.1|  PREDICTED: CSC1-like protein At3g54510           60.5    9e-08   
ref|XP_010515983.1|  PREDICTED: CSC1-like protein At3g54510           59.7    2e-07   
ref|XP_010670424.1|  PREDICTED: CSC1-like protein At3g54510           59.7    2e-07   
ref|XP_010906445.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  59.7    2e-07   
ref|XP_006292418.1|  hypothetical protein CARUB_v10018632mg           59.3    2e-07   
gb|EPS65452.1|  hypothetical protein M569_09324                       59.3    2e-07   
ref|XP_010504259.1|  PREDICTED: CSC1-like protein At3g54510           58.9    3e-07   
dbj|BAJ87166.1|  predicted protein                                    58.9    3e-07   
ref|XP_007220369.1|  hypothetical protein PRUPE_ppa017744mg           58.9    3e-07   
ref|XP_006403564.1|  hypothetical protein EUTSA_v10010925mg           58.9    3e-07   
ref|XP_011088368.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  58.9    3e-07   
ref|XP_010906444.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  58.9    3e-07   
ref|XP_011088351.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  58.5    5e-07   
ref|XP_011088359.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  58.5    5e-07   
ref|XP_010427157.1|  PREDICTED: CSC1-like protein At3g54510           58.2    5e-07   
ref|XP_001765646.1|  predicted protein                                58.2    6e-07   
ref|XP_011088342.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  58.2    6e-07   
ref|XP_002960116.1|  hypothetical protein SELMODRAFT_450821           58.2    6e-07   
ref|XP_008661355.1|  PREDICTED: calcium permeable stress-gated ca...  57.8    7e-07   
ref|XP_009764506.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  57.4    1e-06   
ref|XP_009764507.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  57.0    1e-06   
gb|KDO83208.1|  hypothetical protein CISIN_1g006258mg                 57.0    1e-06   
ref|XP_009764505.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  57.0    1e-06   
ref|XP_002984025.1|  hypothetical protein SELMODRAFT_156268           56.6    2e-06   
ref|XP_002265197.1|  PREDICTED: CSC1-like protein At3g54510           56.6    2e-06   
ref|NP_001067142.1|  Os12g0582800                                     56.2    2e-06   
gb|EAY83674.1|  hypothetical protein OsI_38898                        56.2    2e-06   
ref|XP_008775844.1|  PREDICTED: CSC1-like protein At3g54510           55.8    3e-06   
emb|CBI17725.3|  unnamed protein product                              54.7    7e-06   
ref|XP_009602132.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  54.3    9e-06   
ref|XP_009602133.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  54.3    1e-05   
ref|XP_009602131.1|  PREDICTED: CSC1-like protein At3g54510 isofo...  54.3    1e-05   
ref|XP_006591164.1|  PREDICTED: uncharacterized membrane protein ...  54.3    1e-05   
ref|XP_006365456.1|  PREDICTED: uncharacterized membrane protein ...  53.5    2e-05   
ref|XP_010521464.1|  PREDICTED: CSC1-like protein At3g54510           53.5    2e-05   
gb|KFK34689.1|  hypothetical protein AALP_AA5G178800                  53.5    2e-05   
ref|XP_010089233.1|  Uncharacterized membrane protein                 52.4    4e-05   
ref|XP_008656873.1|  PREDICTED: phosphate metabolism protein 7 is...  52.0    5e-05   
ref|XP_008656872.1|  PREDICTED: phosphate metabolism protein 7 is...  52.0    5e-05   
gb|AFW83960.1|  hypothetical protein ZEAMMB73_809898                  52.0    5e-05   
emb|CDX73475.1|  BnaC08g25280D                                        51.2    9e-05   
ref|XP_006645386.1|  PREDICTED: uncharacterized membrane protein ...  50.4    1e-04   
gb|EPS71647.1|  hypothetical protein M569_03112                       49.7    2e-04   
emb|CDP16438.1|  unnamed protein product                              50.1    2e-04   
ref|XP_004963015.1|  PREDICTED: transmembrane protein 63B-like is...  48.9    5e-04   
ref|XP_004963014.1|  PREDICTED: transmembrane protein 63B-like is...  48.5    6e-04   



>ref|XP_009609764.1| PREDICTED: CSC1-like protein RXW8 [Nicotiana tomentosiformis]
Length=154

 Score =   137 bits (345),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M L+ALLTSAG+NT VCVV F LYSVLRKQPS V+VYFG K+A +  ++ D   F+RFVP
Sbjct  1    MKLAALLTSAGVNTAVCVVLFSLYSVLRKQPSFVNVYFGAKIAQVRARQQDAFRFDRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+DEEI A GGLDA+VF R IVFS RIFSIAA +C FLVLPL
Sbjct  61   SPSWILKAWETSDEEICATGGLDAVVFVRMIVFSFRIFSIAAIVCNFLVLPL  112



>ref|XP_009797746.1| PREDICTED: CSC1-like protein RXW8 [Nicotiana sylvestris]
 ref|XP_009797747.1| PREDICTED: CSC1-like protein RXW8 [Nicotiana sylvestris]
 ref|XP_009797748.1| PREDICTED: CSC1-like protein RXW8 [Nicotiana sylvestris]
Length=719

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M L+ALLTSAG+NT VCVV F LYSVLRKQPS V+VYFG K+A +  ++ D   F+RFVP
Sbjct  1    MKLAALLTSAGVNTAVCVVLFSLYSVLRKQPSFVNVYFGAKIAQVRARQQDAFRFDRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+DEEI+A GGLDA+VF R IVFS RIFSIAA +C FLVLPL
Sbjct  61   SPSWILKAWETSDEEISATGGLDAVVFVRMIVFSFRIFSIAAIVCNFLVLPL  112



>gb|EYU26139.1| hypothetical protein MIMGU_mgv1a022719mg, partial [Erythranthe 
guttata]
Length=700

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MN+SALLTSAG+NT VC V F LYSVLRKQPSLVSVYFGQKL+ +  KR DP  F R +P
Sbjct  1    MNISALLTSAGINTAVCAVLFSLYSVLRKQPSLVSVYFGQKLSQVHSKRNDPFWFGRLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWE +++E+   GG+D++VF R +VFSIR+F++AA +CLFLVLPL
Sbjct  61   SPSWIVKAWEASEDELYLTGGVDSVVFLRAVVFSIRVFTVAAIVCLFLVLPL  112



>ref|XP_009619283.1| PREDICTED: CSC1-like protein RXW8 [Nicotiana tomentosiformis]
Length=719

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M L+ALLTSAG+NT VCVV F LYSVLRKQPS V+VYFG K+A +  ++ D   F+RFVP
Sbjct  1    MKLAALLTSAGVNTAVCVVLFSLYSVLRKQPSFVNVYFGAKIAQVRARQQDAFRFDRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+DEEI A GGLDA+VF R IVFS RIFSIAA +C FLVLPL
Sbjct  61   SPSWILKAWETSDEEICATGGLDAVVFVRMIVFSFRIFSIAAIVCNFLVLPL  112



>emb|CDP00997.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M L+ALLTSAG+N  VCVV F LYS+LRKQP  ++VYFGQKLAH   +R DP CFER VP
Sbjct  1    MYLAALLTSAGINIAVCVVIFSLYSILRKQPRFMNVYFGQKLAHAKSRRQDPFCFERLVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAWE ++++I A GGLDALVF R IVFSIRIFSIAA+IC+ LVLPL
Sbjct  61   SASWIVKAWEASEDQICAAGGLDALVFIRLIVFSIRIFSIAATICISLVLPL  112



>gb|EYU34204.1| hypothetical protein MIMGU_mgv1a001911mg [Erythranthe guttata]
Length=740

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MN+SALLTSAG+NTVVC V F LYSVLRKQP+LVSVYFGQKLA +  KR DP  F R +P
Sbjct  1    MNVSALLTSAGINTVVCGVLFSLYSVLRKQPNLVSVYFGQKLAQVNSKRNDPFWFGRLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAWE +++E+   GG+DA+VF R +VFSIR+F++AA ICLFLVLPL
Sbjct  61   SASWIVKAWEASEDELYVNGGVDAVVFLRAVVFSIRVFTVAAVICLFLVLPL  112



>gb|EPS73081.1| hypothetical protein M569_01675, partial [Genlisea aurea]
Length=164

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+LSALLTSAG+NT V +  F LYSVLRKQPSLVSVYFGQKL     K  DP C+ R VP
Sbjct  1    MDLSALLTSAGINTAVSLALFSLYSVLRKQPSLVSVYFGQKLEQAQSKFQDPFCYWRLVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
              SW MKAWE ++EE+   GG+DA+VF R ++FSIRIF+IAA ICLF VLP 
Sbjct  61   CASWIMKAWEASEEELYVAGGVDAVVFLRAVLFSIRIFTIAAIICLFFVLPF  112



>ref|XP_010320285.1| PREDICTED: CSC1-like protein RXW8 [Solanum lycopersicum]
Length=719

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M L+ALLTSAG+NT V VV F LYSVLRKQPS V+VYFG K+A +  ++ D   F+RFVP
Sbjct  1    MKLAALLTSAGINTAVSVVLFSLYSVLRKQPSFVNVYFGAKIAQVRSRQQDAFRFDRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+DEEI A GGLDA+VF R IVFS RIFSIAA +C FLVLPL
Sbjct  61   SPSWILKAWETSDEEICATGGLDAVVFVRMIVFSFRIFSIAAIVCNFLVLPL  112



>ref|XP_006356826.1| PREDICTED: uncharacterized protein RSN1-like [Solanum tuberosum]
Length=719

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M L+ALLTSAG+NT V VV F LYSVLRKQPS V+VYFG K+A +  ++ D   F+RFVP
Sbjct  1    MKLAALLTSAGINTAVSVVLFSLYSVLRKQPSFVNVYFGAKIAQVRSRQQDAFRFDRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+DEEI A GGLDA+VF R IVFS RIFSIAA +C FLVLPL
Sbjct  61   SPSWILKAWETSDEEICATGGLDAVVFVRMIVFSFRIFSIAAIVCNFLVLPL  112



>gb|AAQ17609.1|AF167425_2 unknown [Solanum lycopersicum]
Length=261

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M L+ALLTSAG+NT V VV F LYSVLRKQPS V+VYFG K+A +  ++ D   F+RFVP
Sbjct  1    MKLAALLTSAGINTAVSVVLFSLYSVLRKQPSFVNVYFGAKIAQVRSRQQDAFRFDRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            SPSW +KAWET+DEEI A GGLDA+VF R
Sbjct  61   SPSWILKAWETSDEEICATGGLDAVVFVR  89



>gb|AFK42839.1| unknown [Lotus japonicus]
Length=169

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ALLTSAG+N  VCVV F  YSVLRKQP  VSVYFG++LA    +R +  C ERFVP
Sbjct  1    MDIAALLTSAGINIAVCVVLFSFYSVLRKQPGNVSVYFGRRLASKHSRRLE-FCLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAW+T+++EI A+GGLDA+VF R +VFSIR+FSIAA IC+ +VLP+
Sbjct  60   SPSWILKAWDTSEDEILAIGGLDAVVFVRILVFSIRVFSIAAVICISIVLPV  111



>ref|XP_008352127.1| PREDICTED: uncharacterized protein LOC103415586 [Malus domestica]
Length=170

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MNL+ALLTSAG+N  VCV+ F LYSVLRKQP  V+VYFG+ ++ +  +R DP C ERFVP
Sbjct  1    MNLAALLTSAGINIAVCVILFSLYSVLRKQPCNVNVYFGRTVS-ITKRRSDPFCLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAW T ++++ AVGGLD++VF R ++FS+RIFSIAA IC+F+VLP+
Sbjct  60   SASWLVKAWRTREDDLLAVGGLDSVVFIRMVIFSLRIFSIAAVICVFIVLPV  111



>ref|XP_007018411.1| Lipases,hydrolases, acting on ester bonds isoform 2 [Theobroma 
cacao]
 gb|EOY15636.1| Lipases,hydrolases, acting on ester bonds isoform 2 [Theobroma 
cacao]
Length=665

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++ ALLTSAG+N  +CVV   LYS+LRKQPS VSVYF ++      KR DP C ERFVP
Sbjct  1    MDIGALLTSAGINIAICVVLLSLYSILRKQPSNVSVYFTRRFVSEPVKRSDPFCLERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW M+AW+ TDEEI AVGG+DA+VF R +VFSIRIFSIAA IC+FLVLP+
Sbjct  61   SASWIMRAWQATDEEILAVGGVDAVVFMRIVVFSIRIFSIAAMICIFLVLPV  112



>gb|KHN36998.1| Putative membrane protein [Glycine soja]
Length=680

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 92/112 (82%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ALLTSAG+N  VCVV F  YSVLRKQPS V+VYFG++LA    +R D LC ERFVP
Sbjct  1    MDIAALLTSAGINIAVCVVLFSFYSVLRKQPSNVNVYFGRRLASQHSRRID-LCLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++EI A+GGLDA+VF R +VFSIR+FSIAA IC  LVLP+
Sbjct  60   SPSWILKAWETSEDEILAIGGLDAVVFVRILVFSIRVFSIAAVICTILVLPV  111



>ref|XP_007018410.1| Lipases,hydrolases, acting on ester bonds isoform 1 [Theobroma 
cacao]
 gb|EOY15635.1| Lipases,hydrolases, acting on ester bonds isoform 1 [Theobroma 
cacao]
Length=724

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++ ALLTSAG+N  +CVV   LYS+LRKQPS VSVYF ++      KR DP C ERFVP
Sbjct  1    MDIGALLTSAGINIAICVVLLSLYSILRKQPSNVSVYFTRRFVSEPVKRSDPFCLERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW M+AW+ TDEEI AVGG+DA+VF R +VFSIRIFSIAA IC+FLVLP+
Sbjct  61   SASWIMRAWQATDEEILAVGGVDAVVFMRIVVFSIRIFSIAAMICIFLVLPV  112



>ref|XP_003556958.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Glycine 
max]
Length=750

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 92/112 (82%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ALLTSAG+N  VCVV F  YSVLRKQPS V+VYFG++LA    +R D LC ERFVP
Sbjct  1    MDIAALLTSAGINIAVCVVLFSFYSVLRKQPSNVNVYFGRRLASQHSRRID-LCLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++EI A+GGLDA+VF R +VFSIR+FSIAA IC  LVLP+
Sbjct  60   SPSWILKAWETSEDEILAIGGLDAVVFVRILVFSIRVFSIAAVICTILVLPV  111



>ref|XP_010664474.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Vitis vinifera]
Length=664

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M L ALLTSAG+N   C +   LYS+LRKQPS VSVYFG++LA   PK  DP CFERFVP
Sbjct  1    MKLYALLTSAGINIAFCAILLSLYSILRKQPSNVSVYFGRRLAQFSPKPHDPFCFERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W +KAWET++EEI +VGG+DA+VF R +VFSIRIF+IAA IC+FLVLP+
Sbjct  61   SPGWMVKAWETSEEEILSVGGMDAVVFLRIVVFSIRIFAIAAIICIFLVLPV  112



>ref|XP_007160961.1| hypothetical protein PHAVU_001G031900g [Phaseolus vulgaris]
 gb|ESW32955.1| hypothetical protein PHAVU_001G031900g [Phaseolus vulgaris]
Length=721

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ALLTSAG+N  VCVV F  YSVLRKQPS V+VYFG+++A    +R D LC ERFVP
Sbjct  1    MDIAALLTSAGINIAVCVVLFSFYSVLRKQPSNVNVYFGRRIASQHSRRID-LCLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++EI A+GGLDA+VF R +VFSIRIFSIAA IC+ LVLP+
Sbjct  60   SPSWILKAWETSEDEILAIGGLDAVVFVRMLVFSIRIFSIAAVICITLVLPV  111



>emb|CBI19350.3| unnamed protein product [Vitis vinifera]
Length=722

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M L ALLTSAG+N   C +   LYS+LRKQPS VSVYFG++LA   PK  DP CFERFVP
Sbjct  1    MKLYALLTSAGINIAFCAILLSLYSILRKQPSNVSVYFGRRLAQFSPKPHDPFCFERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W +KAWET++EEI +VGG+DA+VF R +VFSIRIF+IAA IC+FLVLP+
Sbjct  61   SPGWMVKAWETSEEEILSVGGMDAVVFLRIVVFSIRIFAIAAIICIFLVLPV  112



>ref|XP_007160962.1| hypothetical protein PHAVU_001G031900g [Phaseolus vulgaris]
 gb|ESW32956.1| hypothetical protein PHAVU_001G031900g [Phaseolus vulgaris]
Length=751

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ALLTSAG+N  VCVV F  YSVLRKQPS V+VYFG+++A    +R D LC ERFVP
Sbjct  1    MDIAALLTSAGINIAVCVVLFSFYSVLRKQPSNVNVYFGRRIASQHSRRID-LCLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++EI A+GGLDA+VF R +VFSIRIFSIAA IC+ LVLP+
Sbjct  60   SPSWILKAWETSEDEILAIGGLDAVVFVRMLVFSIRIFSIAAVICITLVLPV  111



>ref|XP_002283520.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Vitis vinifera]
Length=717

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M L ALLTSAG+N   C +   LYS+LRKQPS VSVYFG++LA   PK  DP CFERFVP
Sbjct  1    MKLYALLTSAGINIAFCAILLSLYSILRKQPSNVSVYFGRRLAQFSPKPHDPFCFERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W +KAWET++EEI +VGG+DA+VF R +VFSIRIF+IAA IC+FLVLP+
Sbjct  61   SPGWMVKAWETSEEEILSVGGMDAVVFLRIVVFSIRIFAIAAIICIFLVLPV  112



>ref|XP_007225157.1| hypothetical protein PRUPE_ppa002376mg [Prunus persica]
 gb|EMJ26356.1| hypothetical protein PRUPE_ppa002376mg [Prunus persica]
Length=679

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MNL+ALLTSAG+N  VCV+ F LYS+LRKQPS V+VYFG++++ +  +R DP C +RFVP
Sbjct  1    MNLAALLTSAGINIAVCVILFSLYSILRKQPSNVNVYFGRRIS-IATRRSDPFCLDRFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAW T +E++ AVGGLD++VF R +VFS+RIFSIAA +C+F+VLP+
Sbjct  60   SASWLLKAWRTKEEDLLAVGGLDSVVFIRMVVFSLRIFSIAAVVCVFIVLPV  111



>ref|XP_003545361.2| PREDICTED: uncharacterized membrane protein C24H6.13-like [Glycine 
max]
Length=750

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ALLTSAG+N  VCVV F  YSVLRKQPS V+VYFG++LA    +R D LC ERFVP
Sbjct  1    MDIAALLTSAGINIAVCVVLFSFYSVLRKQPSNVNVYFGRRLASQHSRRID-LCLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++EI A+GGLDA+VF R +VFSI++FSIAA+IC  +VLP+
Sbjct  60   SPSWILKAWETSEDEILAIGGLDAVVFVRILVFSIQVFSIAAAICTVMVLPV  111



>ref|XP_008220418.1| PREDICTED: uncharacterized membrane protein YLR241W [Prunus mume]
Length=738

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MNL+ALLTSAG+N  VCV+ F LYS+LRKQPS V+VYFG++++ +  +R DP C +RFVP
Sbjct  1    MNLAALLTSAGINIAVCVILFSLYSILRKQPSNVNVYFGRRIS-IATRRSDPFCLDRFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAW T +E++ AVGGLD++VF R +VFS+RIFSIAA +C+F+VLP+
Sbjct  60   SASWLLKAWRTKEEDLLAVGGLDSVVFIRMVVFSLRIFSIAAVVCVFIVLPV  111



>ref|XP_007136794.1| hypothetical protein PHAVU_009G074900g [Phaseolus vulgaris]
 gb|ESW08788.1| hypothetical protein PHAVU_009G074900g [Phaseolus vulgaris]
Length=678

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ALLTSAG+N  VCVV F LYS+LRKQPS V+VYFG++LA    K  D LC +RFVP
Sbjct  1    MDIAALLTSAGINIAVCVVLFTLYSILRKQPSNVNVYFGRRLASRRSKSRD-LCLDRFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP+W MKAWETT EE+   GGLDA+VF R +VFSIR+FS+AA IC  LVLP+
Sbjct  60   SPTWVMKAWETTQEEMLTTGGLDAVVFSRMVVFSIRVFSVAAIICTILVLPV  111



>ref|XP_009776499.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Nicotiana sylvestris]
Length=921

