BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF024E13

Length=433
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773433.1|  PREDICTED: BEL1-like homeodomain protein 4       56.2    2e-06   Nicotiana sylvestris
ref|XP_009614985.1|  PREDICTED: BEL1-like homeodomain protein 4       55.8    3e-06   Nicotiana tomentosiformis
ref|XP_004238216.1|  PREDICTED: BEL1-like homeodomain protein 4       52.8    3e-05   Solanum lycopersicum



>ref|XP_009773433.1| PREDICTED: BEL1-like homeodomain protein 4 [Nicotiana sylvestris]
Length=657

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 57/94 (61%), Gaps = 18/94 (19%)
 Frame = +1

Query  160  EMMMRIHGGFE--------GDAPPGCDDSNGGMLAEMVDNYRSAWRKSAAQVLEEQIQAS  315
            E M+RI G FE         + P G     GGML E++ +Y SAWRK+A  +L++QIQ+S
Sbjct  24   EDMLRIQG-FEPLPPPPQQVEEPSGAVYDGGGMLTEII-SYPSAWRKAATDILDDQIQSS  81

Query  316  SYGGRSWPQKDN----PLSLNQA-LPLMNLIHVK  402
            +Y  R WPQK+     P S+N+  LPLMN  H+K
Sbjct  82   NY--RQWPQKEQQQLLPPSINEVELPLMN-SHIK  112



>ref|XP_009614985.1| PREDICTED: BEL1-like homeodomain protein 4 [Nicotiana tomentosiformis]
Length=659

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 48/64 (75%), Gaps = 9/64 (14%)
 Frame = +1

Query  226  GGMLAEMVDNYRSAWRKSAAQVLEEQIQASSYGGRSWPQKDN----PLSLNQA-LPLMNL  390
            GGML E++ +Y SAWRK+A ++L++QIQ+S+Y  R WPQK+     P ++N+A LPLMN 
Sbjct  55   GGMLTEII-SYPSAWRKAATEILDDQIQSSNY--RPWPQKEQQQQLPPAINEAELPLMN-  110

Query  391  IHVK  402
             H+K
Sbjct  111  SHIK  114



>ref|XP_004238216.1| PREDICTED: BEL1-like homeodomain protein 4 [Solanum lycopersicum]
Length=692

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 37/49 (76%), Gaps = 3/49 (6%)
 Frame = +1

Query  202  PPGCDDSNGGMLAEMVDNYRSAWRKSAAQVLEEQIQASSYGGRSWPQKD  348
            P      +GGML E++ +Y SAWRK+A ++L++QIQ+S+Y  RSWPQK+
Sbjct  53   PTATVYDDGGMLTEII-SYPSAWRKTATEILDDQIQSSNY--RSWPQKE  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566946208800