BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF023J01

Length=394
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625475.1|  PREDICTED: 60S ribosomal protein L18-2-like        189   5e-58   Nicotiana tomentosiformis
ref|XP_009629074.1|  PREDICTED: 60S ribosomal protein L18-2             188   1e-57   Nicotiana tomentosiformis
ref|XP_009783807.1|  PREDICTED: 60S ribosomal protein L18-2-like        188   2e-57   Nicotiana sylvestris
gb|KDP28183.1|  hypothetical protein JCGZ_13954                         186   7e-57   Jatropha curcas
ref|XP_009630920.1|  PREDICTED: 60S ribosomal protein L18-2-like        186   1e-56   Nicotiana tomentosiformis
ref|XP_009772706.1|  PREDICTED: 60S ribosomal protein L18-2-like        185   3e-56   Nicotiana sylvestris
ref|XP_002301485.1|  60S ribosomal protein L18                          184   7e-56   Populus trichocarpa [western balsam poplar]
ref|XP_010025256.1|  PREDICTED: 60S ribosomal protein L18-2             182   3e-55   Eucalyptus grandis [rose gum]
gb|KJB41868.1|  hypothetical protein B456_007G127300                    181   5e-55   Gossypium raimondii
ref|XP_010313195.1|  PREDICTED: 60S ribosomal protein L18-2-like        181   8e-55   Solanum lycopersicum
ref|XP_011042004.1|  PREDICTED: 60S ribosomal protein L18-2-like        181   9e-55   Populus euphratica
ref|XP_006344694.1|  PREDICTED: 60S ribosomal protein L18-2-like        181   9e-55   Solanum tuberosum [potatoes]
ref|NP_001237789.1|  uncharacterized protein LOC100500164               181   9e-55   Glycine max [soybeans]
gb|KJB45331.1|  hypothetical protein B456_007G301700                    181   1e-54   Gossypium raimondii
ref|XP_002320999.1|  60S ribosomal protein L18                          181   1e-54   Populus trichocarpa [western balsam poplar]
gb|KJB23304.1|  hypothetical protein B456_004G091200                    180   1e-54   Gossypium raimondii
gb|KJB41867.1|  hypothetical protein B456_007G127300                    181   2e-54   Gossypium raimondii
ref|XP_009796134.1|  PREDICTED: 60S ribosomal protein L18-2-like        181   2e-54   Nicotiana sylvestris
gb|KJB45330.1|  hypothetical protein B456_007G301700                    180   2e-54   Gossypium raimondii
gb|KJB82632.1|  hypothetical protein B456_013G206100                    179   4e-54   Gossypium raimondii
gb|KJB23303.1|  hypothetical protein B456_004G091200                    179   4e-54   Gossypium raimondii
gb|KHN43503.1|  60S ribosomal protein L18-2                             179   4e-54   Glycine soja [wild soybean]
ref|NP_001236701.1|  uncharacterized protein LOC100306301               179   4e-54   
gb|KHN03962.1|  60S ribosomal protein L18-2                             179   5e-54   Glycine soja [wild soybean]
ref|XP_007031040.1|  Ribosomal protein L18                              179   5e-54   Theobroma cacao [chocolate]
ref|XP_009630742.1|  PREDICTED: 60S ribosomal protein L18-2-like        179   6e-54   Nicotiana tomentosiformis
gb|KHF98574.1|  60S ribosomal L18-2 -like protein                       179   6e-54   Gossypium arboreum [tree cotton]
ref|XP_007163123.1|  hypothetical protein PHAVU_001G208200g             179   8e-54   Phaseolus vulgaris [French bean]
ref|XP_007147006.1|  hypothetical protein PHAVU_006G088800g             179   8e-54   Phaseolus vulgaris [French bean]
ref|XP_002523106.1|  60S ribosomal protein L18, putative                179   9e-54   Ricinus communis
ref|XP_010544997.1|  PREDICTED: 60S ribosomal protein L18-2-like        179   9e-54   Tarenaya hassleriana [spider flower]
ref|XP_010559184.1|  PREDICTED: 60S ribosomal protein L18-2-like        177   1e-53   Tarenaya hassleriana [spider flower]
ref|XP_011036896.1|  PREDICTED: 60S ribosomal protein L18-2             178   1e-53   Populus euphratica
ref|XP_006382454.1|  60S ribosomal protein L18                          178   2e-53   Populus trichocarpa [western balsam poplar]
ref|XP_010523956.1|  PREDICTED: 60S ribosomal protein L18-2-like        178   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_003556523.1|  PREDICTED: 60S ribosomal protein L18-2-like        178   2e-53   Glycine max [soybeans]