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLA-HLGPKRPDPLCFERFV  296
            M LSALLTSAG+N  VCVV F LYS+LRKQP+ V+VYF Q+ A H+  +     CF RFV
Sbjct  1    MKLSALLTSAGINIAVCVVLFFLYSLLRKQPTFVNVYFSQRFAPHVRTRHLGTFCFNRFV  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            PSPSW +KAWE +DEEI A GGLDALV  R IVFS RIFS+AA + LFLVLPL
Sbjct  61   PSPSWILKAWEASDEEIVAAGGLDALVLVRMIVFSFRIFSMAAILGLFLVLPL  113



>ref|XP_010109429.1| putative membrane protein [Morus notabilis]
 gb|EXC22422.1| putative membrane protein [Morus notabilis]
Length=758

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MN+SALLTSAG+N  VC++   LYS+LRKQPS V+VYFG+++A    +R DP CFERFVP
Sbjct  1    MNISALLTSAGINIAVCLILISLYSILRKQPSNVTVYFGRRIASGRSRRTDPFCFERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRT  389
            SPSW ++AW TT+E++ A+GG+DA+VF R+
Sbjct  61   SPSWIVRAWVTTEEDLLAIGGMDAVVFLRS  90



>gb|EPS67708.1| hypothetical protein M569_07066, partial [Genlisea aurea]
Length=235

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MN++ALLTSAG+NT V +    LYS+LRKQ SLVSVYFG KLA    K  DP C  R VP
Sbjct  1    MNIAALLTSAGINTGVSLSLISLYSILRKQRSLVSVYFGHKLAQAQSKCQDPFCSWRLVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAW+ ++EE+ A GG+DA+VF R +V SIR+F +AA ICLF VLPL
Sbjct  61   SASWIVKAWKASEEELYAAGGVDAVVFLRAVVLSIRVFMVAAFICLFFVLPL  112



>ref|XP_004501797.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cicer 
arietinum]
Length=727

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MN++ALLTSAG+N  VCVV F LYS+LRKQPS  +VYFG+KLA    K  D LC ERFVP
Sbjct  1    MNIAALLTSAGINISVCVVLFSLYSILRKQPSNFNVYFGRKLATRCSKNID-LCLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP+W MKAW+T+ +EI  +GGLDA+VF R + FSIR+FS+AA IC  LVLP+
Sbjct  60   SPTWVMKAWDTSQDEILTIGGLDAVVFSRMLTFSIRVFSVAAIICTILVLPV  111



>gb|KHN29744.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=622

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ALLTSAG+N  VCVV F LYSVLRKQPS V VYFG+++A    K  D LC ERFVP
Sbjct  1    MDIAALLTSAGVNIAVCVVLFSLYSVLRKQPSNVRVYFGRRVASRCSKSRD-LCLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP+W MKAWETT +E+ + GGLDA+VF R +VFSIR+FS+AA IC  LVLP+
Sbjct  60   SPTWVMKAWETTQDEMLSTGGLDAVVFSRMVVFSIRVFSVAAVICTTLVLPV  111



>ref|XP_004159572.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Cucumis sativus]
Length=682

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M  SALLTS G+N  +CVV F LYS+LRKQPS ++VYFG+K+A    K  +  C +RFVP
Sbjct  1    MEFSALLTSVGINIGICVVLFSLYSILRKQPSNITVYFGRKIATKKLKHCETFCLDRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET++EEI A+ GLDA+VF R I+FSIR+FSIAA IC+FLVLP+
Sbjct  61   SPSWIVKAWETSEEEILALDGLDAVVFLRIIIFSIRVFSIAAIICMFLVLPV  112



>gb|KHN17195.1| Putative membrane protein [Glycine soja]
Length=701

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 73/89 (82%), Gaps = 1/89 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ALLTSAG+N  VCVV F  YSVLRKQPS V+VYFG++LA    +R D LC ERFVP
Sbjct  1    MDIAALLTSAGINIAVCVVLFSFYSVLRKQPSNVNVYFGRRLASQHSRRID-LCLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            SPSW +KAWET+++EI A+GGLDA+VF R
Sbjct  60   SPSWILKAWETSEDEILAIGGLDAVVFVR  88



>ref|XP_010670325.1| PREDICTED: CSC1-like protein RXW8 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670326.1| PREDICTED: CSC1-like protein RXW8 [Beta vulgaris subsp. vulgaris]
Length=747

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  VC V F LYSVLRKQPS  +VYFG+KLA +   R DP  FERFVP
Sbjct  1    MEISALLTSAGINIGVCCVLFSLYSVLRKQPSNRNVYFGRKLAQMRTTRDDPHWFERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++ I A+GGLDA+V  R +VFSIRIFSIAA +C  +VLPL
Sbjct  61   SPSWILKAWETSEDVILAIGGLDAVVLMRMLVFSIRIFSIAAIVCTAIVLPL  112



>ref|XP_004142910.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN62417.1| hypothetical protein Csa_2G352960 [Cucumis sativus]
Length=743

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M  SALLTS G+N  +CVV F LYS+LRKQPS ++VYFG+K+A    K  +  C +RFVP
Sbjct  1    MEFSALLTSVGINIGICVVLFSLYSILRKQPSNITVYFGRKIATKKLKHCETFCLDRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET++EEI A+ GLDA+VF R I+FSIR+FSIAA IC+FLVLP+
Sbjct  61   SPSWIVKAWETSEEEILALDGLDAVVFLRIIIFSIRVFSIAAIICMFLVLPV  112



>ref|XP_008444513.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Cucumis melo]
Length=742

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M  SALLTS G+N  +CVV F LYS+LRKQPS ++VYFG+K+A    K  +  C +RFVP
Sbjct  1    MEFSALLTSVGINIGICVVLFSLYSILRKQPSNITVYFGRKIATKKLKHCETFCLDRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET++EEI A+ GLDA+VF R IVFSIR+FSIAA+IC+FLVLP+
Sbjct  61   SPSWIVKAWETSEEEILALDGLDAVVFLRIIVFSIRVFSIAATICMFLVLPV  112



>ref|XP_003523635.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Glycine 
max]
Length=744

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ALLTSAG+N  VCVV F LYSVLRKQPS V VYFG+++A    K  D LC ERFVP
Sbjct  1    MDIAALLTSAGVNIAVCVVLFSLYSVLRKQPSNVRVYFGRRVASRCSKSRD-LCLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP+W MKAWETT +E+ + GGLDA+VF R +VFSIR+FS+AA IC  LVLP+
Sbjct  60   SPTWVMKAWETTQDEMLSTGGLDAVVFSRMVVFSIRVFSVAAVICTTLVLPV  111



>gb|AAC34340.1| Hypothetical protein [Arabidopsis thaliana]
Length=246

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++SALLTSAG+N  +CVV   LYS+LRKQP+   VYFG+ L+    KR DP  +ERF P
Sbjct  1    MDVSALLTSAGINIAICVVLVSLYSILRKQPANYCVYFGRLLSDGRVKRHDPRWYERFAP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT+EE+ A  GLDA+VF R ++ SIRIFSI A +CL  VLP+
Sbjct  61   SPSWLVKAWETTEEEMLAAAGLDAVVFIRMVICSIRIFSIVAVVCLAFVLPV  112



>ref|XP_010548610.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Tarenaya hassleriana]
 ref|XP_010548618.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Tarenaya hassleriana]
 ref|XP_010548625.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Tarenaya hassleriana]
Length=775

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MN+SALLTSAG+N  +CVV   LYS+LRKQPS   VYFG++LA+   KR DP  +ERFVP
Sbjct  1    MNISALLTSAGINIAICVVLLSLYSILRKQPSNYCVYFGRRLANGRVKRYDPFWYERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW ++AWET ++E+ A  GLDA+VF R +VFSIR+F IAA +C+ LVLP+
Sbjct  61   SPSWLVRAWETNEDELLAAAGLDAVVFLRMVVFSIRLFFIAAVVCIGLVLPV  112



>ref|XP_010548636.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Tarenaya hassleriana]
Length=764

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MN+SALLTSAG+N  +CVV   LYS+LRKQPS   VYFG++LA+   KR DP  +ERFVP
Sbjct  1    MNISALLTSAGINIAICVVLLSLYSILRKQPSNYCVYFGRRLANGRVKRYDPFWYERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW ++AWET ++E+ A  GLDA+VF R +VFSIR+F IAA +C+ LVLP+
Sbjct  61   SPSWLVRAWETNEDELLAAAGLDAVVFLRMVVFSIRLFFIAAVVCIGLVLPV  112



>ref|XP_002510037.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52224.1| conserved hypothetical protein [Ricinus communis]
Length=731

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ALLTSAG+N  +C+V   LYS+LRKQPS   VYFG++LA +  +  D    ERFVP
Sbjct  1    MDIAALLTSAGINIGLCIVLLSLYSILRKQPSNRVVYFGRRLASVRIRNTDFFSIERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT+EEI A+GGLDAL F R ++FSIR+FSIAA ICL LVLP+
Sbjct  61   SPSWIVKAWETTEEEILAIGGLDALAFQRMLIFSIRVFSIAAVICLLLVLPM  112



>ref|XP_011078463.1| PREDICTED: CSC1-like protein RXW8 [Sesamum indicum]
Length=728

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MN+SALLTSAG+NT +CV  F LYSVLRKQP+LVSVYF +KL     +  D   F R +P
Sbjct  1    MNISALLTSAGINTGICVGAFSLYSVLRKQPNLVSVYFARKLVQEQSRHEDSFWFGRLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAWE +++E+ A GG+DA+VF R +VFS+R+F++AA ICLFLVLPL
Sbjct  61   SASWIVKAWEASEDELYAAGGVDAVVFLRMVVFSLRVFTVAAVICLFLVLPL  112



>ref|XP_009623866.1| PREDICTED: CSC1-like protein RXW8 [Nicotiana tomentosiformis]
Length=887

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 85/113 (75%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLA-HLGPKRPDPLCFERFV  296
            M L ALLTSAG+N  VCVV F LYS+LRKQP+ V+VYF Q+ A H+  +     CF RFV
Sbjct  1    MKLYALLTSAGVNIAVCVVLFFLYSLLRKQPTFVNVYFSQRFAPHVRTRHLGTFCFNRFV  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            PSPSW +KAWE +DEEI A GGLDALV  R IVFS RIFSIAA + LFLVLPL
Sbjct  61   PSPSWILKAWEASDEEIVAAGGLDALVLVRMIVFSFRIFSIAAILGLFLVLPL  113



>ref|XP_010553666.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Tarenaya hassleriana]
Length=762

 Score =   120 bits (302),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 69/112 (62%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++SALLTSAG+N  +CVV   LYS+LRKQP+   VYFG+KLA+   KR DP  +ERFVP
Sbjct  1    MDISALLTSAGINIAICVVLLSLYSILRKQPANYCVYFGRKLANGRVKRYDPFWYERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +++WETT++E+ A  GLDA+VF R +VFSIR+F IAA IC+ LVLP+
Sbjct  61   SPSWLLRSWETTEDELLATAGLDAVVFIRMVVFSIRLFFIAAIICIGLVLPV  112



>ref|XP_009361350.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Pyrus x bretschneideri]
Length=738

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MNL+ALLTSAG+N  VCV+   LYSVLRKQP  V+VYFG+ ++ +  +R DP C ERFVP
Sbjct  1    MNLAALLTSAGINIAVCVILLSLYSVLRKQPCNVNVYFGRTVS-ITKRRSDPFCLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAW T +E++ AVGGLD++VF R ++FS+RIFSIAA IC+F+VLP+
Sbjct  60   SASWLVKAWRTREEDLLAVGGLDSVVFIRMVIFSLRIFSIAAVICVFIVLPV  111



>ref|XP_009361345.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Pyrus x bretschneideri]
Length=778

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MNL+ALLTSAG+N  VCV+   LYSVLRKQP  V+VYFG+ ++ +  +R DP C ERFVP
Sbjct  1    MNLAALLTSAGINIAVCVILLSLYSVLRKQPCNVNVYFGRTVS-ITKRRSDPFCLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAW T +E++ AVGGLD++VF R ++FS+RIFSIAA IC+F+VLP+
Sbjct  60   SASWLVKAWRTREEDLLAVGGLDSVVFIRMVIFSLRIFSIAAVICVFIVLPV  111



>gb|KDP41570.1| hypothetical protein JCGZ_15977 [Jatropha curcas]
Length=736

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++ ALLTSAG+N  +C++ F LYS+LRKQPS   VYFG++LA +  +  D    +RFVP
Sbjct  1    MDIGALLTSAGINIALCILLFSLYSILRKQPSNRVVYFGRRLASVRIRNNDFFSIDRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW  KAWETT+EEI A+GGLDAL F R + F IRIFSIAA ICL LVLP+
Sbjct  61   SPSWIWKAWETTEEEILAIGGLDALAFQRMLTFGIRIFSIAAIICLVLVLPM  112



>ref|XP_002302379.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE81652.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=736

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRP-DPLCFERFV  296
            M++ ALLTSA +NT + V+ F LYS+LRKQPS   VYFG++LA L  +   +   FERFV
Sbjct  1    MDIGALLTSAAINTGLSVLLFSLYSILRKQPSNTIVYFGRRLASLNNRNSRNHFSFERFV  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            PSPSW +KAWETT+ EI A+GGLDA+VF R +VFSIR+FSIAA  CLFLVLP+
Sbjct  61   PSPSWIVKAWETTENEILAIGGLDAVVFQRILVFSIRVFSIAAVTCLFLVLPV  113



>ref|XP_009337131.1| PREDICTED: CSC1-like protein RXW8 isoform X3 [Pyrus x bretschneideri]
Length=628

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MNL+ALLTSAG+N  VCVV F+LYS+LRKQPS V+VYFG+ L  +  +R D    ERFVP
Sbjct  1    MNLAALLTSAGINIAVCVVLFLLYSILRKQPSNVNVYFGRMLT-ISKRRSDLFNLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAW T +E+   VGGLD++VF R ++FS+RIFSIAA IC+F+VLP+
Sbjct  60   SASWLVKAWRTKEEDFLTVGGLDSVVFIRMLIFSLRIFSIAAVICVFIVLPV  111



>ref|XP_011017061.1| PREDICTED: CSC1-like protein RXW8 [Populus euphratica]
 ref|XP_011017062.1| PREDICTED: CSC1-like protein RXW8 [Populus euphratica]
Length=736

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRP-DPLCFERFV  296
            M++ ALLTSA +NT + V+ F LYS+LRKQPS   VYFG++LA L  +   +   FERFV
Sbjct  1    MDIGALLTSAAINTGLSVLLFSLYSILRKQPSNTIVYFGRRLASLNNRNSRNHFSFERFV  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            PSPSW +KAWETT+ EI A+GGLDA+VF R +VFSIR+FSIAA  C+FLVLP+
Sbjct  61   PSPSWIVKAWETTENEILAIGGLDAVVFQRILVFSIRVFSIAAVTCMFLVLPV  113



>ref|XP_004252733.1| PREDICTED: CSC1-like protein RXW8 [Solanum lycopersicum]
 ref|XP_010314599.1| PREDICTED: CSC1-like protein RXW8 [Solanum lycopersicum]
Length=977

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTSAG+N  VCVV  ILYS+LRKQP+ V+VYF Q+ A +  ++     FERFVP
Sbjct  1    MKLSALLTSAGVNIAVCVVLLILYSLLRKQPTFVNVYFSQRFARVRTRQLGGFNFERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWE +D+EI A GGLDA V  R IVFS+RIFSIA ++ LFLV+PL
Sbjct  61   SPSWILKAWEASDDEIVAAGGLDAFVLVRMIVFSVRIFSIATTLGLFLVVPL  112



>ref|XP_002888209.1| hypothetical protein ARALYDRAFT_893642 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64468.1| hypothetical protein ARALYDRAFT_893642 [Arabidopsis lyrata subsp. 
lyrata]
Length=764

 Score =   118 bits (295),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 66/112 (59%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +C+V   LYS+LRKQPS   VYFG++L   G +R DP  +ERFVP
Sbjct  1    MEISALLTSAGINISICIVLLSLYSILRKQPSNYCVYFGRRLVCGGARRYDPFWYERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++E+ A  GLDA+VF R ++FSIRIF I A IC+  VLP+
Sbjct  61   SPSWLVKAWETSEDELLAAAGLDAVVFLRMVLFSIRIFFIVAVICIAFVLPV  112



>ref|XP_010470242.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Camelina sativa]
Length=768

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +C+V   LYS+LRKQPS   VYFG++L   G +R DP  +ERFVP
Sbjct  1    MEISALLTSAGINISICIVLLSLYSILRKQPSNYCVYFGRRLVCGGARRYDPFWYERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++E+ A  GLDA+VF R ++FSIR F I A +C+  VLP+
Sbjct  61   SPSWLVKAWETSEDELLAAAGLDAVVFLRMVLFSIRTFFIVAVVCIVFVLPV  112



>emb|CDY45880.1| BnaC01g28160D [Brassica napus]
Length=716

 Score =   117 bits (294),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 64/112 (57%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +C+V   LYS+LRKQP+   VYFG++L   G +R DP  +ERFVP
Sbjct  1    MEISALLTSAGINISICIVLLSLYSILRKQPANYCVYFGRRLVCGGARRYDPFWYERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++E+ A  GLDA+VF R ++FSIRIF I A +C+  VLP+
Sbjct  61   SPSWLVKAWETSEDELLAAAGLDAVVFLRMVIFSIRIFFITAVVCIAFVLPV  112



>ref|XP_009102869.1| PREDICTED: CSC1-like protein RXW8 [Brassica rapa]
 ref|XP_009102875.1| PREDICTED: CSC1-like protein RXW8 [Brassica rapa]
Length=765

 Score =   117 bits (293),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 64/112 (57%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +C+V   LYS+LRKQP+   VYFG++L   G +R DP  +ERFVP
Sbjct  1    MEISALLTSAGINISICIVLLSLYSILRKQPANYCVYFGRRLVCGGARRYDPFWYERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++E+ A  GLDA+VF R ++FSIRIF I A +C+  VLP+
Sbjct  61   SPSWLVKAWETSEDELLAAAGLDAVVFLRMVIFSIRIFFITAVVCIAFVLPV  112



>ref|XP_009337128.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009337129.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Pyrus x bretschneideri]
Length=764

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MNL+ALLTSAG+N  VCVV F+LYS+LRKQPS V+VYFG+ L  +  +R D    ERFVP
Sbjct  1    MNLAALLTSAGINIAVCVVLFLLYSILRKQPSNVNVYFGRMLT-ISKRRSDLFNLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAW T +E+   VGGLD++VF R ++FS+RIFSIAA IC+F+VLP+
Sbjct  60   SASWLVKAWRTKEEDFLTVGGLDSVVFIRMLIFSLRIFSIAAVICVFIVLPV  111



>ref|XP_009337130.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Pyrus x bretschneideri]
Length=737

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MNL+ALLTSAG+N  VCVV F+LYS+LRKQPS V+VYFG+ L  +  +R D    ERFVP
Sbjct  1    MNLAALLTSAGINIAVCVVLFLLYSILRKQPSNVNVYFGRMLT-ISKRRSDLFNLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAW T +E+   VGGLD++VF R ++FS+RIFSIAA IC+F+VLP+
Sbjct  60   SASWLVKAWRTKEEDFLTVGGLDSVVFIRMLIFSLRIFSIAAVICVFIVLPV  111



>ref|XP_006392284.1| hypothetical protein EUTSA_v10023298mg [Eutrema salsugineum]
 gb|ESQ29570.1| hypothetical protein EUTSA_v10023298mg [Eutrema salsugineum]
Length=765

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +C+V   LYS+LRKQP+   VYFG++L   G +R DP  +ERFVP
Sbjct  1    MEISALLTSAGINISICIVLLSLYSILRKQPANYCVYFGRRLVCGGARRYDPFWYERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++E+ A  GLDA+VF R ++FSIRIF I A +C+  VLP+
Sbjct  61   SPSWLVKAWETSEDELLAAAGLDAVVFLRMVIFSIRIFFITAVVCIAFVLPV  112



>ref|NP_683440.2| protein RXW8 [Arabidopsis thaliana]
 sp|F4IBD7.1|CSCLA_ARATH RecName: Full=CSC1-like protein RXW8 [Arabidopsis thaliana]
 gb|AEE33554.1| lipase/hydrolase [Arabidopsis thaliana]
 gb|AIU34621.1| hyperosmolality-gated Ca2+ permeable channel 2.1 [Arabidopsis 
thaliana]
Length=746

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +C+V   LYS+LRKQP+   VYFG++L   G +R DP  +ERFVP
Sbjct  1    MEISALLTSAGINISICIVLLSLYSILRKQPANYCVYFGRRLVCGGARRYDPFWYERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++E+ A  GLDA+VF R ++FSIRIF I A IC+  VLP+
Sbjct  61   SPSWLVKAWETSEDELLAAAGLDAVVFLRMVIFSIRIFFIVAVICIAFVLPV  112



>ref|XP_004498938.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cicer 
arietinum]
Length=775

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ALLTSAG+N  VCVV F  YS+LRKQPS V+VYFG+        R      ERFVP
Sbjct  1    MDIAALLTSAGINIAVCVVLFSFYSILRKQPSNVNVYFGRXXXXXXXSRHVDFWLERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++EI A+GGLDA+VF R +VFSIR+FSIAA IC+ LVLP+
Sbjct  61   SPSWILKAWETSEDEILAIGGLDAVVFVRILVFSIRVFSIAAVICVILVLPV  112



>ref|XP_006300402.1| hypothetical protein CARUB_v10019848mg [Capsella rubella]
 gb|EOA33300.1| hypothetical protein CARUB_v10019848mg [Capsella rubella]
Length=765

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +C+V   LYS+LRKQP+   VYFG++L   G +R DP  +ERFVP
Sbjct  1    MEISALLTSAGINISICIVLLSLYSILRKQPANYCVYFGRRLVCGGARRYDPFWYERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++E+ A  GLDA+VF R +VFSIR+F I A IC+  VLP+
Sbjct  61   SPSWLVKAWETSEDELLAAAGLDAVVFLRMVVFSIRVFFIVAVICIAFVLPV  112



>ref|XP_010480405.1| PREDICTED: CSC1-like protein At1g10090 [Camelina sativa]
Length=265

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++ ALLTSAG+N  +CVV   LYS+LRKQP+   VYFG+ L+    KR DP  +ERF P
Sbjct  1    MDVGALLTSAGINVAICVVLVSLYSILRKQPANYCVYFGRMLSSGRVKRHDPHWYERFAP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT++E+ A  GLDA+V  R ++ SIRIFSI A +C+  VLP+
Sbjct  61   SPSWLLKAWETTEDEMLAAAGLDAVVLIRMVICSIRIFSIVAVVCIAFVLPV  112



>gb|KJB14673.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
Length=672

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++ ALLTSAG+N  +CVV   LYS+LRKQPS VSVYF ++L     K  DP  FER VP
Sbjct  1    MDIGALLTSAGINIAICVVLLSLYSILRKQPSNVSVYFMRRLISEPIKHSDPFRFERLVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW ++AW+ T+EEI A GG+DALVF R +VFSIR+F IAA IC+FL+LP+
Sbjct  61   SASWIVRAWQATNEEILAAGGVDALVFLRIVVFSIRVFIIAAMICVFLLLPV  112



>emb|CDY44554.1| BnaA01g21850D [Brassica napus]
Length=723

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +C+V   LYS+LRKQP+   VYFG++L   G +R DP  +ERFVP
Sbjct  1    MEISALLTSAGINISICIVLLSLYSILRKQPANYCVYFGRRLVCGGARRYDPFWYERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++E  A  GLDA+VF R ++FSIRIF I A +C+  VLP+
Sbjct  61   SPSWLVKAWETSEDEFLAAAGLDAVVFLRMVIFSIRIFFITAVVCIAFVLPV  112



>emb|CDY27274.1| BnaC04g18540D [Brassica napus]
Length=723

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M ++ALLTSAG+N  +C+V   LYSVLRKQP+   VYFG++L   G +R DP  +ERFVP
Sbjct  1    MEIAALLTSAGINISICIVLLSLYSVLRKQPANYCVYFGRRLVCGGARRYDPFWYERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++E+ A  GLDA+VF R ++FSIRIF I A +C+  VLP+
Sbjct  61   SPSWLVKAWETSEDELLAAAGLDAVVFLRMVIFSIRIFFITAVVCIAFVLPV  112



>dbj|BAD43330.1| unnamed protein product [Arabidopsis thaliana]
Length=762

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++SALLTSAG+N  +CVV   LYS+LRKQP+   VYFG+ L+    KR DP  +ERF P
Sbjct  1    MDVSALLTSAGINIAICVVLVSLYSILRKQPANYCVYFGRLLSDGRVKRHDPRWYERFAP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT+EE+ A  GLDA+VF R ++ SIRIFSI A +CL  VLP+
Sbjct  61   SPSWLVKAWETTEEEMLAAAGLDAVVFIRMVICSIRIFSIVAVVCLAFVLPV  112



>gb|KJB14675.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
Length=808

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++ ALLTSAG+N  +CVV   LYS+LRKQPS VSVYF ++L     K  DP  FER VP
Sbjct  1    MDIGALLTSAGINIAICVVLLSLYSILRKQPSNVSVYFMRRLISEPIKHSDPFRFERLVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW ++AW+ T+EEI A GG+DALVF R +VFSIR+F IAA IC+FL+LP+
Sbjct  61   SASWIVRAWQATNEEILAAGGVDALVFLRIVVFSIRVFIIAAMICVFLLLPV  112



>ref|NP_172480.2| Early-responsive to dehydration stress protein ERD4 [Arabidopsis 
thaliana]
 sp|Q94A87.1|CSCL9_ARATH RecName: Full=CSC1-like protein At1g10090 [Arabidopsis thaliana]
 gb|AAK83615.1| At1g10080/T27I1_10 [Arabidopsis thaliana]
 dbj|BAD44185.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD44218.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE28540.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 gb|AIU34622.1| hyperosmolality-gated Ca2+ permeable channel 2.2 [Arabidopsis 
thaliana]
Length=762

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++SALLTSAG+N  +CVV   LYS+LRKQP+   VYFG+ L+    KR DP  +ERF P
Sbjct  1    MDVSALLTSAGINIAICVVLVSLYSILRKQPANYCVYFGRLLSDGRVKRHDPRWYERFAP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT+EE+ A  GLDA+VF R ++ SIRIFSI A +CL  VLP+
Sbjct  61   SPSWLVKAWETTEEEMLAAAGLDAVVFIRMVICSIRIFSIVAVVCLAFVLPV  112



>gb|KJB14674.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
 gb|KJB14677.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
 gb|KJB14678.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
 gb|KJB14679.1| hypothetical protein B456_002G137000 [Gossypium raimondii]
Length=792

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++ ALLTSAG+N  +CVV   LYS+LRKQPS VSVYF ++L     K  DP  FER VP
Sbjct  1    MDIGALLTSAGINIAICVVLLSLYSILRKQPSNVSVYFMRRLISEPIKHSDPFRFERLVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW ++AW+ T+EEI A GG+DALVF R +VFSIR+F IAA IC+FL+LP+
Sbjct  61   SASWIVRAWQATNEEILAAGGVDALVFLRIVVFSIRVFIIAAMICVFLLLPV  112



>gb|AAM63909.1| unknown [Arabidopsis thaliana]
Length=762

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++SALLTSAG+N  +CVV   LYS+LRKQP+   VYFG+ L+    KR DP  +ERF P
Sbjct  1    MDVSALLTSAGINIAICVVLVSLYSILRKQPANYCVYFGRLLSDGRVKRHDPRWYERFAP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT+EE+ A  GLDA+VF R ++  IRIFSI A +CL  VLP+
Sbjct  61   SPSWLVKAWETTEEEMLAAAGLDAVVFIRMVICIIRIFSIVAVVCLAFVLPV  112



>gb|KHG29773.1| Membrane protein [Gossypium arboreum]
Length=792

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++ ALLTSAG+N  +CVV   LYS+LRKQPS VSVYF ++L     K  DP  FER VP
Sbjct  1    MDIGALLTSAGINIAICVVLLSLYSILRKQPSNVSVYFMRRLISEPIKHSDPFHFERLVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW ++AW+ T+EEI A GG+DALVF R +VFSIRIF IAA+IC+FL+LP+
Sbjct  61   SASWIVRAWQATNEEILAAGGVDALVFLRIVVFSIRIFIIAAAICVFLLLPV  112



>ref|XP_006342673.1| PREDICTED: transmembrane protein 63B-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342674.1| PREDICTED: transmembrane protein 63B-like isoform X2 [Solanum 
tuberosum]
Length=955

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTSAG+N  VCVV  ILYS+LRKQP+ V+VYF Q+ A +  ++     FERFVP
Sbjct  1    MKLSALLTSAGVNISVCVVLLILYSLLRKQPTFVNVYFSQRFARVRTRQLGGFNFERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW  KAWE +D+EI   GGLDA V  R IVFS RIFSIA ++ LFLV+PL
Sbjct  61   SPSWIFKAWEASDDEIVDAGGLDAFVLVRMIVFSFRIFSIATTLGLFLVVPL  112



>ref|XP_009124465.1| PREDICTED: CSC1-like protein RXW8 [Brassica rapa]
Length=765

 Score =   115 bits (287),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 63/112 (56%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M ++ALLTSAG+N  +C+V   LYSVLRKQP+   VYFG++L   G +R DP  +ERFVP
Sbjct  1    MEIAALLTSAGINISICIVLLSLYSVLRKQPANYCVYFGRRLVCGGARRYDPFWYERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++E+    GLDA+VF R ++FSIRIF I A +C+  VLP+
Sbjct  61   SPSWLVKAWETSEDELLTAAGLDAVVFLRMVIFSIRIFFITAVVCIAFVLPV  112



>ref|XP_006303157.1| hypothetical protein CARUB_v10008381mg [Capsella rubella]
 gb|EOA36055.1| hypothetical protein CARUB_v10008381mg [Capsella rubella]
Length=763

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++SALLTSAG+N  +C+V   LYS+LRKQP+   VYFG+ L+    KR DP  +ERF P
Sbjct  1    MDISALLTSAGINIAICIVLVSLYSILRKQPANYCVYFGRMLSSGRVKRHDPHWYERFAP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT++E+ A  GLDA+VF R ++ SIRIFS+ A +C+  VLP+
Sbjct  61   SPSWILKAWETTEDEMLAAAGLDAVVFIRMVICSIRIFSVVAVVCIAFVLPV  112



>gb|KEH39975.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=605

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++ ALLTSAG+N  VCVV F LYS+LRKQPS V+VYF ++LA    ++ D    ERFVP
Sbjct  1    MDIVALLTSAGINIAVCVVIFSLYSILRKQPSNVNVYFARRLASQYSRQVD-FWLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W +KAWET++ EI A+GGLDA+VF R +VFSIR+FSI   IC  LVLP+
Sbjct  60   SPGWILKAWETSENEILAIGGLDAVVFVRIVVFSIRVFSITGVICTVLVLPV  111



>ref|XP_006855764.1| hypothetical protein AMTR_s00044p00184510 [Amborella trichopoda]
 gb|ERN17231.1| hypothetical protein AMTR_s00044p00184510 [Amborella trichopoda]
Length=756

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MN+SALLTSAG+N  +C +   LYSVLRKQP  ++VYFG++LA    K  D    ER VP
Sbjct  1    MNISALLTSAGINIGLCALLLSLYSVLRKQPGNINVYFGRRLAQEHIKHQDSFSLERLVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWE+++EEI ++ GLDA+VF R +VFSIRIFS+AA IC+  VLPL
Sbjct  61   SPSWIVKAWESSEEEILSIAGLDAVVFLRILVFSIRIFSVAAIICMCFVLPL  112



>gb|KEH35861.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=736

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MNL+ALLTSAG+N +VCVV F LYS+LRKQPS V+VYFG++LA       D +  ERFVP
Sbjct  1    MNLAALLTSAGINIIVCVVLFSLYSILRKQPSNVNVYFGRRLATRSSTNVD-ISLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP+W MKA +TT +E+  +GGLDA+ F+R I+FSIR+FS+AA IC  LVLP+
Sbjct  60   SPTWVMKACDTTQDELLNIGGLDAVAFNRMIIFSIRVFSVAAIICNILVLPV  111



>ref|XP_010480404.1| PREDICTED: CSC1-like protein At1g10090 [Camelina sativa]
Length=386

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++ ALLTSAG+N  +CVV   LYS+LRKQP+   VYFG+ L+    KR DP  +ERF P
Sbjct  1    MDVGALLTSAGINVAICVVLVSLYSILRKQPANYCVYFGRMLSSGRVKRHDPHWYERFAP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT++E+ A  GLDA+V  R ++ SIRIFSI A +C+  VLP+
Sbjct  61   SPSWLLKAWETTEDEMLAAAGLDAVVLIRMVICSIRIFSIVAVVCIAFVLPV  112



>emb|CDY20660.1| BnaC08g13980D [Brassica napus]
Length=761

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++SALLTSAG+N  +CVV   LYS+LRKQPS   VYFG+ L+    KR DP  +ERF P
Sbjct  1    MDVSALLTSAGINVGICVVLVSLYSILRKQPSNYCVYFGRMLSGGRVKRNDPRWYERFAP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT++E+ A  GLDA+VF R ++ SIRIFS+ A +C+  VLP+
Sbjct  61   SPSWLVKAWETTEDEMLAAAGLDAVVFIRMVICSIRIFSVVAVVCISFVLPV  112



>ref|XP_009397320.1| PREDICTED: CSC1-like protein RXW8 [Musa acuminata subsp. malaccensis]
 ref|XP_009397321.1| PREDICTED: CSC1-like protein RXW8 [Musa acuminata subsp. malaccensis]
Length=753

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTSAG+N  VC +   LYSVLRKQP  V+VYFG++LA    +  D    ERFVP
Sbjct  1    MKLSALLTSAGINIGVCALLLSLYSVLRKQPGNVNVYFGRRLAEEHGRHRDSYVLERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAW+ T+EEI +  GLDA+VF R IVFSIRIFSIAA IC+F ++PL
Sbjct  61   SPSWIVKAWQYTEEEILSAAGLDAVVFLRAIVFSIRIFSIAAVICVFGIIPL  112



>ref|XP_009144475.1| PREDICTED: CSC1-like protein At1g10090 [Brassica rapa]
 emb|CDY31049.1| BnaA08g25990D [Brassica napus]
Length=761

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++SALLTSAG+N  +CVV   LYS+LRKQPS   VYFG+ L+    KR DP  +ERF P
Sbjct  1    MDVSALLTSAGINIGICVVLVSLYSILRKQPSNYCVYFGRMLSGGRVKRNDPRWYERFAP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT++E+ A  GLDA+VF R ++ SIRIFS+ A +C+  VLP+
Sbjct  61   SPSWLVKAWETTEDEMLAAAGLDAVVFIRMVICSIRIFSVVAVVCISFVLPV  112



>emb|CDY04434.1| BnaA03g59260D [Brassica napus]
Length=765

 Score =   113 bits (283),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 62/112 (55%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M ++ALLTSAG+N  +C+V   LYSVLRKQP+   VYFG++L   G +R DP  +ERFVP
Sbjct  1    MEIAALLTSAGINISICIVLLSLYSVLRKQPANYCVYFGRRLVCGGARRYDPFWYERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +K WET+++E+    GLDA+VF R ++FSIRIF I A +C+  VLP+
Sbjct  61   SPSWLVKTWETSEDELLTAAGLDAVVFLRMVIFSIRIFFITAVVCIAFVLPV  112



>gb|KEH39976.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=768

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++ ALLTSAG+N  VCVV F LYS+LRKQPS V+VYF ++LA    ++ D    ERFVP
Sbjct  1    MDIVALLTSAGINIAVCVVIFSLYSILRKQPSNVNVYFARRLASQYSRQVD-FWLERFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W +KAWET++ EI A+GGLDA+VF R +VFSIR+FSI   IC  LVLP+
Sbjct  60   SPGWILKAWETSENEILAIGGLDAVVFVRIVVFSIRVFSITGVICTVLVLPV  111



>ref|XP_010458341.1| PREDICTED: CSC1-like protein At1g10090 [Camelina sativa]
 ref|XP_010458342.1| PREDICTED: CSC1-like protein At1g10090 [Camelina sativa]
Length=765

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ALLTSAG+N  +C+V   LYS+LRKQP+   VYFG+ L+    KR DP  +ERF P
Sbjct  1    MDVAALLTSAGINVAICIVLVSLYSILRKQPANYCVYFGRMLSSGRVKRHDPHWYERFAP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT+EE+ A  GLDA+V  R ++ SIRIFSI A +C+  VLP+
Sbjct  61   SPSWLLKAWETTEEEMLAAAGLDAVVLIRMVICSIRIFSIVAVVCIAFVLPV  112



>ref|XP_006417497.1| hypothetical protein EUTSA_v10006880mg [Eutrema salsugineum]
 gb|ESQ35850.1| hypothetical protein EUTSA_v10006880mg [Eutrema salsugineum]
Length=764

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++SALLTSAG+N  +CVV   LYS+LRKQP+   VYFG+ L+    KR DPL +ERF P
Sbjct  1    MDISALLTSAGINIAICVVLVSLYSILRKQPANYCVYFGRMLSGGRVKRHDPLWYERFAP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            SPSW +KAWETT++E+ A  GLDA+VF R
Sbjct  61   SPSWLVKAWETTEDEMLASAGLDAVVFIR  89



>ref|XP_010490656.1| PREDICTED: CSC1-like protein At1g10090 [Camelina sativa]
Length=765

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ALLTSAG+N  +C+V   LYS+LRKQP+   VYFG+ L+    KR DP  +ERF P
Sbjct  1    MDVAALLTSAGINVAICIVLVSLYSILRKQPANYCVYFGRMLSSGRVKRHDPHWYERFAP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT+EE+ A  GLDA+V  R ++ SIRIFSI A +C+  VLP+
Sbjct  61   SPSWLLKAWETTEEEMLAAAGLDAVVLIRMVICSIRIFSIVAVVCIAFVLPV  112



>ref|XP_009396675.1| PREDICTED: CSC1-like protein RXW8 [Musa acuminata subsp. malaccensis]
Length=713

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MN+SALLTSAG+N   C +   LYS+LRKQPS + VYFG++L     +  DP   ERFVP
Sbjct  1    MNISALLTSAGINIGFCALFLSLYSILRKQPSNLYVYFGRRLEKENSRYQDPFTLERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W +KAWE T++EI ++GGLDA+VF R  VFSIRIFSI A +C+F VLP+
Sbjct  61   SAGWIVKAWEVTEDEILSIGGLDAVVFLRIFVFSIRIFSITAVVCVFGVLPV  112



>gb|KDO81403.1| hypothetical protein CISIN_1g039780mg [Citrus sinensis]
Length=701

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSA LTS G+N+ + V+ F+LYSVLRKQP  ++VYFG +LA    ++  P    R++P
Sbjct  1    MELSAFLTSVGINSAIAVLLFLLYSVLRKQPGNLNVYFGPRLALASERKNYPPSLLRYLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT+++I A+GG+DALVF R IVFSIRIF IAA IC+FLVLP+
Sbjct  61   SPSWVVKAWETTEDDILALGGMDALVFVRIIVFSIRIFCIAAVICMFLVLPV  112



>ref|XP_006433681.1| hypothetical protein CICLE_v10000392mg [Citrus clementina]
 gb|ESR46921.1| hypothetical protein CICLE_v10000392mg [Citrus clementina]
Length=742

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSA LTS G+N+ + V+ F+LYSVLRKQP  ++VYFG +LA    ++  P    R++P
Sbjct  1    MELSAFLTSVGINSAIAVLLFLLYSVLRKQPGNLNVYFGPRLALASERKNYPPSLLRYLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT+++I A+GG+DALVF R IVFSIRIF IAA IC+FLVLP+
Sbjct  61   SPSWVVKAWETTEDDILALGGMDALVFVRIIVFSIRIFCIAAVICMFLVLPV  112



>ref|XP_006472346.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Citrus sinensis]
 ref|XP_006472347.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Citrus sinensis]
Length=742

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSA LTS G+N+ + V+ F+LYSVLRKQP  ++VYFG +LA    ++  P    R++P
Sbjct  1    MELSAFLTSVGINSAIAVLLFLLYSVLRKQPGNLNVYFGPRLALASERQNYPPSLLRYLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT+++I A+GG+DALVF R IVFSIRIF IAA IC+FLVLP+
Sbjct  61   SPSWVVKAWETTEDDILALGGMDALVFVRIIVFSIRIFCIAAVICMFLVLPV  112



>gb|KJB58719.1| hypothetical protein B456_009G222800 [Gossypium raimondii]
Length=733

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ LLTSAG+N  VCVV F LYSVLRKQPS   VYF ++      +  DP    RFVP
Sbjct  1    MDVADLLTSAGINISVCVVAFSLYSVLRKQPSNACVYFTRRYISETIRHDDPFSLHRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W M+AW  TDEEI   GG+DA+VF R +V SIRIF IAA IC+FLVLP+
Sbjct  61   SAGWIMQAWRATDEEILEAGGIDAVVFMRIVVLSIRIFIIAAVICVFLVLPV  112



>gb|KJB58718.1| hypothetical protein B456_009G222800 [Gossypium raimondii]
Length=734

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+++ LLTSAG+N  VCVV F LYSVLRKQPS   VYF ++      +  DP    RFVP
Sbjct  1    MDVADLLTSAGINISVCVVAFSLYSVLRKQPSNACVYFTRRYISETIRHDDPFSLHRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W M+AW  TDEEI   GG+DA+VF R +V SIRIF IAA IC+FLVLP+
Sbjct  61   SAGWIMQAWRATDEEILEAGGIDAVVFMRIVVLSIRIFIIAAVICVFLVLPV  112



>ref|XP_002892546.1| hypothetical protein ARALYDRAFT_471124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68805.1| hypothetical protein ARALYDRAFT_471124 [Arabidopsis lyrata subsp. 
lyrata]
Length=761

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++S+LLTSAG+N   CVV   LYS+LRKQP+   VYFG+ L+    KR DP  +ERF P
Sbjct  1    MDVSSLLTSAGINIGTCVVLVSLYSILRKQPANYCVYFGRLLSDGRVKRHDPRWYERFAP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWETT++E+ A  GLDA+VF R ++ SIRIFSI A +C+  VLP+
Sbjct  61   SPSWLVKAWETTEDEMLASAGLDAVVFIRMVICSIRIFSIVAVVCIAFVLPV  112



>ref|XP_010943525.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Elaeis guineensis]
Length=663

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +C +   LYSVLRKQP  VSVYFG++LA    +  D    ERFVP
Sbjct  1    MKISALLTSAGINIGLCALFLSLYSVLRKQPGNVSVYFGRRLAQEHSRYRDSFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KA++  +EEI ++ GLDA+VF R +VFSIRIFSIAA +C+F +LPL
Sbjct  61   SPSWIVKAYQYKEEEILSIAGLDAVVFLRLVVFSIRIFSIAAVVCVFGILPL  112



>ref|XP_011458884.1| PREDICTED: CSC1-like protein RXW8 [Fragaria vesca subsp. vesca]
Length=742

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+L+AL TSAG+N  VCV  F LYS+LRKQPS   VYFG++L+ +G ++   LC +RFVP
Sbjct  1    MDLNALGTSAGINIGVCVGVFSLYSILRKQPSQARVYFGRRLS-IGARKCTALCLDRFVP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAW+TTDEEI    GLD++VF R IVFS+RIFSIAA  C+ +VLP+
Sbjct  60   SASWIVKAWKTTDEEILNNVGLDSVVFVRIIVFSLRIFSIAAVTCILIVLPV  111



>ref|XP_010943516.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Elaeis guineensis]
Length=755

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +C +   LYSVLRKQP  VSVYFG++LA    +  D    ERFVP
Sbjct  1    MKISALLTSAGINIGLCALFLSLYSVLRKQPGNVSVYFGRRLAQEHSRYRDSFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KA++  +EEI ++ GLDA+VF R +VFSIRIFSIAA +C+F +LPL
Sbjct  61   SPSWIVKAYQYKEEEILSIAGLDAVVFLRLVVFSIRIFSIAAVVCVFGILPL  112



>gb|KJB64003.1| hypothetical protein B456_010G028700 [Gossypium raimondii]
Length=530

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPL-CFERFV  296
            M++S LLTSAG+N  +CVV   LYS+LRKQP    VYF ++L     +    + CFERFV
Sbjct  1    MDVSDLLTSAGINIAICVVLLSLYSILRKQPGNACVYFTRRLVSEPVRGTGAISCFERFV  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            PS  W  KAW+ TDEEI AVGG+DA+ F R +VFSIR+F IAA ICLF+VLP+
Sbjct  61   PSTGWIAKAWQATDEEILAVGGVDAVAFMRIVVFSIRVFIIAAVICLFIVLPV  113



>ref|XP_008798900.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Phoenix dactylifera]
 ref|XP_008798901.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Phoenix dactylifera]
 ref|XP_008798902.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Phoenix dactylifera]
Length=755

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M + ALLTSAG+N  +C +   LYSVLRKQP  VSVYFG++LA    +  D    ERFVP
Sbjct  1    MKIYALLTSAGINIGLCALFLSLYSVLRKQPGNVSVYFGRRLAQEHGRYRDSFSLERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KA + T+EEI ++ GLDA+VF R +VFSIRIFSIAA +C+F +LPL
Sbjct  61   SPSWIVKACQYTEEEILSIAGLDAVVFLRLVVFSIRIFSIAAVVCVFGILPL  112



>ref|XP_008798903.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Phoenix dactylifera]
Length=752

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M + ALLTSAG+N  +C +   LYSVLRKQP  VSVYFG++LA    +  D    ERFVP
Sbjct  1    MKIYALLTSAGINIGLCALFLSLYSVLRKQPGNVSVYFGRRLAQEHGRYRDSFSLERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KA + T+EEI ++ GLDA+VF R +VFSIRIFSIAA +C+F +LPL
Sbjct  61   SPSWIVKACQYTEEEILSIAGLDAVVFLRLVVFSIRIFSIAAVVCVFGILPL  112



>gb|KJB64004.1| hypothetical protein B456_010G028700 [Gossypium raimondii]
Length=736

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPL-CFERFV  296
            M++S LLTSAG+N  +CVV   LYS+LRKQP    VYF ++L     +    + CFERFV
Sbjct  1    MDVSDLLTSAGINIAICVVLLSLYSILRKQPGNACVYFTRRLVSEPVRGTGAISCFERFV  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            PS  W  KAW+ TDEEI AVGG+DA+ F R +VFSIR+F IAA ICLF+VLP+
Sbjct  61   PSTGWIAKAWQATDEEILAVGGVDAVAFMRIVVFSIRVFIIAAVICLFIVLPV  113



>gb|KJB64002.1| hypothetical protein B456_010G028700 [Gossypium raimondii]
Length=758

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPL-CFERFV  296
            M++S LLTSAG+N  +CVV   LYS+LRKQP    VYF ++L     +    + CFERFV
Sbjct  1    MDVSDLLTSAGINIAICVVLLSLYSILRKQPGNACVYFTRRLVSEPVRGTGAISCFERFV  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            PS  W  KAW+ TDEEI AVGG+DA+ F R +VFSIR+F IAA ICLF+VLP+
Sbjct  61   PSTGWIAKAWQATDEEILAVGGVDAVAFMRIVVFSIRVFIIAAVICLFIVLPV  113



>ref|XP_010061607.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Eucalyptus grandis]
 ref|XP_010061608.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Eucalyptus grandis]
Length=743

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MN+SALLTSAG+N  +CVV  +LYS+LRKQPS   VYF ++LA    KR D L F+RFVP
Sbjct  1    MNISALLTSAGINIGLCVVLLLLYSLLRKQPSNFCVYFVRRLAQARQKRTDSLWFDRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++EI +  GLDA+VF R +VFS+R+FSIAA +C+FLVLPL
Sbjct  61   SPSWILKAWETSEDEILSTAGLDAVVFIRILVFSLRVFSIAAFVCMFLVLPL  112



>gb|KCW68598.1| hypothetical protein EUGRSUZ_F02209 [Eucalyptus grandis]
Length=723

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MN+SALLTSAG+N  +CVV  +LYS+LRKQPS   VYF ++LA    KR D L F+RFVP
Sbjct  1    MNISALLTSAGINIGLCVVLLLLYSLLRKQPSNFCVYFVRRLAQARQKRTDSLWFDRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++EI +  GLDA+VF R +VFS+R+FSIAA +C+FLVLPL
Sbjct  61   SPSWILKAWETSEDEILSTAGLDAVVFIRILVFSLRVFSIAAFVCMFLVLPL  112



>ref|XP_010061609.1| PREDICTED: CSC1-like protein RXW8 isoform X2 [Eucalyptus grandis]
 gb|KCW68599.1| hypothetical protein EUGRSUZ_F02209 [Eucalyptus grandis]
Length=734

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            MN+SALLTSAG+N  +CVV  +LYS+LRKQPS   VYF ++LA    KR D L F+RFVP
Sbjct  1    MNISALLTSAGINIGLCVVLLLLYSLLRKQPSNFCVYFVRRLAQARQKRTDSLWFDRFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +KAWET+++EI +  GLDA+VF R +VFS+R+FSIAA +C+FLVLPL
Sbjct  61   SPSWILKAWETSEDEILSTAGLDAVVFIRILVFSLRVFSIAAFVCMFLVLPL  112



>ref|XP_006471294.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Citrus 
sinensis]
Length=712

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++SALLTSAG+N  V  +   +YS+LRKQPS +SVYFG++LA +G +  D    ERF  
Sbjct  1    MDVSALLTSAGINISVTSLLLSVYSILRKQPSNLSVYFGKRLASVGNRLDDSFSLERFAS  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAWET+++EI A+GG+DA++  R IVFSIRIFSIAA IC+ LVLP+
Sbjct  61   SSSWIVKAWETSEDEILAIGGMDAVIIIRIIVFSIRIFSIAAIICILLVLPV  112



>ref|NP_001168247.1| hypothetical protein [Zea mays]
 gb|ACN27575.1| unknown [Zea mays]
Length=703

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +  LLTSAG+N  +CV+   LYS+LRKQP  V VYFG+++A    +  D    ERFVP
Sbjct  1    MKVGGLLTSAGINIGLCVLFLSLYSILRKQPQNVKVYFGRRIAEEHNRLRDAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +K+   T+EEI A  GLDA+VF+R +VFSIRIFS+AA +C+F VLPL
Sbjct  61   SPSWIVKSLRCTEEEILATAGLDAVVFNRILVFSIRIFSLAAILCVFGVLPL  112



>ref|XP_008643723.1| PREDICTED: uncharacterized protein LOC100382010 isoform X1 [Zea 
mays]
 tpg|DAA50528.1| TPA: hypothetical protein ZEAMMB73_928437 [Zea mays]
 tpg|DAA50529.1| TPA: hypothetical protein ZEAMMB73_928437 [Zea mays]
Length=765

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +  LLTSAG+N  +CV+   LYS+LRKQP  V VYFG+++A    +  D    ERFVP
Sbjct  1    MKVGGLLTSAGINIGLCVLFLSLYSILRKQPQNVKVYFGRRIAEEHNRLRDAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +K+   T+EEI A  GLDA+VF+R +VFSIRIFS+AA +C+F VLPL
Sbjct  61   SPSWIVKSLRCTEEEILATAGLDAVVFNRILVFSIRIFSLAAILCVFGVLPL  112



>ref|XP_010274545.1| PREDICTED: uncharacterized protein LOC104609841, partial [Nelumbo 
nucifera]
Length=573

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +CV+   LYSVLRKQP+ V VYFG++LA    KR + +C +R VP
Sbjct  1    MKVSALLTSAGINIGMCVLLLSLYSVLRKQPANVCVYFGRRLAQENIKRNEFICLKRLVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAWET+++EI A+GGLDA+VF R +VFSIR+FSIAA++C+ LVLPL
Sbjct  61   SLSWILKAWETSEDEILAIGGLDAVVFFRILVFSIRVFSIAATVCILLVLPL  112



>tpg|DAA54769.1| TPA: hypothetical protein ZEAMMB73_421656 [Zea mays]
Length=586

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +CV+   LYSVLRKQP+ V VYFG+++A    +       ERFVP
Sbjct  1    MKISALLTSAGINIGLCVLFLSLYSVLRKQPANVRVYFGRRIAEEHDRLRGAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W +KA + T+EEI A  GLDA+VF+R +VFSIRIFS+AA +C+F +LPL
Sbjct  61   STGWIVKALQCTEEEILAAAGLDAVVFNRILVFSIRIFSLAAVLCVFGILPL  112



>ref|XP_004963302.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Setaria 
italica]
 ref|XP_004963303.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Setaria 
italica]
 ref|XP_004963304.1| PREDICTED: uncharacterized protein RSN1-like isoform X3 [Setaria 
italica]
Length=763

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +CV+   LYSVLRKQP+ V VYFG+++A    +       ERFVP
Sbjct  1    MKISALLTSAGINIGLCVLFLSLYSVLRKQPANVRVYFGRRIAEENERLRGAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W +KA + T+EEI A  GLDA+VF+R +VFSIRIFS+AA +C+F +LPL
Sbjct  61   STGWIVKALQCTEEEILAAAGLDAVVFNRILVFSIRIFSLAAILCVFGILPL  112



>ref|XP_006432542.1| hypothetical protein CICLE_v10000536mg [Citrus clementina]
 gb|ESR45782.1| hypothetical protein CICLE_v10000536mg [Citrus clementina]
Length=653

 Score =   102 bits (254),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 65/112 (58%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M++SALLTSAG+N  V  +   +YS+LRKQPS +SVYFG++LA +G +  D    ERF  
Sbjct  1    MDVSALLTSAGINISVTSLLLSVYSILRKQPSNLSVYFGKRLASVGNRLDDSFSLERFAS  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAWET+++EI A+GG+DA++  R IVFSIRIFSIAA IC+ LVLP+
Sbjct  61   SSSWIVKAWETSEDEILAIGGMDAVIIIRIIVFSIRIFSIAAIICILLVLPV  112



>ref|XP_008674128.1| PREDICTED: uncharacterized protein LOC103650301 isoform X1 [Zea 
mays]
 ref|XP_008674129.1| PREDICTED: uncharacterized protein LOC103650301 isoform X1 [Zea 
mays]
Length=767

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +CV+   LYSVLRKQP+ V VYFG+++A    +       ERFVP
Sbjct  1    MKISALLTSAGINIGLCVLFLSLYSVLRKQPANVRVYFGRRIAEEHDRLRGAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W +KA + T+EEI A  GLDA+VF+R +VFSIRIFS+AA +C+F +LPL
Sbjct  61   STGWIVKALQCTEEEILAAAGLDAVVFNRILVFSIRIFSLAAVLCVFGILPL  112



>ref|XP_006664233.1| PREDICTED: uncharacterized protein RSN1-like [Oryza brachyantha]
Length=764

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +S LLTSAG+N  +CV+   LYSVLRKQP+ V VYFG+++A    +  +    ERFVP
Sbjct  1    MKISGLLTSAGINIGLCVLFLSLYSVLRKQPANVRVYFGRRIAQEHNRLREAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W +KA + T+EEI A  GLDA+VF+R +VFSIRIFS+AA +C+F +LPL
Sbjct  61   STGWIVKALQCTEEEILAAAGLDAVVFNRILVFSIRIFSLAALLCVFGILPL  112



>ref|XP_002443649.1| hypothetical protein SORBIDRAFT_08g022840 [Sorghum bicolor]
 gb|EES17487.1| hypothetical protein SORBIDRAFT_08g022840 [Sorghum bicolor]
Length=767

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +CV+   LYSVLRKQP+ V VYFG+++A    +       ERFVP
Sbjct  1    MKISALLTSAGINIGLCVLFLSLYSVLRKQPANVRVYFGRRIAEEHDRLRGGFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W +KA + T+EEI A  GLDA+VF+R +VFS+RIFS+AA +C+F +LPL
Sbjct  61   STGWIVKALQCTEEEILAAAGLDAVVFNRILVFSMRIFSLAAVLCVFGILPL  112



>ref|XP_002463956.1| hypothetical protein SORBIDRAFT_01g009540 [Sorghum bicolor]
 gb|EER90954.1| hypothetical protein SORBIDRAFT_01g009540 [Sorghum bicolor]
Length=677

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDP-LCFERFV  296
            M  SALLTSAG+N  VCV+   LYSVLRKQP   SVYFG++LA    +R D    FER +
Sbjct  1    MEFSALLTSAGINIAVCVLFLSLYSVLRKQPHNFSVYFGRRLAEEKFQRQDDYFSFERLL  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W +KA+  T+EEI  V GLD++VF R  +FSIRIFSI + +C+F+VLP+
Sbjct  61   PTAGWIVKAYWCTEEEIRQVAGLDSVVFLRLFIFSIRIFSITSLVCIFVVLPV  113



>ref|XP_003561326.1| PREDICTED: CSC1-like protein At1g10090 isoform X2 [Brachypodium 
distachyon]
Length=700

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M + ALLTSAG+N  +CV+    YS+LRKQP  V VYFG+++A    +       ERFVP
Sbjct  1    MKVGALLTSAGINIGLCVLFLSFYSILRKQPQNVKVYFGRRIAEEHKRLRGAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +++ + T+EE+ A  GLDA+VF+R +VFSIRIFS+AA +C+F +LPL
Sbjct  61   SPSWIVRSLQITEEEMLATAGLDAVVFNRILVFSIRIFSLAAILCIFGILPL  112



>ref|XP_003561325.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Brachypodium distachyon]
Length=762

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M + ALLTSAG+N  +CV+    YS+LRKQP  V VYFG+++A    +       ERFVP
Sbjct  1    MKVGALLTSAGINIGLCVLFLSFYSILRKQPQNVKVYFGRRIAEEHKRLRGAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +++ + T+EE+ A  GLDA+VF+R +VFSIRIFS+AA +C+F +LPL
Sbjct  61   SPSWIVRSLQITEEEMLATAGLDAVVFNRILVFSIRIFSLAAILCIFGILPL  112



>ref|XP_010231660.1| PREDICTED: CSC1-like protein RXW8 isoform X3 [Brachypodium distachyon]
Length=692

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M + ALLTSAG+N  +CV+    YS+LRKQP  V VYFG+++A    +       ERFVP
Sbjct  1    MKVGALLTSAGINIGLCVLFLSFYSILRKQPQNVKVYFGRRIAEEHKRLRGAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +++ + T+EE+ A  GLDA+VF+R +VFSIRIFS+AA +C+F +LPL
Sbjct  61   SPSWIVRSLQITEEEMLATAGLDAVVFNRILVFSIRIFSLAAILCIFGILPL  112



>gb|EMT10348.1| Putative membrane protein [Aegilops tauschii]
Length=818

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M + ALLTSAG+N  +C++    YSVLRKQP  V VYFG+++A    +       ERFVP
Sbjct  1    MKVGALLTSAGINIGLCILFLSFYSVLRKQPQNVKVYFGRRIAEQHKRLRGAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +++ + T++EI +  GLDA+VF+R +VFSIRIFS+AA +CLF VLPL
Sbjct  61   SPSWIVRSLQCTEDEIVSTAGLDAVVFNRVLVFSIRIFSLAAILCLFGVLPL  112



>gb|EMS66678.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=760

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SAL+TSAG+N  +CV+ + LYSVLRKQP+ V VYFG+++A       +    ERFVP
Sbjct  1    MKISALMTSAGINIGICVLLWSLYSVLRKQPAFVRVYFGRRIAEENRLLREAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W +KA + T+EE+ A  GLDA+ F+R +VFSIRIFS+AA +CLF +LP+
Sbjct  61   STGWIVKALQCTEEELLAAAGLDAVAFNRMLVFSIRIFSLAAILCLFGILPV  112



>ref|XP_004982193.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X3 [Setaria italica]
Length=700

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +  LLTSAG+N  +CV+   LYS+LRKQP  V VYFG+++A    +  D    ERFVP
Sbjct  1    MKVGGLLTSAGINIGLCVLFLSLYSILRKQPQNVKVYFGRRIAEEHNRLRDAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +K+   T++EI    GLDA+VF+R +VFSIRIFS+AA +C+F VLPL
Sbjct  61   SPSWIVKSLRCTEDEILDTAGLDAVVFNRIMVFSIRIFSLAAILCVFGVLPL  112



>ref|XP_004982191.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Setaria italica]
 ref|XP_004982192.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Setaria italica]
Length=762

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +  LLTSAG+N  +CV+   LYS+LRKQP  V VYFG+++A    +  D    ERFVP
Sbjct  1    MKVGGLLTSAGINIGLCVLFLSLYSILRKQPQNVKVYFGRRIAEEHNRLRDAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +K+   T++EI    GLDA+VF+R +VFSIRIFS+AA +C+F VLPL
Sbjct  61   SPSWIVKSLRCTEDEILDTAGLDAVVFNRIMVFSIRIFSLAAILCVFGVLPL  112



>dbj|BAJ92039.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=778

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M + ALLTSAG+N  +C++    YS+LRKQP  V VYFG+++A    +       ERFVP
Sbjct  1    MKVGALLTSAGINIGLCILFLSFYSILRKQPQNVKVYFGRRIAEQHKRLRGAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW +++ + T++EI +  GLDA+VF+R +VFSIRIFS+AA +CLF VLPL
Sbjct  61   SPSWIVRSLQCTEDEILSTAGLDAVVFNRVLVFSIRIFSLAAILCLFGVLPL  112



>ref|XP_008644541.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 ref|XP_008644542.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 gb|AFW67743.1| hypothetical protein ZEAMMB73_500032 [Zea mays]
Length=749

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDP-LCFERFV  296
            M  SALLTSAG+N  VCV+   LYS+LRKQP   SVYFG++LA    +R D    FER +
Sbjct  1    MEFSALLTSAGINIAVCVLFLSLYSILRKQPHNFSVYFGRRLAEERFQRQDDYFSFERLL  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W +KA+  T+EEI  V GLD++VF R  +FSIRIFSI + +C+F+VLP+
Sbjct  61   PTAGWIVKAYWCTEEEIRQVAGLDSVVFLRLFIFSIRIFSITSLVCVFVVLPV  113



>dbj|BAJ86319.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=676

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +CV+   LYSVLRKQP+ V VYFG++++    +  +    ERFVP
Sbjct  1    MKISALLTSAGINIGLCVLFLSLYSVLRKQPANVRVYFGRRISEEHSRLREAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W +KA   T+EE+ A  GLDA+ F+R +VFSIRIFS+AA +C+F +LPL
Sbjct  61   STGWIVKALRYTEEEVLAAAGLDAVAFNRMLVFSIRIFSLAALLCVFGILPL  112



>ref|XP_004981918.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Setaria italica]
 ref|XP_004981919.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Setaria italica]
Length=746

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDP-LCFERFV  296
            M  SALLTSAG+N  VCV+   LYSVLRKQP   SVYFG++LA    +R D    FER +
Sbjct  1    MEFSALLTSAGINIAVCVLFLSLYSVLRKQPHNFSVYFGRRLAEEKFQRQDDYFSFERLL  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W +KA+  T+EEI  V GLD++VF R  +FSIRIFSI + +C+F VLP+
Sbjct  61   PTAGWIVKAYWCTEEEIRQVAGLDSVVFLRLFIFSIRIFSITSLVCIFGVLPV  113



>ref|NP_001067352.1| Os12g0633600 [Oryza sativa Japonica Group]
 gb|ABA99948.1| early-responsive to dehydration protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF30371.1| Os12g0633600 [Oryza sativa Japonica Group]
 dbj|BAG96127.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70433.1| hypothetical protein OsI_01443 [Oryza sativa Indica Group]
 gb|EEE65270.1| hypothetical protein OsJ_20480 [Oryza sativa Japonica Group]
 gb|AIU34632.1| hyperosmolality-gated Ca2+ permeable channel 2.1 [Oryza sativa]
Length=763

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +S LLTSAG+N  + V+   LYSVLRKQP+ V VYFG+++A    +  +    ERFVP
Sbjct  1    MKISGLLTSAGINIALSVLFISLYSVLRKQPANVRVYFGRRIAEEHNRLREAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W +KA + T+EEI A  GLDA+VF+R +VFS+RIFS+AA +C+F +LPL
Sbjct  61   STGWIVKALQCTEEEILAAAGLDAVVFNRILVFSLRIFSLAAILCVFGILPL  112



>gb|EMT19397.1| Putative membrane protein [Aegilops tauschii]
Length=786

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +CV+   LYSVLRKQP+ V VYFG++++    +  +    ERFVP
Sbjct  1    MKISALLTSAGINIGLCVLFLSLYSVLRKQPANVRVYFGRRISEEHSRLREAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W +KA   T+EE+ A  GLDA+ F+R +VFSIRIFS+AA +C+F +LPL
Sbjct  61   STGWIVKALRYTEEEVLAAAGLDAVAFNRMLVFSIRIFSLAALLCVFGILPL  112



>ref|XP_010936200.1| PREDICTED: CSC1-like protein RXW8 [Elaeis guineensis]
Length=744

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = +3

Query  111  WTKMNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFER  290
            +  M+LS LLTSAG+N  +C +   LYSV RKQP  V VYFG++L+    K  +    ER
Sbjct  11   YLSMDLSRLLTSAGINIGICALFLSLYSVFRKQPGNVYVYFGRRLSQEDGKLQNINALER  70

Query  291  FVPSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            FVPS SW +KAW+ T++E+ +  G+DA+VF R +VFSIRIFSIA  +C+F VLP+
Sbjct  71   FVPSASWIVKAWQITEDELLSFAGIDAVVFLRVLVFSIRIFSIATVVCIFGVLPV  125



>gb|KHG12367.1| Membrane protein [Gossypium arboreum]
Length=703

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 62/91 (68%), Gaps = 3/91 (3%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRP--DPLCFERF  293
            M++S LLTSAG+N  +CVV   LYS+LRKQP    VYF ++L    P R   D  CFERF
Sbjct  1    MDVSDLLTSAGINIAICVVLLSLYSILRKQPGNACVYFTRRLVS-EPVRGTGDISCFERF  59

Query  294  VPSPSWFMKAWETTDEEINAVGGLDALVFDR  386
            VPS  W  KAW+ TDEEI AVGG+DA+ F R
Sbjct  60   VPSTGWIAKAWQATDEEILAVGGVDAVAFMR  90



>dbj|BAJ90247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SAL+TSAG+N  +CV+ + LYSVLRKQP+ V VYFG+++A       +    ERFVP
Sbjct  1    MKISALMTSAGINIGLCVLFWSLYSVLRKQPAFVRVYFGRRIAEENRLLREAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W +KA + T+E++ A  GLDA+ F+R +VFSIRIFS+AA +CLF +LP+
Sbjct  61   STGWIVKALQCTEEDLLAAAGLDAVAFNRMLVFSIRIFSLAAILCLFGILPV  112



>ref|XP_002464091.1| hypothetical protein SORBIDRAFT_01g012190 [Sorghum bicolor]
 gb|EER91089.1| hypothetical protein SORBIDRAFT_01g012190 [Sorghum bicolor]
Length=783

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +  LLTSAG+N  +CV+   LYS+LRKQP  V VYFG+++A    +  D    ERFVP
Sbjct  1    MKVGGLLTSAGINIGLCVLFLSLYSILRKQPQNVKVYFGRRIAEEHNRLRDAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            SPSW +K+   T+EEI A  GLDA+VF+R
Sbjct  61   SPSWIVKSLRCTEEEILATAGLDAVVFNR  89



>ref|XP_003575997.1| PREDICTED: CSC1-like protein RXW8 [Brachypodium distachyon]
 ref|XP_010236974.1| PREDICTED: CSC1-like protein RXW8 [Brachypodium distachyon]
Length=764

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M + ALLTSAG+N  +CV+   LYSVLRKQP+ V VYFG+++A    +       ERFVP
Sbjct  1    MKIKALLTSAGINIGLCVLFLSLYSVLRKQPANVRVYFGRRIAEEHNRVRGAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W +KA + T+EE+ A  GLDA+ F+R +VFS+RIFS+AA +C+F +LPL
Sbjct  61   STGWIVKALQCTEEEMLAAAGLDAVAFNRMLVFSMRIFSLAALLCVFGILPL  112



>ref|XP_008790275.1| PREDICTED: CSC1-like protein RXW8 [Phoenix dactylifera]
Length=733

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M+LS LLTSAG+N  +C +   LYSV RKQP  V VYFG++L+    +R +    ER VP
Sbjct  1    MDLSRLLTSAGINIGICALFLSLYSVFRKQPGNVYVYFGRRLSQEDGERRNINALERLVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +KAW+ T++E+ +  G+DA+VF R +VFSIRIFSIA  +C+F VLP+
Sbjct  61   SASWIVKAWQITEDELLSFAGVDAVVFLRVLVFSIRIFSIAMVVCIFGVLPV  112



>gb|AAR87202.1| expressed protein (with alternative splicing) [Oryza sativa Japonica 
Group]
 gb|EEE59670.1| hypothetical protein OsJ_12072 [Oryza sativa Japonica Group]
Length=777

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M + ALLTSAG+N  +C++   LYSVLRKQP  V VYFG+++A    +  +    ERFVP
Sbjct  1    MKVGALLTSAGINISLCILFLSLYSVLRKQPQNVKVYFGRRIAEENSRLREAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +++   T++E+ A  GLDA+VF+R +VFSIRIFS+AA +C+  VLPL
Sbjct  61   SASWILRSLRCTEDELLATAGLDAVVFNRILVFSIRIFSLAAFLCVLGVLPL  112



>gb|EEC75908.1| hypothetical protein OsI_12978 [Oryza sativa Indica Group]
Length=777

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M + ALLTSAG+N  +C++   LYSVLRKQP  V VYFG+++A    +  +    ERFVP
Sbjct  1    MKVGALLTSAGINISLCILFLSLYSVLRKQPQNVKVYFGRRIAEENSRLREAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +++   T++E+ A  GLDA+VF+R +VFSIRIFS+AA +C+  VLPL
Sbjct  61   SASWILRSLRCTEDELLATAGLDAVVFNRILVFSIRIFSLAAFLCVLGVLPL  112



>ref|XP_010470241.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Camelina sativa]
Length=1062

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +3

Query  168  CVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVPSPSWFMKAWETTDEEI  347
            C V   LYS+LRKQPS   VYFG++L   G +R DP  +ERFVPSPSW +KAWET+++E+
Sbjct  290  CCVLLSLYSILRKQPSNYCVYFGRRLVCGGARRYDPFWYERFVPSPSWLVKAWETSEDEL  349

Query  348  NAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
             A  GLDA+VF R ++FSIR F I A +C+  VLP+
Sbjct  350  LAAAGLDAVVFLRMVLFSIRTFFIVAVVCIVFVLPV  385



>ref|XP_010414723.1| PREDICTED: CSC1-like protein RXW8 isoform X1 [Camelina sativa]
Length=1041

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +3

Query  168  CVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVPSPSWFMKAWETTDEEI  347
            C V   LYS+LRKQPS   VYFG++L   G +R DP  +ERFVPSPSW +KAWET+++E+
Sbjct  290  CCVLLSLYSILRKQPSNYCVYFGRRLVCGGARRYDPFWYERFVPSPSWLVKAWETSEDEL  349

Query  348  NAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
             A  GLDA+VF R ++FSIR F I A +C+  VLP+
Sbjct  350  LAAAGLDAVVFLRMVLFSIRTFFIVAVVCIAFVLPV  385



>gb|KDP41246.1| hypothetical protein JCGZ_15653 [Jatropha curcas]
Length=709

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +CV+ F+LYS+LRKQPS   VY  + LA    KR      ER +P
Sbjct  1    MLVSALLTSVGINSGLCVLFFVLYSILRKQPSYYEVYVPRLLAEGNSKRRSRFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  KAW+ ++E+I +  GLDALVF R I FS+++F+ A  I +F++LP+
Sbjct  61   SPGWITKAWKLSEEDILSSSGLDALVFMRIITFSLKVFTFAGIIGIFILLPV  112



>ref|XP_006650401.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X3 [Oryza brachyantha]
Length=709

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M + ALLTSAG+N  +CV+   LYS+LRKQP  V VYFG+++A    +  +    ERFVP
Sbjct  1    MKVGALLTSAGINIGLCVLFLSLYSILRKQPQNVKVYFGRRIAEENNRLREAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +++   T++E+ A  GLDA+VF+R +VFSIRIFS+AA +C+  VLPL
Sbjct  61   STSWIIRSLRCTEDELLATAGLDAVVFNRILVFSIRIFSLAACLCVLGVLPL  112



>ref|XP_006650399.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Oryza brachyantha]
Length=779

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M + ALLTSAG+N  +CV+   LYS+LRKQP  V VYFG+++A    +  +    ERFVP
Sbjct  1    MKVGALLTSAGINIGLCVLFLSLYSILRKQPQNVKVYFGRRIAEENNRLREAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S SW +++   T++E+ A  GLDA+VF+R +VFSIRIFS+AA +C+  VLPL
Sbjct  61   STSWIIRSLRCTEDELLATAGLDAVVFNRILVFSIRIFSLAACLCVLGVLPL  112



>ref|XP_003559478.1| PREDICTED: CSC1-like protein RXW8 [Brachypodium distachyon]
Length=740

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRP-DPLCFERFV  296
            M  SALLTSAG+N   C +   LYS+LRKQP   SVYFG++LA    ++  D   FER +
Sbjct  1    MEFSALLTSAGINIAFCALFLSLYSILRKQPHNYSVYFGRRLAEEKFRQQVDYFSFERLL  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W +KA+  T+EEI  V GLD++VF R  +FSIRIFSI   +CLF VLP+
Sbjct  61   PTAGWIVKAYWCTEEEIRRVAGLDSVVFLRLFIFSIRIFSITCLVCLFGVLPV  113



>gb|EMS66677.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=788

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTSAG+N  +CV+   LYSVLRKQP+ V VYFG++++    +  +    ERFVP
Sbjct  1    MKISALLTSAGINIGLCVLFLSLYSVLRKQPANVRVYFGRRISEEHSRLREAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            S  W +KA   T+EE+ A  GLDA+ F+R
Sbjct  61   STGWIVKALRYTEEELLAAAGLDAVAFNR  89



>ref|XP_010044468.1| PREDICTED: CSC1-like protein At1g69450 [Eucalyptus grandis]
Length=716

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+NT +C + FILYSVLR+QPS   VY  +++A     +      ER +P
Sbjct  1    MLVSALLTSVGINTGLCFLFFILYSVLRRQPSNYEVYIPRQVAEGKSNKRSYFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  KAW+ ++EE+ ++ GLDA+VF R I+FS+R+F+ A  I +F++LPL
Sbjct  61   SPGWVKKAWKLSEEELLSISGLDAVVFMRIIIFSLRVFAFAGVIGVFILLPL  112



>ref|XP_006650400.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Oryza brachyantha]
Length=730

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M + ALLTSAG+N  +CV+   LYS+LRKQP  V VYFG+++A    +  +    ERFVP
Sbjct  1    MKVGALLTSAGINIGLCVLFLSLYSILRKQPQNVKVYFGRRIAEENNRLREAFILERFVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            S SW +++   T++E+ A  GLDA+VF+R
Sbjct  61   STSWIIRSLRCTEDELLATAGLDAVVFNR  89



>gb|EMT18535.1| Putative membrane protein [Aegilops tauschii]
Length=707

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLG-PKRPDPLCFERFV  296
            M  SALLTSAG+N  +C++   LYS+LRKQP    VYFG++LA     ++ D   FER +
Sbjct  1    MEFSALLTSAGINIALCILYLSLYSILRKQPHNFRVYFGRRLAEEKFREQVDYFSFERLL  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W +KA+  T++EI  V GLD++VF R  +FSIRIFSI   IC+F VLP+
Sbjct  61   PTAGWLVKAYWCTEDEIRRVAGLDSVVFLRLFIFSIRIFSITTLICVFGVLPV  113



>dbj|BAK06091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=745

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLG-PKRPDPLCFERFV  296
            M  SALLTSAG+N  +C++   LYS+LRKQP    VYFG++LA     ++ D   FER +
Sbjct  1    MEFSALLTSAGINIALCILYLSLYSILRKQPHNFGVYFGRRLAEEKFREQVDYFSFERLL  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W +KA+  T++EI  V GLD++VF R  +FSIRIFSI   IC+F VLP+
Sbjct  61   PTAGWLVKAYWCTEDEIRRVAGLDSVVFLRLFIFSIRIFSITTLICVFGVLPV  113



>ref|XP_010683104.1| PREDICTED: CSC1-like protein At1g69450 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683105.1| PREDICTED: CSC1-like protein At1g69450 [Beta vulgaris subsp. 
vulgaris]
Length=714

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +C++ F LYS+LRKQP    VY  + LA  G +R   +  +R +P
Sbjct  1    MIVSALLTSVGINSGLCILFFALYSILRKQPGYSYVYVPRLLAAKGIERNRYIHLQRLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SPSW  +AW+ ++EE+ +  GLDA+VF RTI  S++IFS A  I LF++LP+
Sbjct  61   SPSWVKRAWKLSEEELLSTSGLDAVVFIRTIRLSLKIFSFAGVIGLFVLLPI  112



>ref|XP_006650526.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Oryza 
brachyantha]
Length=743

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRP-DPLCFERFV  296
            M  SALLTSAG+N   C +   LYSVLRKQP    VYFG++LA    ++  D   FER +
Sbjct  1    MEFSALLTSAGINIGFCALFLSLYSVLRKQPHNYGVYFGRRLAEEKFRQQVDYFSFERLL  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W +KA+  T+EEI  V GLD++VF R  +FSIRIFSI + +C+F VLP+
Sbjct  61   PTAGWIVKAYWCTEEEIRRVAGLDSVVFLRLFIFSIRIFSITSLVCIFGVLPV  113



>gb|ABR16200.1| unknown [Picea sitchensis]
 gb|ABR16390.1| unknown [Picea sitchensis]
Length=717

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+NT +CV+    YSVLRKQP  V VY  +++A    KR  P   ER VP
Sbjct  1    MIVSALLTSVGINTGLCVLLLSFYSVLRKQPDNVYVYAPRRVAEEQAKREGPFSLERLVP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W ++AW  +++E  +  G DA VF R  +FSIRIFSIA  I +F++LPL
Sbjct  61   SPGWIVRAWRLSEDEFLSAAGFDAFVFLRIFIFSIRIFSIAGIIGVFVLLPL  112



>ref|XP_007045993.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
 ref|XP_007045994.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
 gb|EOY01825.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
 gb|EOY01826.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
Length=715

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +CV+ FILYS+LRKQPS   VY  + LA    KR      ER +P
Sbjct  1    MLVSALLTSVGINSGLCVLFFILYSILRKQPSNYEVYIPRLLAEGNSKRRTGFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  +AW+ +++++ +  GLDA+VF R I FS+R+F  A  I +F++LP+
Sbjct  61   SPGWVKRAWKLSEDDLLSTSGLDAVVFMRVITFSLRVFLFAGVIGIFVLLPV  112



>gb|EEC76105.1| hypothetical protein OsI_13363 [Oryza sativa Indica Group]
Length=743

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRP-DPLCFERFV  296
            M  SALLTSAG+N  +C +   LYSVLRKQP    VYFG++LA    ++  D    ER +
Sbjct  1    MEFSALLTSAGINIGLCALLLSLYSVLRKQPHNYGVYFGRRLAEEKFRQQVDYFSLERLL  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W +KA+  T+EEI  V GLD++VF R  +FSIRIFSI + +C+F VLP+
Sbjct  61   PTAGWIVKAYWCTEEEIRRVAGLDSVVFLRLFIFSIRIFSITSLVCIFGVLPV  113



>gb|EEE59847.1| hypothetical protein OsJ_12422 [Oryza sativa Japonica Group]
Length=738

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRP-DPLCFERFV  296
            M  SALLTSAG+N  +C +   LYSVLRKQP    VYFG++LA    ++  D    ER +
Sbjct  1    MEFSALLTSAGINIGLCALFLSLYSVLRKQPHNYGVYFGRRLAEEKFRQQVDYFSLERLL  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W +KA+  T+EEI  V GLD++VF R  +FSIRIFSI + +C+F VLP+
Sbjct  61   PTAGWIVKAYWCTEEEIRRVAGLDSVVFLRLFIFSIRIFSITSLVCIFGVLPV  113



>ref|NP_001051134.1| Os03g0726300 [Oryza sativa Japonica Group]
 gb|AAS07159.1| expressed protein [Oryza sativa Japonica Group]
 gb|AAT77082.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF98645.1| early-responsive to dehydration protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13048.1| Os03g0726300 [Oryza sativa Japonica Group]
 dbj|BAG92902.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34634.1| hyperosmolality-gated Ca2+ permeable channel 2.3 [Oryza sativa]
Length=743

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRP-DPLCFERFV  296
            M  SALLTSAG+N  +C +   LYSVLRKQP    VYFG++LA    ++  D    ER +
Sbjct  1    MEFSALLTSAGINIGLCALFLSLYSVLRKQPHNYGVYFGRRLAEEKFRQQVDYFSLERLL  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W +KA+  T+EEI  V GLD++VF R  +FSIRIFSI + +C+F VLP+
Sbjct  61   PTAGWIVKAYWCTEEEIRRVAGLDSVVFLRLFIFSIRIFSITSLVCIFGVLPV  113



>ref|XP_003613914.1| Membrane protein, putative [Medicago truncatula]
 gb|AES96872.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=711

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+NT +CV+   LYS+LRKQPS   VY  + L     KR     FER +P
Sbjct  1    MIVSALLTSVGINTALCVLFLTLYSILRKQPSNYEVYVPRLLVEGTSKRRSHFNFERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  KAW+ ++EE+ +  GLD +VF R I FS++IF+ A  I +F++LP+
Sbjct  61   SAGWVAKAWKLSEEELYSSSGLDGVVFMRIITFSVKIFTFAGVIGIFVLLPV  112



>ref|XP_002522488.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39980.1| conserved hypothetical protein [Ricinus communis]
Length=710

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +CV+ F+ YS+LRKQPS   VY  + LA    KR      ER +P
Sbjct  1    MLVSALLTSLGINSGLCVLFFVFYSILRKQPSNYEVYAPRLLAEGNSKRRSRFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  KAW+ ++E+I    GLDA+VF R I FS+++FS A  I +F++LP+
Sbjct  61   SPGWISKAWKLSEEDILLSSGLDAVVFMRLITFSLKVFSFAGIIGIFVLLPV  112



>ref|XP_006574919.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X4 [Glycine max]
Length=588

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+NT +CV+ F LYS+LRKQPS   VY  + L     KR      ER +P
Sbjct  1    MIVSALLTSVGINTALCVLFFTLYSILRKQPSNYEVYVPRLLTEGTSKRRSRFKLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  KAW  ++EE+ ++ GLD +VF R I FS++ F+ A  I +F++LP+
Sbjct  61   SAGWVAKAWRLSEEELFSLSGLDGVVFMRMITFSLKTFTFAGIIGIFVLLPV  112



>gb|KEH30798.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=713

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+NT +CV+ F LYS+LRKQPS   VY  + LA  G  R  P   ++ +P
Sbjct  1    MIVSALLTSVGINTALCVLFFTLYSILRKQPSNYKVYIPRLLAE-GISRKKPFKLKQLIP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  KAW  +++E+ +  GLDALVF   I FS++IF+ A  I +F++LP+
Sbjct  60   SPDWVAKAWNLSEDELFSSSGLDALVFMHLITFSLKIFTFAGVIGIFVLLPV  111



>ref|XP_004516572.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cicer 
arietinum]
Length=710

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+NT +CV+ F  YS+LRKQPS   VY  + LA  G     P   ++ +P
Sbjct  1    MIVSALLTSVGINTALCVLFFTFYSILRKQPSNYKVYIPRLLAQ-GASLTTPFNLKKLIP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  KAW  ++E++ ++ GLDALVF R I FS++IF+ A  I +F++LP+
Sbjct  60   SPDWIAKAWSLSEEDLFSLSGLDALVFMRLITFSLKIFTFAGVIGIFVLLPV  111



>gb|KEH30800.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=722

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+NT +CV+ F LYS+LRKQPS   VY  + LA  G  R  P   ++ +P
Sbjct  1    MIVSALLTSVGINTALCVLFFTLYSILRKQPSNYKVYIPRLLAE-GISRKKPFKLKQLIP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  KAW  +++E+ +  GLDALVF   I FS++IF+ A  I +F++LP+
Sbjct  60   SPDWVAKAWNLSEDELFSSSGLDALVFMHLITFSLKIFTFAGVIGIFVLLPV  111



>ref|XP_006574918.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X3 [Glycine max]
Length=642

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+NT +CV+ F LYS+LRKQPS   VY  + L     KR      ER +P
Sbjct  1    MIVSALLTSVGINTALCVLFFTLYSILRKQPSNYEVYVPRLLTEGTSKRRSRFKLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  KAW  ++EE+ ++ GLD +VF R I FS++ F+ A  I +F++LP+
Sbjct  61   SAGWVAKAWRLSEEELFSLSGLDGVVFMRMITFSLKTFTFAGIIGIFVLLPV  112



>ref|XP_006574916.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Glycine max]
 ref|XP_006574917.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Glycine max]
 gb|KHN01989.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=712

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+NT +CV+ F LYS+LRKQPS   VY  + L     KR      ER +P
Sbjct  1    MIVSALLTSVGINTALCVLFFTLYSILRKQPSNYEVYVPRLLTEGTSKRRSRFKLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  KAW  ++EE+ ++ GLD +VF R I FS++ F+ A  I +F++LP+
Sbjct  61   SAGWVAKAWRLSEEELFSLSGLDGVVFMRMITFSLKTFTFAGIIGIFVLLPV  112



>gb|KJB80261.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
Length=645

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +CV+ F LYS+LRKQP+   VY  + +A    KR      ER +P
Sbjct  1    MLVSALLTSVGINSGLCVLFFTLYSILRKQPTNYEVYIPRLIAEGSSKRRSHFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  +AW+ ++E++ +  GLDA+VF R I FS+R+F  A  I +F++LP+
Sbjct  61   SPGWVKRAWKLSEEDLLSTSGLDAVVFMRVITFSLRVFLFAGVIGIFVLLPV  112



>gb|KJB80260.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
Length=673

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +CV+ F LYS+LRKQP+   VY  + +A    KR      ER +P
Sbjct  1    MLVSALLTSVGINSGLCVLFFTLYSILRKQPTNYEVYIPRLIAEGSSKRRSHFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  +AW+ ++E++ +  GLDA+VF R I FS+R+F  A  I +F++LP+
Sbjct  61   SPGWVKRAWKLSEEDLLSTSGLDAVVFMRVITFSLRVFLFAGVIGIFVLLPV  112



>gb|KJB80259.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80262.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80263.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80264.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80265.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80266.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80267.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
Length=715

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +CV+ F LYS+LRKQP+   VY  + +A    KR      ER +P
Sbjct  1    MLVSALLTSVGINSGLCVLFFTLYSILRKQPTNYEVYIPRLIAEGSSKRRSHFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  +AW+ ++E++ +  GLDA+VF R I FS+R+F  A  I +F++LP+
Sbjct  61   SPGWVKRAWKLSEEDLLSTSGLDAVVFMRVITFSLRVFLFAGVIGIFVLLPV  112



>ref|XP_004490117.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cicer 
arietinum]
Length=724

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+NT +CV+   LYS+LRKQPS   VY  + L     KR      ER +P
Sbjct  1    MIVSALLTSVGINTALCVLFLTLYSILRKQPSNYEVYVPRLLVEGTSKRRSHFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  KAW  T+EE+ ++ GLD +VF R I FS++IF+ A  I +F++LP+
Sbjct  61   STGWVAKAWSLTEEELYSLSGLDGVVFMRIITFSVKIFTFAGIIGIFVLLPV  112



>ref|XP_006483098.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
Length=733

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 76/119 (64%), Gaps = 0/119 (0%)
 Frame = +3

Query  99   RIVFWTKMNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPL  278
            +I +W +M +SALLTS G+N+ +CV+ F LYS+LRKQPS   VY  + LA     R    
Sbjct  19   KINYWVEMLVSALLTSVGINSGLCVLFFTLYSILRKQPSNYEVYVPRLLAKGSSNRRRRF  78

Query  279  CFERFVPSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
              E  +PS  W  +AW+ ++E++    GLDA+VF R I FS+++F  A  I +F++LP+
Sbjct  79   NLEMLIPSAGWVSRAWKHSEEDLLESSGLDAVVFMRVITFSLKVFLFAGIIGIFVILPV  137



>gb|KEH30801.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=599

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+NT +CV+ F LYS+LRKQPS   VY  + LA  G  R  P   ++ +P
Sbjct  1    MIVSALLTSVGINTALCVLFFTLYSILRKQPSNYKVYIPRLLAE-GISRKKPFKLKQLIP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  KAW  +++E+ +  GLDALVF   I FS++IF+ A  I +F++LP+
Sbjct  60   SPDWVAKAWNLSEDELFSSSGLDALVFMHLITFSLKIFTFAGVIGIFVLLPV  111



>ref|XP_011017881.1| PREDICTED: CSC1-like protein At1g69450 isoform X1 [Populus euphratica]
Length=714

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SA+LTS G+N+ +CV+  +LYS+L+KQPS   VY  + L     KR      ER +P
Sbjct  1    MLVSAILTSVGINSALCVIFLVLYSILKKQPSYYEVYIPRLLTEGNSKRRSRFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  KAW+ ++EE+ +  GLDA+V+ RTI F +++FS A  I +F++LP+
Sbjct  61   STGWLPKAWKLSEEEMLSSSGLDAVVYMRTITFCLKVFSFAGIIGIFILLPV  112



>gb|KEH30803.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=683

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+NT +CV+ F LYS+LRKQPS   VY  + LA  G  R  P   ++ +P
Sbjct  1    MIVSALLTSVGINTALCVLFFTLYSILRKQPSNYKVYIPRLLAE-GISRKKPFKLKQLIP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  KAW  +++E+ +  GLDALVF   I FS++IF+ A  I +F++LP+
Sbjct  60   SPDWVAKAWNLSEDELFSSSGLDALVFMHLITFSLKIFTFAGVIGIFVLLPV  111



>ref|XP_010525100.1| PREDICTED: CSC1-like protein HYP1 [Tarenaya hassleriana]
Length=715

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGP-KRPDPLCFERFV  296
            M LSALLTS G+N  +C + F LYS+LRKQP  V+VY   +L H G  ++ D    ERF+
Sbjct  1    MLLSALLTSVGINLGLCFLFFTLYSILRKQPGNVTVY-APRLVHEGKSQQRDEFNLERFL  59

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W  +AWE +DE I    GLDALVF R  VFS+R+FS AA + +F+++P+
Sbjct  60   PTAGWVRRAWELSDEHILLNMGLDALVFSRIFVFSLRVFSFAAMVGIFILVPV  112



>ref|XP_011017887.1| PREDICTED: CSC1-like protein At1g69450 isoform X2 [Populus euphratica]
Length=709

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 49/112 (44%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SA+LTS G+N+ +CV+  +LYS+L+KQPS   VY  + L     KR      ER +P
Sbjct  1    MLVSAILTSVGINSALCVIFLVLYSILKKQPSYYEVYIPRLLTEGNSKRRSRFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  KAW+ ++EE+ +  GLDA+V+ RTI F +++FS A  I +F++LP+
Sbjct  61   STGWLPKAWKLSEEEMLSSSGLDAVVYMRTITFCLKVFSFAGIIGIFILLPV  112



>ref|XP_002311322.1| hypothetical protein POPTR_0008s09070g [Populus trichocarpa]
 gb|EEE88689.1| hypothetical protein POPTR_0008s09070g [Populus trichocarpa]
Length=714

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SA+LTS G+N+ +CV+  +LYS+L+KQPS   VY  + L     KR      ER +P
Sbjct  1    MLVSAILTSVGINSALCVLFVVLYSILKKQPSYYEVYIPRLLTEGNSKRRSRFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  KAW+ ++EE+ +  GLDA+V+ RTI F +++FS A  I +F++LP+
Sbjct  61   STGWLPKAWKLSEEEMLSSSGLDAVVYMRTITFCLKVFSFAGIIGIFILLPV  112



>ref|XP_004297274.1| PREDICTED: CSC1-like protein At1g69450 [Fragaria vesca subsp. 
vesca]
Length=719

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SAL+TS  +N+ +C++ F LYS+LRKQPS   VY  + LA  G K+      ER +P
Sbjct  1    MLVSALVTSLAINSGLCILFFTLYSILRKQPSNSEVYIPRVLAEGGYKKTSHFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  +AW+ +++++ A  GLDA+VF R I FS+R+F  A  I +F++LP+
Sbjct  61   SPDWLRRAWKLSEDDLLATSGLDAVVFMRLINFSLRVFLFAGVIGVFVLLPV  112



>ref|XP_010670229.1| PREDICTED: CSC1-like protein HYP1 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=713

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C + F  YS+LRKQP  + VY  + +A    KR +   FER +P
Sbjct  1    MILSALLTSVGINLGLCFLFFTFYSILRKQPGNLRVYAPRLVAERRVKRKNDFNFERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  +AWE ++EE+    GLD +VF R   FS+++F+IAA I +F++LP+
Sbjct  61   SAGWVKRAWEQSEEELLENSGLDGVVFMRVFTFSLKVFAIAAIIGVFILLPI  112



>ref|XP_010670228.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=650

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C + F  YS+LRKQP  + VY  + +A    KR +   FER +P
Sbjct  1    MILSALLTSVGINLGLCFLFFTFYSILRKQPGNLRVYAPRLVAERRVKRKNDFNFERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  +AWE ++EE+    GLD +VF R   FS+++F+IAA I +F++LP+
Sbjct  61   SAGWVKRAWEQSEEELLENSGLDGVVFMRVFTFSLKVFAIAAIIGVFILLPI  112



>gb|AEM36349.1| At1g58520 [Arabidopsis thaliana]
Length=1031

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +3

Query  195  VLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVPSPSWFMKAWETTDEEINAVGGLDAL  374
            + RKQP+   VYFG++L   G +R DP  +ERFVPSPSW +KAWET+++E+ A  GLDA+
Sbjct  291  IARKQPANYCVYFGRRLVCGGARRYDPFWYERFVPSPSWLVKAWETSEDELLAAAGLDAV  350

Query  375  VFDRTivfsirifsiaasiCLFLVLPL  455
            VF R ++FSIRIF I A IC+  VLP+
Sbjct  351  VFLRMVIFSIRIFFIVAVICIAFVLPV  377



>ref|NP_001154436.1| protein RXW8 [Arabidopsis thaliana]
 gb|AEE33553.1| lipase/hydrolase [Arabidopsis thaliana]
Length=1041

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +3

Query  195  VLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVPSPSWFMKAWETTDEEINAVGGLDAL  374
            + RKQP+   VYFG++L   G +R DP  +ERFVPSPSW +KAWET+++E+ A  GLDA+
Sbjct  302  IARKQPANYCVYFGRRLVCGGARRYDPFWYERFVPSPSWLVKAWETSEDELLAAAGLDAV  361

Query  375  VFDRTivfsirifsiaasiCLFLVLPL  455
            VF R ++FSIRIF I A IC+  VLP+
Sbjct  362  VFLRMVIFSIRIFFIVAVICIAFVLPV  388



>ref|XP_007226980.1| hypothetical protein PRUPE_ppa002249mg [Prunus persica]
 gb|EMJ28179.1| hypothetical protein PRUPE_ppa002249mg [Prunus persica]
Length=695

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +CV+ F LYS+LRKQPS   VY  + LA            ER +P
Sbjct  1    MLVSALLTSLGINSGLCVLFFTLYSILRKQPSNYEVYMPKLLAEGESNTSSIFNIERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W   AW+ T++++ +  GLDA+VF R I FS+R+F  A  I +F++LP+
Sbjct  61   SPDWVKTAWQLTEDDLLSSSGLDAVVFMRLINFSLRVFLFAGVIGVFVLLPI  112



>ref|XP_008339854.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Malus 
domestica]
Length=717

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS  +N+ +CV+ F LYS+LRKQPS   VY  + LA     +      ER +P
Sbjct  1    MLVSALLTSLAINSGLCVLFFTLYSILRKQPSNYEVYIPRLLAEGESDKSGSFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  +AW+ T++++ +  GLDA+VF R I FS+R+F  A  I +F++LP+
Sbjct  61   SPYWVKRAWQLTEDDLLSSSGLDAVVFMRLINFSLRVFMFAGVIGIFVLLPV  112



>ref|XP_011012741.1| PREDICTED: CSC1-like protein At1g69450 [Populus euphratica]
Length=712

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SA+LTS G+N+ +CV+  +LYS+L+KQPS   V+  + LA    K+      ER +P
Sbjct  1    MLVSAILTSVGINSALCVIFLVLYSILKKQPSYYEVFVPRLLAEGSSKQGSRFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            S  W  KAW+ ++EE+ +  GLDA+V+ R
Sbjct  61   SAGWLSKAWKLSEEEMLSSSGLDAVVYMR  89



>ref|XP_008221566.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
 ref|XP_008221567.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=719

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +CV+ F LYS+LRKQPS   VY  + LA            ER +P
Sbjct  1    MLVSALLTSLGINSGLCVLFFTLYSILRKQPSNYEVYMPRLLAEGESNTSSLFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W   AW+ T++++ +  GLDA+VF R I FS+R+F  A  I +F++LP+
Sbjct  61   SPDWVKTAWQLTEDDLLSSSGLDAVVFMRLINFSLRVFLFAGVIGVFVLLPI  112



>ref|XP_009356342.1| PREDICTED: CSC1-like protein At1g69450 [Pyrus x bretschneideri]
Length=717

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SAL+TS  +N+ +CV+ F LYS+LRKQPS   VY  + LA  G         ER +P
Sbjct  1    MLVSALVTSLAINSGLCVLFFTLYSILRKQPSNYEVYMPRLLAEGGSYSSTRFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  +AW+ T++++ +  GLDA+VF R I FS+R+F  A  I +F++LP+
Sbjct  61   SPYWLKRAWQLTEDDLLSSSGLDAVVFMRLINFSLRVFLFAGVIGVFVLLPV  112



>ref|XP_002316110.2| hypothetical protein POPTR_0010s17130g [Populus trichocarpa]
 gb|EEF02281.2| hypothetical protein POPTR_0010s17130g [Populus trichocarpa]
Length=634

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SA+LTS G+N+ +CV+  +LYS+L+KQPS   V+  + LA    K+      ER +P
Sbjct  1    MLVSAILTSVGINSALCVIFLVLYSILKKQPSYYEVFAPRLLAEGSSKQGSRFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            S  W  KAW+ ++EE+ +  GLDA+V+ R
Sbjct  61   SAGWLSKAWKLSEEEMLSSSGLDAVVYMR  89



>gb|KDO83031.1| hypothetical protein CISIN_1g0052163mg, partial [Citrus sinensis]
 gb|KDO83032.1| hypothetical protein CISIN_1g0052163mg, partial [Citrus sinensis]
Length=577

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +CV+ F LYS+LRKQPS   VY  + LA     R      E  +P
Sbjct  1    MLVSALLTSVGINSGLCVLFFTLYSILRKQPSNYEVYVPRLLAKGSSNRRRRFNLEMLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  +AW+ ++E++    GLDA+VF R I FS+++F  A  I +F++LP+
Sbjct  61   SAGWVSRAWKHSEEDLLESSGLDAVVFMRVITFSLKVFLFAGIIGIFVILPV  112



>ref|XP_010661095.1| PREDICTED: CSC1-like protein HYP1 isoform X4 [Vitis vinifera]
Length=622

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C + F LYS+LRKQP  + VY  + +A    +R +    +R +P
Sbjct  1    MILSALLTSVGINLGLCFLFFTLYSILRKQPGNIHVYAPRLVAEGKSQRTNHFNLDRLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  +AW+ ++E++ +  GLDA+VF R  +FS+R+F+ A  I +F++LP+
Sbjct  61   SAGWVTRAWQPSEEDLLSTSGLDAVVFMRIFIFSLRVFTFAGIIGVFILLPI  112



>ref|XP_010661093.1| PREDICTED: CSC1-like protein HYP1 isoform X2 [Vitis vinifera]
Length=666

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C + F LYS+LRKQP  + VY  + +A    +R +    +R +P
Sbjct  1    MILSALLTSVGINLGLCFLFFTLYSILRKQPGNIHVYAPRLVAEGKSQRTNHFNLDRLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  +AW+ ++E++ +  GLDA+VF R  +FS+R+F+ A  I +F++LP+
Sbjct  61   SAGWVTRAWQPSEEDLLSTSGLDAVVFMRIFIFSLRVFTFAGIIGVFILLPI  112



>ref|XP_006438758.1| hypothetical protein CICLE_v10030873mg [Citrus clementina]
 gb|ESR51998.1| hypothetical protein CICLE_v10030873mg [Citrus clementina]
Length=689

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +CV+ F LYS+LRKQPS   VY  + LA     R      E  +P
Sbjct  1    MLVSALLTSVGINSGLCVLFFTLYSILRKQPSNYEVYVPRLLAKGSSNRRRRFNLEMLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  +AW+ ++E++    GLDA+VF R I FS+++F  A  I +F++LP+
Sbjct  61   SAGWVSRAWKHSEEDLLESSGLDAVVFMRVITFSLKVFLFAGIIGIFVILPV  112



>ref|XP_010661092.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Vitis vinifera]
Length=714

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C + F LYS+LRKQP  + VY  + +A    +R +    +R +P
Sbjct  1    MILSALLTSVGINLGLCFLFFTLYSILRKQPGNIHVYAPRLVAEGKSQRTNHFNLDRLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  +AW+ ++E++ +  GLDA+VF R  +FS+R+F+ A  I +F++LP+
Sbjct  61   SAGWVTRAWQPSEEDLLSTSGLDAVVFMRIFIFSLRVFTFAGIIGVFILLPI  112



>ref|XP_010661094.1| PREDICTED: CSC1-like protein HYP1 isoform X3 [Vitis vinifera]
Length=651

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C + F LYS+LRKQP  + VY  + +A    +R +    +R +P
Sbjct  1    MILSALLTSVGINLGLCFLFFTLYSILRKQPGNIHVYAPRLVAEGKSQRTNHFNLDRLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  +AW+ ++E++ +  GLDA+VF R  +FS+R+F+ A  I +F++LP+
Sbjct  61   SAGWVTRAWQPSEEDLLSTSGLDAVVFMRIFIFSLRVFTFAGIIGVFILLPI  112



>ref|XP_006483099.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483100.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X3 [Citrus sinensis]
 ref|XP_006483101.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X4 [Citrus sinensis]
Length=713

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +CV+ F LYS+LRKQPS   VY  + LA     R      E  +P
Sbjct  1    MLVSALLTSVGINSGLCVLFFTLYSILRKQPSNYEVYVPRLLAKGSSNRRRRFNLEMLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  +AW+ ++E++    GLDA+VF R I FS+++F  A  I +F++LP+
Sbjct  61   SAGWVSRAWKHSEEDLLESSGLDAVVFMRVITFSLKVFLFAGIIGIFVILPV  112



>gb|KJB75678.1| hypothetical protein B456_012G051600 [Gossypium raimondii]
 gb|KJB75679.1| hypothetical protein B456_012G051600 [Gossypium raimondii]
 gb|KJB75680.1| hypothetical protein B456_012G051600 [Gossypium raimondii]
 gb|KJB75681.1| hypothetical protein B456_012G051600 [Gossypium raimondii]
 gb|KJB75682.1| hypothetical protein B456_012G051600 [Gossypium raimondii]
Length=715

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C + F LYS+LR QP  + VY  +  +    +  D    ER +P
Sbjct  1    MILSALLTSVGINLGLCFLFFALYSILRNQPGNIPVYSPRLFSERKAQEEDEFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            SP W  +AW+ +++E+ ++ GLDA+VF R
Sbjct  61   SPGWLKRAWQPSEDELLSITGLDAVVFMR  89



>emb|CDP02261.1| unnamed protein product [Coffea canephora]
Length=714

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C + F LYS+LRKQP    VY  + +AH   +       ER +P
Sbjct  1    MILSALLTSVGINLALCFLFFALYSILRKQPGNAGVYAPRLVAHGKSQERGDFSLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W   AW+ +++E+ +V GLD +VF R  +FS+RIF+ AA I +F++LP+
Sbjct  61   SAGWVRMAWQPSEDELLSVSGLDGVVFMRIFIFSLRIFTFAAVIGVFILLPV  112



>ref|XP_007032617.1| Early-responsive to dehydration stress protein (ERD4), putative 
isoform 1 [Theobroma cacao]
 gb|EOY03543.1| Early-responsive to dehydration stress protein (ERD4), putative 
isoform 1 [Theobroma cacao]
Length=714

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C + F LYS+LR QP  ++VY          ++ D    ER +P
Sbjct  1    MILSALLTSVGINLGLCFLFFALYSILRNQPGNITVYSPLLFNERKAQQQDEFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  +AW+ +++E+ ++ GLDA+VF R  +F +R+F+ A  I +F++LP+
Sbjct  61   SPGWVKRAWQPSEDELLSITGLDAVVFMRVFIFCVRVFTFACIIGIFILLPI  112



>ref|XP_006844825.1| hypothetical protein AMTR_s00058p00059520 [Amborella trichopoda]
 gb|ERN06500.1| hypothetical protein AMTR_s00058p00059520 [Amborella trichopoda]
Length=713

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N  +CV+   LYS+L KQPS V VY   +L   G +RP  L  ER +P
Sbjct  1    MIVSALLTSVGINLGLCVLFVTLYSILGKQPSNVRVY-APRLVDKGEERPFNL--ERLLP  57

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  KAWE +++E+ ++ GLDA+VF R  +FS+RIF IA  + +F++LP+
Sbjct  58   SAGWLKKAWEPSEDELLSLAGLDAVVFMRIFIFSLRIFLIAGILGIFILLPI  109



>emb|CBI22257.3| unnamed protein product [Vitis vinifera]
Length=917

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C + F LYS+LRKQP  + VY  + +A    +R +    +R +P
Sbjct  1    MILSALLTSVGINLGLCFLFFTLYSILRKQPGNIHVYAPRLVAEGKSQRTNHFNLDRLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  +AW+ ++E++ +  GLDA+VF R  +FS+R+F+ A  I +F++LP+
Sbjct  61   SAGWVTRAWQPSEEDLLSTSGLDAVVFMRIFIFSLRVFTFAGIIGVFILLPI  112



>ref|XP_006408462.1| hypothetical protein EUTSA_v10020163mg [Eutrema salsugineum]
 gb|ESQ49915.1| hypothetical protein EUTSA_v10020163mg [Eutrema salsugineum]
Length=713

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGP-KRPDPLCFERFV  296
            M LSALLTS G+N  +C + F LYS+LRKQP  V+VY G +L   G  ++ +    ER +
Sbjct  1    MILSALLTSVGINLGLCFLFFTLYSILRKQPGNVTVY-GPRLIQQGKSQQSNAFNLERLL  59

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W  +A E T+EEI +  GLDALVF R  VFSIR+FS A+ + +F++LP+
Sbjct  60   PTAGWVKRALEPTNEEILSNLGLDALVFTRVFVFSIRVFSFASVVGIFILLPV  112



>ref|XP_009147396.1| PREDICTED: CSC1-like protein HYP1 [Brassica rapa]
Length=713

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGP-KRPDPLCFERFV  296
            M LSALLTS G+N  +C + F LYS+LRKQP  V+VY G +L   G  ++ +    ER +
Sbjct  1    MILSALLTSVGINLGLCFLFFTLYSILRKQPGNVTVY-GPRLIQAGKSQQTNAFNLERLL  59

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W  +A E T+EEI +  GLDALVF R  VFSIR+FS A+ + +F++LP+
Sbjct  60   PTAGWVKRALEPTNEEILSNLGLDALVFTRVFVFSIRVFSFASVVGIFILLPV  112



>ref|XP_007151261.1| hypothetical protein PHAVU_004G031700g [Phaseolus vulgaris]
 ref|XP_007151262.1| hypothetical protein PHAVU_004G031700g [Phaseolus vulgaris]
 ref|XP_007151263.1| hypothetical protein PHAVU_004G031700g [Phaseolus vulgaris]
 gb|ESW23255.1| hypothetical protein PHAVU_004G031700g [Phaseolus vulgaris]
 gb|ESW23256.1| hypothetical protein PHAVU_004G031700g [Phaseolus vulgaris]
 gb|ESW23257.1| hypothetical protein PHAVU_004G031700g [Phaseolus vulgaris]
Length=711

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C++ F LYS+LRKQP  ++VY  + +A    K       ER +P
Sbjct  1    MILSALLTSVGINLGLCLLFFTLYSILRKQPGNITVYAPRLVAEGKVKEGGHFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            +  W  +AWE ++EE  +  GLDA VF R  +FS+++F++  SI +F++LP+
Sbjct  61   TAGWVKQAWEPSEEEFLSSSGLDAFVFMRIFIFSLKVFAVGGSIGMFVLLPI  112



>emb|CDY37544.1| BnaA05g34090D [Brassica napus]
Length=792

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGP-KRPDPLCFERFV  296
            M LSALLTS G+N  +C + F LYS+LRKQP  V+VY G +L   G  ++ +    ER +
Sbjct  80   MILSALLTSVGINLGLCFLFFTLYSILRKQPGNVTVY-GPRLIQAGKSQQTNAFNLERLL  138

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W  +A E T+EEI +  GLDALVF R  VFSIR+FS A+ + +F++LP+
Sbjct  139  PTAGWVKRALEPTNEEILSNLGLDALVFTRVFVFSIRVFSFASVVGIFILLPV  191



>ref|XP_002269926.1| PREDICTED: CSC1-like protein HYP1 [Vitis vinifera]
 ref|XP_010645179.1| PREDICTED: CSC1-like protein HYP1 [Vitis vinifera]
 ref|XP_010645180.1| PREDICTED: CSC1-like protein HYP1 [Vitis vinifera]
 ref|XP_010645181.1| PREDICTED: CSC1-like protein HYP1 [Vitis vinifera]
 ref|XP_010645182.1| PREDICTED: CSC1-like protein HYP1 [Vitis vinifera]
 ref|XP_010645183.1| PREDICTED: CSC1-like protein HYP1 [Vitis vinifera]
Length=715

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +S+LLTS G+N  +C++ F+LYS+L+KQP    VY  + LA    K+      ER +P
Sbjct  1    MLVSSLLTSLGINLGLCILFFMLYSILKKQPGNFEVYAPRLLAEGKSKKISHFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  +AW+ ++EE+ +  GLD +VF R  +FS R+F +A  + +F++LP+
Sbjct  61   SPGWVRRAWQPSEEELLSSSGLDTVVFMRIFIFSFRVFLVAGILGIFVLLPV  112



>emb|CBI38238.3| unnamed protein product [Vitis vinifera]
Length=888

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +S+LLTS G+N  +C++ F+LYS+L+KQP    VY  + LA    K+      ER +P
Sbjct  1    MLVSSLLTSLGINLGLCILFFMLYSILKKQPGNFEVYAPRLLAEGKSKKISHFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  +AW+ ++EE+ +  GLD +VF R  +FS R+F +A  + +F++LP+
Sbjct  61   SPGWVRRAWQPSEEELLSSSGLDTVVFMRIFIFSFRVFLVAGILGIFVLLPV  112



>ref|XP_010467963.1| PREDICTED: CSC1-like protein HYP1 [Camelina sativa]
Length=375

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLG-PKRPDPLCFERFV  296
            M LSALLTS G+N  +C + F LYS+LRKQP+ V+VY G +L   G  ++ +    ER +
Sbjct  1    MLLSALLTSVGINLGLCFLFFTLYSILRKQPANVTVY-GPRLVKDGNSQQSNAFNLERLL  59

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W  +A E T++EI +  GLDALVF R  VFSIR+FS A+ + +F++LP+
Sbjct  60   PTAGWVKRALEPTNDEILSNLGLDALVFVRVFVFSIRVFSFASVVGIFILLPV  112



>ref|XP_010108715.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXC20026.1| Uncharacterized membrane protein [Morus notabilis]
Length=717

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +C++ F LYS+LRKQP    VY  + LA    +R      ER +P
Sbjct  1    MLVSALLTSVGINSGLCILFFGLYSILRKQPLNNEVYLPRLLAEGKSQRTSRFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W   AW  +++++ A  GLDA+VF R I FS+++F  A  I +F++LP+
Sbjct  61   STGWLKNAWSLSEDDLLASSGLDAVVFMRVITFSLKVFVFAGIIGIFVLLPV  112



>ref|XP_002882200.1| hypothetical protein ARALYDRAFT_477418 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58459.1| hypothetical protein ARALYDRAFT_477418 [Arabidopsis lyrata subsp. 
lyrata]
Length=699

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGP-KRPDPLCFERFV  296
            M LSALLTS G+N  +C + F LYS+LRKQPS V+VY G +L   G  ++ +    ER +
Sbjct  1    MLLSALLTSVGINLGLCFLFFTLYSILRKQPSNVTVY-GPRLVKDGKSQQSNEFNLERLL  59

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W  +A E T++EI +  GLDALVF R  VFSIR+FS A+ + +F++LP+
Sbjct  60   PTAGWVKRALEPTNDEILSNLGLDALVFIRVFVFSIRVFSFASVVGIFILLPV  112



>gb|AES74767.2| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=588

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS  +N  +C++ F LYS+LRKQP  ++VY  + +A    K       ER +P
Sbjct  1    MILSALLTSVAINLGLCLLFFTLYSILRKQPGNINVYVPRFVAEGKVKEGGQFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            +  W  KAWE T++E  +  GLDA VF R
Sbjct  61   TAGWVRKAWEPTEDEFLSTSGLDAFVFMR  89



>ref|XP_010258239.1| PREDICTED: CSC1-like protein HYP1 [Nelumbo nucifera]
Length=717

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 42/90 (47%), Positives = 59/90 (66%), Gaps = 2/90 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLC-FERFV  296
            M +SALLTS G+N  +C++ F LYS+LRKQPS  +VY G +L   G  + +     ER +
Sbjct  1    MIVSALLTSVGINLGLCILFFTLYSILRKQPSNANVY-GPRLVAEGKSQQNSCSNIERLL  59

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDR  386
            PSP W  +AW+ ++EEI +  GLDA+V  R
Sbjct  60   PSPGWVRRAWQLSEEEILSTTGLDAVVLMR  89



>ref|XP_004135445.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cucumis 
sativus]
 gb|KGN51951.1| hypothetical protein Csa_5G606420 [Cucumis sativus]
Length=712

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +C    +LYS+LRKQP+  S+Y  + +A    KR      ER +P
Sbjct  1    MFVSALLTSVGINSAICFSFLVLYSILRKQPAYYSIYIPRLVAEGKTKRRSDFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S +W  KAW  ++EE+ +  GLDA+VF R + FS+++   A  I +F++LP+
Sbjct  61   SANWLKKAWMLSEEELLSSSGLDAVVFMRIVTFSLKVLLFAGIIGIFVLLPV  112



>ref|XP_004155380.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
YLR241W-like [Cucumis sativus]
Length=712

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +C    +LYS+LRKQP+  S+Y  + +A    KR      ER +P
Sbjct  1    MFVSALLTSVGINSAICFSFLVLYSILRKQPAYYSIYIPRLVAEGKTKRRSDFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S +W  KAW  ++EE+ +  GLDA+VF R + FS+++   A  I +F++LP+
Sbjct  61   SANWLKKAWMLSEEELLSSSGLDAVVFMRIVTFSLKVLLFAGIIGIFVLLPV  112



>emb|CAA56144.1| unnamed protein product [Arabidopsis thaliana]
Length=203

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPK--RPDPLCFERF  293
            M LSALLTS G+N  +C + F LYS+LRKQPS V+VY G +L     K  + +    ER 
Sbjct  80   MLLSALLTSVGINLGLCFLFFTLYSILRKQPSNVTVY-GPRLVKKDGKSQQSNEFNLERL  138

Query  294  VPSPSWFMKAWETTDEEINAVGGLDALVFDR  386
            +P+  W  +A E T++EI +  GLDALVF R
Sbjct  139  LPTAGWVKRALEPTNDEILSNLGLDALVFTR  169



>ref|XP_006338419.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Solanum 
tuberosum]
Length=716

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 69/112 (62%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C + F LYS+LRKQP    VY  + +A    ++      ER +P
Sbjct  1    MILSALLTSVGINLGLCFLFFTLYSILRKQPGNAEVYAPRLVAQGKSQQSSNFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  +AW  ++ E+ +  GLDA+VF R  +FS R+F+ A  + +F++LP+
Sbjct  61   SAGWVTRAWRPSEAELLSTSGLDAVVFMRIFIFSARVFTFAVIVGIFILLPI  112



>gb|AES74766.2| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=712

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS  +N  +C++ F LYS+LRKQP  ++VY  + +A    K       ER +P
Sbjct  1    MILSALLTSVAINLGLCLLFFTLYSILRKQPGNINVYVPRFVAEGKVKEGGQFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            +  W  KAWE T++E  +  GLDA VF R
Sbjct  61   TAGWVRKAWEPTEDEFLSTSGLDAFVFMR  89



>ref|XP_010258592.1| PREDICTED: CSC1-like protein HYP1 isoform X2 [Nelumbo nucifera]
Length=588

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 49/112 (44%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N  +C++ F LYS+LRKQP  V+VY  + +A    +       ER +P
Sbjct  1    MIVSALLTSVGINLGLCILFFTLYSILRKQPGNVNVYAPRLVAEGKFQHNSHFHLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  +AW  ++EE+ +  GLDA+V  R  VFS+R+FS A  + +F++LP+
Sbjct  61   SPGWVRRAWMPSEEELLSSSGLDAVVLMRIFVFSLRVFSFAGIVGIFILLPV  112



>ref|XP_003618548.1| Membrane protein, putative [Medicago truncatula]
Length=721

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS  +N  +C++ F LYS+LRKQP  ++VY  + +A    K       ER +P
Sbjct  1    MILSALLTSVAINLGLCLLFFTLYSILRKQPGNINVYVPRFVAEGKVKEGGQFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            +  W  KAWE T++E  +  GLDA VF R
Sbjct  61   TAGWVRKAWEPTEDEFLSTSGLDAFVFMR  89



>ref|XP_010463578.1| PREDICTED: CSC1-like protein HYP1 [Camelina sativa]
 ref|XP_010463579.1| PREDICTED: CSC1-like protein HYP1 [Camelina sativa]
 ref|XP_010463580.1| PREDICTED: CSC1-like protein HYP1 [Camelina sativa]
 ref|XP_010463581.1| PREDICTED: CSC1-like protein HYP1 [Camelina sativa]
 ref|XP_010463582.1| PREDICTED: CSC1-like protein HYP1 [Camelina sativa]
Length=591

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLG-PKRPDPLCFERFV  296
            M LSALLTS G+N  +C + F LYS+LRKQP+ V+VY G +L   G  ++ +    ER +
Sbjct  1    MLLSALLTSVGINLGLCFLFFTLYSILRKQPANVTVY-GPRLVKDGNSQQSNAFNLERLL  59

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W  +A E T++EI +  GLDALVF R  VFSIR+FS A+ + +F++LP+
Sbjct  60   PTAGWVKRALEPTNDEILSNLGLDALVFVRVFVFSIRVFSFASVVGIFILLPV  112



>gb|KDP27183.1| hypothetical protein JCGZ_19882 [Jatropha curcas]
Length=717

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRP--DPLCFERF  293
            M LSALLTS G+N  +C + F LYS+LRKQP  + VY  + +     ++   D    ER 
Sbjct  1    MLLSALLTSVGINLGLCFLFFTLYSILRKQPGNIFVYAPRLIDKQKSEQQTDDLFNLERL  60

Query  294  VPSPSWFMKAWETTDEEINAVGGLDALVFDR  386
            +PS SW   AW+ T+EE+ ++ GLDALVF R
Sbjct  61   LPSASWVRNAWQLTEEELLSISGLDALVFIR  91



>emb|CDY43268.1| BnaC05g48610D [Brassica napus]
Length=713

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGP-KRPDPLCFERFV  296
            M LSALLTS G+N  +C + F LYS+LRKQP  V+VY G +L   G  ++ +    ER +
Sbjct  1    MILSALLTSVGINLGLCFLFFTLYSILRKQPGNVTVY-GPRLIQAGKSQQTNAFNLERLL  59

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W  +A E T+EEI +  GLDALV  R  VFSIR+FS A+ + +F++LP+
Sbjct  60   PTAGWVKRALEPTNEEILSNLGLDALVLTRVFVFSIRVFSFASVVGIFILLPV  112



>ref|XP_010258582.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Nelumbo nucifera]
Length=714

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 49/112 (44%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N  +C++ F LYS+LRKQP  V+VY  + +A    +       ER +P
Sbjct  1    MIVSALLTSVGINLGLCILFFTLYSILRKQPGNVNVYAPRLVAEGKFQHNSHFHLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            SP W  +AW  ++EE+ +  GLDA+V  R  VFS+R+FS A  + +F++LP+
Sbjct  61   SPGWVRRAWMPSEEELLSSSGLDAVVLMRIFVFSLRVFSFAGIVGIFILLPV  112



>gb|AAF26163.1|AC008261_20 hypothetical protein [Arabidopsis thaliana]
Length=203

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 58/92 (63%), Gaps = 3/92 (3%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPK--RPDPLCFERF  293
            M LSALLTS G+N  +C + F LYS+LRKQPS V+VY G +L     K  + +    ER 
Sbjct  80   MLLSALLTSVGINLGLCFLFFTLYSILRKQPSNVTVY-GPRLVKKDGKSQQSNEFNLERL  138

Query  294  VPSPSWFMKAWETTDEEINAVGGLDALVFDRT  389
            +P+  W  +A E T++EI +  GLDALVF R 
Sbjct  139  LPTAGWVKRALEPTNDEILSNLGLDALVFIRV  170



>ref|XP_009134634.1| PREDICTED: CSC1-like protein HYP1 [Brassica rapa]
 ref|XP_009134635.1| PREDICTED: CSC1-like protein HYP1 [Brassica rapa]
Length=713

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLG-PKRPDPLCFERFV  296
            M LSALLTS G+N  +C + F LYS+LRKQP  V+VY G +L   G  ++ +    ER +
Sbjct  1    MILSALLTSVGINLGLCFLFFTLYSILRKQPGNVTVY-GPRLIQDGESQQTNAFNLERLL  59

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W  +A E T+E+I +  GLDALVF R +VFSIR+FS A+ + +F++LP+
Sbjct  60   PTAGWVRRALEPTNEDILSNLGLDALVFIRVLVFSIRVFSFASVVGIFILLPV  112



>ref|XP_009360589.1| PREDICTED: CSC1-like protein HYP1 [Pyrus x bretschneideri]
Length=716

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGP-KRPDPLCFERFV  296
            M +SALLTS G+N  +C++ F LYSVL+KQPS + VY  + LA  G  +  +   FER +
Sbjct  1    MLVSALLTSVGINLALCLLFFTLYSVLKKQPSNLRVYSPRSLAAKGASEESNGFNFERLL  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDR  386
            P+  W  +AW+ +++E  +V  LDA+VF R
Sbjct  61   PTAGWVRRAWQPSEDEFLSVTSLDAVVFMR  90



>ref|XP_007157718.1| hypothetical protein PHAVU_002G092500g [Phaseolus vulgaris]
 gb|ESW29712.1| hypothetical protein PHAVU_002G092500g [Phaseolus vulgaris]
Length=714

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+NT +CV+ F LYS+LRKQPS   VY  + LA    KR      ER +P
Sbjct  1    MIVSALLTSVGINTALCVLFFTLYSILRKQPSNYEVYVPRLLAEGISKRRSRFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  +AW  ++EE+ ++ GLD +VF R I FS+++F+ A  + + ++LP+
Sbjct  61   SAGWVAEAWRLSEEELLSLSGLDGVVFMRMITFSLKMFTFAGMVGILVILPV  112



>ref|XP_009105488.1| PREDICTED: CSC1-like protein At1g69450 [Brassica rapa]
 emb|CDX95935.1| BnaA07g27960D [Brassica napus]
Length=715

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 74/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKL-AHLGPKRPDPLCFERFV  296
            M +SALL S G+N+ +CV+ FILYS+LRKQP    V+  ++L A    +R + +   R++
Sbjct  1    MLVSALLMSVGINSCLCVLLFILYSILRKQPHNYEVFLPRRLVAGTSKRRRNKVA--RYI  58

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            PS  W  K+W  ++EE+ A  GLD +VF R I FS+++F  A  I +F++LP+
Sbjct  59   PSVRWIWKSWRPSEEELMASSGLDGVVFMRMITFSLKVFLFAGIIGVFVILPV  111



>ref|NP_177104.2| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 ref|NP_001185356.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 sp|F4I248.1|CSCLB_ARATH RecName: Full=CSC1-like protein At1g69450 [Arabidopsis thaliana]
 gb|AEE34926.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 gb|AEE34927.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 gb|AIU34624.1| hyperosmolality-gated Ca2+ permeable channel 2.4 [Arabidopsis 
thaliana]
Length=711

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 72/112 (64%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALL S G+N+ +CV+ FILYSVLRKQP    V+  ++LA+   KR       R++P
Sbjct  1    MLLSALLMSVGINSCLCVLLFILYSVLRKQPRNYEVFLPRRLANGTYKRRRNKV-ARYIP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  K+W  T++E+    GLD +VF R I FS+++F  A  I +F++LP+
Sbjct  60   SLKWIWKSWRPTEKELMESSGLDGVVFMRMITFSLKVFLFAGIIGVFVLLPV  111



>ref|XP_004232200.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Solanum lycopersicum]
 ref|XP_010316240.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Solanum lycopersicum]
Length=716

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 69/112 (62%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C + F LYS+LRKQP    VY  + +A    ++      ER +P
Sbjct  1    MILSALLTSVGINLGLCFLFFTLYSILRKQPGNAEVYAPRLVAEGRSQQISNFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  +AW  ++ E+ A  GLDA+VF R  +FS ++F+ A  + +F++LP+
Sbjct  61   SAGWVTRAWRPSEAELLANSGLDAVVFMRIFIFSAKVFTFAVIVGIFILLPI  112



>emb|CDX91963.1| BnaC03g32650D [Brassica napus]
Length=1240

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCF--ERF  293
            M LSALLTS G+N  +C + F LYS+LRKQP  V+VY G +L   G  + +   F  ER 
Sbjct  1    MILSALLTSVGINLGLCFLFFTLYSILRKQPGNVTVY-GPRLIQDGRSQEETNAFNLERL  59

Query  294  VPSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            +P+  W  +A E T+E+I +  GLDALVF R +VFSIR+FS A+ + +F++LP+
Sbjct  60   LPTAGWVRRALEPTNEDILSNLGLDALVFIRVLVFSIRVFSFASVVGIFILLPV  113



>ref|XP_004491850.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cicer 
arietinum]
Length=727

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C + F LYS+LRKQP  ++VY  + ++    +       ER  P
Sbjct  1    MILSALLTSVGINLSICSLFFTLYSILRKQPGNITVYAPRLVSERKLEEGGQFNLERLFP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            +  W  +AWE +D+E     GLDA VF R
Sbjct  61   TAGWVRRAWEPSDDEFIETAGLDAFVFVR  89



>ref|NP_001030613.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE73611.1| uncharacterized protein AT3G01100 [Arabidopsis thaliana]
Length=596

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPK--RPDPLCFERF  293
            M LSALLTS G+N  +C + F LYS+LRKQPS V+VY G +L     K  + +    ER 
Sbjct  1    MLLSALLTSVGINLGLCFLFFTLYSILRKQPSNVTVY-GPRLVKKDGKSQQSNEFNLERL  59

Query  294  VPSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            +P+  W  +A E T++EI +  GLDALVF R  VFSIR+FS A+ + +F++LP+
Sbjct  60   LPTAGWVKRALEPTNDEILSNLGLDALVFIRVFVFSIRVFSFASVVGIFILLPV  113



>ref|XP_002888719.1| hypothetical protein ARALYDRAFT_339179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64978.1| hypothetical protein ARALYDRAFT_339179 [Arabidopsis lyrata subsp. 
lyrata]
Length=711

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 71/112 (63%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALL S G+N+ +CV+ FILYSVLRKQP    V+  ++LA    KR       R++P
Sbjct  1    MLLSALLMSVGINSCLCVLFFILYSVLRKQPRNYEVFLPRRLADGTSKRRRNKV-ARYIP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  K+W  T++E+    GLD +VF R I FS+++F  A  I +F++LP+
Sbjct  60   SVKWIWKSWRPTEKELMESSGLDGVVFMRMITFSLKVFFFAGIIGVFVLLPV  111



>ref|XP_010485425.1| PREDICTED: CSC1-like protein HYP1 [Camelina sativa]
 ref|XP_010485426.1| PREDICTED: CSC1-like protein HYP1 [Camelina sativa]
 ref|XP_010485427.1| PREDICTED: CSC1-like protein HYP1 [Camelina sativa]
 ref|XP_010485428.1| PREDICTED: CSC1-like protein HYP1 [Camelina sativa]
Length=702

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGP-KRPDPLCFERFV  296
            M LSALLTS G+N  +C + F LYS+LRKQP+ V+VY G +L   G  ++ +    ER +
Sbjct  1    MLLSALLTSVGINLGLCFLFFTLYSILRKQPANVTVY-GPRLVKDGKSQQSNDFNLERLL  59

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W  +A E T++EI +  GLDALVF R  VFSIR+FS A+ + +F++LP+
Sbjct  60   PTAGWVKRALEPTNDEILSNLGLDALVFVRVFVFSIRVFSFASVVGVFILLPV  112



>ref|XP_008379386.1| PREDICTED: phosphate metabolism protein 7-like [Malus domestica]
Length=716

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGP-KRPDPLCFERFV  296
            M +SALLTS G+N  +C++ F LYS+LRKQPS ++VY  + +A     +  +   FER +
Sbjct  1    MIVSALLTSVGINLALCLLFFTLYSILRKQPSYLNVYSPRSVAAKEELEESNKFNFERLL  60

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDR  386
            P+  W  +AW+ +++E+ +V  LDA+VF R
Sbjct  61   PTAGWVRRAWQPSEDELLSVTSLDAVVFMR  90



>ref|NP_186759.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8GUH7.1|CSCLC_ARATH RecName: Full=CSC1-like protein HYP1; AltName: Full=HYPOTHETICAL 
PROTEIN 1 [Arabidopsis thaliana]
 gb|AAO00858.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37778.1| At3g01100 [Arabidopsis thaliana]
 gb|AEE73610.1| uncharacterized protein AT3G01100 [Arabidopsis thaliana]
 gb|AIU34623.1| hyperosmolality-gated Ca2+ permeable channel 2.3 [Arabidopsis 
thaliana]
Length=703

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPK--RPDPLCFERF  293
            M LSALLTS G+N  +C + F LYS+LRKQPS V+VY G +L     K  + +    ER 
Sbjct  1    MLLSALLTSVGINLGLCFLFFTLYSILRKQPSNVTVY-GPRLVKKDGKSQQSNEFNLERL  59

Query  294  VPSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            +P+  W  +A E T++EI +  GLDALVF R  VFSIR+FS A+ + +F++LP+
Sbjct  60   LPTAGWVKRALEPTNDEILSNLGLDALVFIRVFVFSIRVFSFASVVGIFILLPV  113



>dbj|BAD94293.1| hypothetical protein [Arabidopsis thaliana]
Length=703

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPK--RPDPLCFERF  293
            M LSALLTS G+N  +C + F LYS+LRKQPS V+VY G +L     K  + +    ER 
Sbjct  1    MLLSALLTSVGINLGLCFLFFTLYSILRKQPSNVTVY-GPRLVKKDGKSQQSNEFNLERL  59

Query  294  VPSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            +P+  W  +A E T++EI +  GLDALVF R  VFSIR+FS A+ + +F++LP+
Sbjct  60   LPTAGWVKRALEPTNDEILSNLGLDALVFIRVFVFSIRVFSFASVVGIFILLPV  113



>ref|XP_010430647.1| PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein HYP1 [Camelina 
sativa]
Length=699

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGP-KRPDPLCFERFV  296
            M LSALLTS G+N  +C + F LYS+LRKQP+ V+VY G +L   G  ++ +    ER +
Sbjct  1    MLLSALLTSVGINLGLCFLFFTLYSILRKQPANVTVY-GPRLVKDGKSQQSNDFNLERLL  59

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W  +A E T++EI +  GLDALVF R  VFSIR+FS A+ + +F++LP+
Sbjct  60   PTAGWVKRALEPTNDEILSNLGLDALVFVRVFVFSIRVFSFASVVGVFILLPV  112



>ref|XP_008446400.1| PREDICTED: uncharacterized membrane protein YLR241W [Cucumis 
melo]
Length=714

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N+ +C    +LYS+LRKQP+  S+Y  + +A    K+      ER +P
Sbjct  1    MFVSALLTSVGINSAICFSFLVLYSILRKQPAYYSIYIPRLVAEGKTKQRSDFNLERLIP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S +W  KAW  ++EE+ +  GLDA+VF R + FS+++   A  I +F++LP+
Sbjct  61   SANWLKKAWMLSEEELLSSSGLDAVVFMRIVTFSLKVLLFAGVIGIFVLLPV  112



>ref|XP_011098669.1| PREDICTED: CSC1-like protein HYP1 isoform X2 [Sesamum indicum]
Length=596

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C++ FILYSVLR +PS    Y  + +A    +R D     + + 
Sbjct  1    MILSALLTSVGINVALCLIFFILYSVLRNRPSYADFYIPRLVAEGKFQREDEFSVGKLLS  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            S  W  +AW+ +++E+ A  GLDA+VF R
Sbjct  61   SVKWVKRAWQPSEDELLANSGLDAVVFMR  89



>ref|XP_010511974.1| PREDICTED: CSC1-like protein At1g69450 [Camelina sativa]
Length=709

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSAL+ S G+N+ +CV+ FILYSVLRKQP    V+  ++LA    KR       R++P
Sbjct  1    MRLSALVMSVGINSCLCVLFFILYSVLRKQPRNYEVFLPRRLAAGTSKRRRNKV-ARYIP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  K+W  +++E+    GLD +VF R I FS+++F  A  I +F++LP+
Sbjct  60   SVKWIWKSWRPSEKELMESSGLDGVVFMRMITFSLKVFLFAVIIGIFVLLPV  111



>ref|XP_004489423.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cicer 
arietinum]
Length=713

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 68/112 (61%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS  +N  +C++ F LYS+LRKQP  ++VY  + +A    K       ER +P
Sbjct  1    MILSALLTSVAINLGLCLLFFTLYSILRKQPGNITVYVPRLVAEGKVKEGGHFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            +  W  KAWE T+EE     GLDA VF R  VFS+++F+    I +F++ P+
Sbjct  61   TAGWVRKAWEPTEEEFLLNCGLDAFVFMRIFVFSLKVFTFGGIIGMFVLFPI  112



>ref|XP_011098667.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Sesamum indicum]
 ref|XP_011098668.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Sesamum indicum]
Length=719

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C++ FILYSVLR +PS    Y  + +A    +R D     + + 
Sbjct  1    MILSALLTSVGINVALCLIFFILYSVLRNRPSYADFYIPRLVAEGKFQREDEFSVGKLLS  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            S  W  +AW+ +++E+ A  GLDA+VF R
Sbjct  61   SVKWVKRAWQPSEDELLANSGLDAVVFMR  89



>ref|XP_010911661.1| PREDICTED: CSC1-like protein HYP1, partial [Elaeis guineensis]
Length=117

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N  +CV+ F LYS+LRKQP  V  Y  + +A    +       E  +P
Sbjct  1    MIVSALLTSVGINLGLCVLFFTLYSILRKQPGNVKFYAPRLVAEGRARLRSEFNVESLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            SP W  KA E +++++ A  GLDA+VF R
Sbjct  61   SPGWVRKALEPSEDDLLASCGLDAVVFMR  89



>ref|XP_006299849.1| hypothetical protein CARUB_v10016052mg [Capsella rubella]
 gb|EOA32747.1| hypothetical protein CARUB_v10016052mg [Capsella rubella]
Length=702

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGP-KRPDPLCFERFV  296
            M LSALLTS G+N  +C + F LYS+LRKQP  V+VY G +L   G  +  +    ER +
Sbjct  1    MLLSALLTSVGINLGLCFLFFTLYSILRKQPGNVTVY-GPRLFKDGKSQHSNEFNLERLL  59

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            P+  W  +A E T++EI +  GLDALVF R  VFSIR+FS A+ + +F++LP+
Sbjct  60   PTAGWVKRALEPTNDEILSNLGLDALVFIRVFVFSIRVFSFASVVGVFILLPV  112



>ref|XP_009789223.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Nicotiana sylvestris]
 ref|XP_009789224.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Nicotiana sylvestris]
 ref|XP_009789226.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Nicotiana sylvestris]
 ref|XP_009789227.1| PREDICTED: CSC1-like protein HYP1 isoform X1 [Nicotiana sylvestris]
Length=715

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALLTS G+N  +C + F LYS+LRKQP    VY  + +A    ++ +    ER +P
Sbjct  1    MILSALLTSVGINLGLCFLFFTLYSILRKQPGNAEVYAPRLVAEGKSQQTNDFNLERLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            S  W  +AW+ ++ E+ +  GLD +VF R
Sbjct  61   SAGWVTRAWKLSEAELLSASGLDGVVFMR  89



>emb|CDY40924.1| BnaC06g30620D [Brassica napus]
Length=715

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKL-AHLGPKRPDPLCFERFV  296
            M +SALL S G+N+ +CV+ FILYS+LRKQP    V+  ++L A    +R + +   R++
Sbjct  1    MLVSALLMSVGINSCLCVLLFILYSILRKQPHNYEVFLPRRLVAGTSKRRRNKVA--RYI  58

Query  297  PSPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            PS  W  K+W  ++EE+    GLD +VF R I FS+++F  A  I +F++LP+
Sbjct  59   PSVRWIWKSWRPSEEELMEKSGLDGVVFMRMITFSLKVFLFAGIIGVFVILPV  111



>ref|XP_002305383.1| HYPOTHETICAL protein 1 [Populus trichocarpa]
 gb|EEE85894.1| HYPOTHETICAL protein 1 [Populus trichocarpa]
Length=716

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKL--AHLGPKRPDPLCFERF  293
            M LSALLTS G+N  +C++ F LYS+LRKQP    VY  + +      P+  D    ER 
Sbjct  1    MILSALLTSVGINLGLCLLFFTLYSILRKQPGNFYVYAPRLVDKEKSQPQESDDFYLERL  60

Query  294  VPSPSWFMKAWETTDEEINAVGGLDALVFDR  386
            +PS  W   AW+ +++EI ++ GLD LV  R
Sbjct  61   LPSAGWVRNAWQLSEDEILSISGLDGLVLTR  91



>ref|XP_003551746.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Glycine 
max]
 gb|KHN13592.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=713

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M L+ALLTS  +N  +C + F LYSVLRKQP  ++VY  + ++    +  D    ER +P
Sbjct  1    MILAALLTSVVINLGLCFIFFTLYSVLRKQPGNITVYAPRLVSEGKRQEGDQFNLERLLP  60

Query  300  SPS--WFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            + +  W  KAWET++EE  +  GLDA VF R  VFS++IF+    + L ++LP+
Sbjct  61   ATTAGWVRKAWETSEEEFLSTAGLDAFVFMRIFVFSLKIFTFGGIVGLLILLPI  114



>ref|XP_006300796.1| hypothetical protein CARUB_v10019875mg [Capsella rubella]
 gb|EOA33694.1| hypothetical protein CARUB_v10019875mg [Capsella rubella]
Length=709

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 71/112 (63%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSALL S G+N+ +CV+ FILYSVLRKQP    V+  ++LA    KR       R++P
Sbjct  1    MLLSALLMSVGINSCLCVLFFILYSVLRKQPRNYEVFLPRRLAAGTSKRRRNKV-ARYIP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  K+W  +++E+    GLD +VF R I FS+++F  A  I +F++LP+
Sbjct  60   SIKWIWKSWRPSEKELMESSGLDGVVFMRMITFSLKVFLFAGIIGVFVLLPV  111



>ref|XP_008780953.1| PREDICTED: CSC1-like protein HYP1 [Phoenix dactylifera]
Length=713

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M +SALLTS G+N  +CV+ F+LYS+LRKQP  +  Y  + +A    ++      E  +P
Sbjct  1    MIVSALLTSVGINLGLCVLFFVLYSILRKQPGNIKFYAPRLVAEGRARQRSEFNIESLLP  60

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDR  386
            SP W  KA E ++E++ A  GLDA+VF R
Sbjct  61   SPGWVRKALEPSEEDLLASCGLDAVVFMR  89



>ref|XP_010415590.1| PREDICTED: CSC1-like protein At1g69450 [Camelina sativa]
Length=709

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSAL+ S G+N+ +CV+ FILYSVLRKQP    V+  ++LA    KR       R++P
Sbjct  1    MLLSALVMSVGINSCLCVLFFILYSVLRKQPRNYEVFLPRRLAAGTSKRRRNKV-ARYIP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  K+W  +++E+    GLD +VF R I FS+++F  A  I +F++LP+
Sbjct  60   SVKWIWKSWRPSEKELMESSGLDGVVFMRMITFSLKVFLFAVIIGIFVLLPV  111



>ref|XP_007216321.1| hypothetical protein PRUPE_ppa019884mg [Prunus persica]
 gb|EMJ17520.1| hypothetical protein PRUPE_ppa019884mg [Prunus persica]
Length=757

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +3

Query  132  ALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKL-AHLGPKRPDPLCFERFVPSPS  308
            ALLTS G+N  +C++ F LYSVLRKQPS + VY  + + A  G ++ +   FER +P+  
Sbjct  5    ALLTSVGINLGLCLLFFTLYSVLRKQPSNLEVYAPRLVAAKEGSEQKNGFNFERLLPTAG  64

Query  309  WFMKAWETTDEEINAVGGLDALVFDR  386
            W  +AW+ +++E+ +V  LDA+VF R
Sbjct  65   WVKRAWQPSEDELLSVSSLDAVVFIR  90



>ref|XP_011010302.1| PREDICTED: CSC1-like protein HYP1 [Populus euphratica]
 ref|XP_011010303.1| PREDICTED: CSC1-like protein HYP1 [Populus euphratica]
Length=716

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKR--PDPLCFERF  293
            M LSALLTS G+N  +C++ F LYS+LRKQP  + VY  + +     ++   D    ER 
Sbjct  1    MILSALLTSVGINFGLCLLFFTLYSILRKQPGNLYVYAPRLVDKEKSQQQESDDFYLERL  60

Query  294  VPSPSWFMKAWETTDEEINAVGGLDALVFDR  386
            +PS  W   AW+ +++EI ++ GLD LVF R
Sbjct  61   LPSAGWVRNAWQLSEDEILSISGLDGLVFTR  91



>ref|XP_010470930.1| PREDICTED: CSC1-like protein At1g69450 [Camelina sativa]
 ref|XP_010470931.1| PREDICTED: CSC1-like protein At1g69450 [Camelina sativa]
Length=709

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  MNLSALLTSAGMNTVVCVVCFILYSVLRKQPSLVSVYFGQKLAHLGPKRPDPLCFERFVP  299
            M LSAL+ S G+N+ +CV+ FILYSVLRKQP    V+  ++LA    KR       R++P
Sbjct  1    MLLSALVMSVGINSCLCVLFFILYSVLRKQPRNYEVFLPRRLAAGTSKRRRNKV-ARYIP  59

Query  300  SPSWFMKAWETTDEEINAVGGLDALVFDRTivfsirifsiaasiCLFLVLPL  455
            S  W  K+W  +++E+    GLD +VF R I FS+++F  A  I +F++LP+
Sbjct  60   SVKWIWKSWRPSEKELMESSGLDGVVFMRMITFSLKVFLFAVIIGIFVLLPV  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566299029105