gb|KHN20393.1|  60S ribosomal protein L18-2                             180   2e-53   Glycine soja [wild soybean]
ref|XP_010559185.1|  PREDICTED: 60S ribosomal protein L18-2-like        177   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_007144959.1|  hypothetical protein PHAVU_007G197900g             177   3e-53   Phaseolus vulgaris [French bean]
gb|KJB41866.1|  hypothetical protein B456_007G127300                    178   3e-53   Gossypium raimondii
ref|XP_002270635.1|  PREDICTED: 60S ribosomal protein L18-2             177   4e-53   Vitis vinifera
ref|NP_001236071.1|  uncharacterized protein LOC100499789               177   4e-53   Glycine max [soybeans]
gb|KHG07157.1|  60S ribosomal L18-2 -like protein                       177   4e-53   Gossypium arboreum [tree cotton]
gb|KDP23459.1|  hypothetical protein JCGZ_23292                         176   5e-53   Jatropha curcas
ref|NP_001235897.1|  uncharacterized protein LOC100527681               176   8e-53   
ref|XP_007050975.1|  Ribosomal protein L18 isoform 2                    176   8e-53   
gb|KGN66048.1|  hypothetical protein Csa_1G569250                       178   8e-53   Cucumis sativus [cucumbers]
ref|XP_010659657.1|  PREDICTED: 60S ribosomal protein L18-2-like        176   1e-52   Vitis vinifera
ref|XP_010043043.1|  PREDICTED: 60S ribosomal protein L18-2             176   1e-52   Eucalyptus grandis [rose gum]
emb|CDP17112.1|  unnamed protein product                                177   1e-52   Coffea canephora [robusta coffee]
emb|CBI39539.3|  unnamed protein product                                177   1e-52   Vitis vinifera
ref|XP_008450608.1|  PREDICTED: 60S ribosomal protein L18-2             176   1e-52   Cucumis melo [Oriental melon]
gb|KHN20252.1|  60S ribosomal protein L18-3                             176   1e-52   Glycine soja [wild soybean]
ref|XP_006433452.1|  hypothetical protein CICLE_v10002597mg             175   1e-52   
ref|XP_007050974.1|  Ribosomal protein L18 isoform 1                    176   1e-52   Theobroma cacao [chocolate]
emb|CDO98841.1|  unnamed protein product                                177   2e-52   Coffea canephora [robusta coffee]
ref|XP_011023716.1|  PREDICTED: 60S ribosomal protein L18-2             175   2e-52   Populus euphratica
ref|XP_003554636.2|  PREDICTED: 60S ribosomal protein L18-2-like        176   2e-52   Glycine max [soybeans]
ref|XP_006433453.1|  hypothetical protein CICLE_v10002597mg             174   4e-52   Citrus clementina [clementine]
ref|XP_010938374.1|  PREDICTED: 60S ribosomal protein L18-2-like        174   4e-52   Elaeis guineensis
ref|XP_010684349.1|  PREDICTED: 60S ribosomal protein L18-2-like        174   4e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011079632.1|  PREDICTED: 60S ribosomal protein L18-2             174   5e-52   Sesamum indicum [beniseed]
ref|XP_010273829.1|  PREDICTED: 60S ribosomal protein L18-2-like        174   5e-52   Nelumbo nucifera [Indian lotus]
ref|XP_004144773.1|  PREDICTED: 60S ribosomal protein L18-3-like        174   7e-52   Cucumis sativus [cucumbers]
ref|XP_010546736.1|  PREDICTED: 60S ribosomal protein L18-3             174   8e-52   Tarenaya hassleriana [spider flower]
gb|AFK49563.1|  unknown                                                 174   8e-52   Lotus japonicus
ref|XP_011079633.1|  PREDICTED: 60S ribosomal protein L18-2-like        173   9e-52   Sesamum indicum [beniseed]
ref|XP_008454015.1|  PREDICTED: 60S ribosomal protein L18-3             173   9e-52   Cucumis melo [Oriental melon]
ref|XP_002319502.1|  60S ribosomal protein L18                          173   1e-51   Populus trichocarpa [western balsam poplar]
gb|ABK92688.1|  unknown                                                 173   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010259492.1|  PREDICTED: 60S ribosomal protein L18-3             173   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_003591163.1|  Ribosomal protein L18                              173   1e-51   Medicago truncatula
ref|XP_010088293.1|  60S ribosomal protein L18-3                        173   2e-51   
ref|XP_002271179.1|  PREDICTED: 60S ribosomal protein L18-2             172   2e-51   Vitis vinifera
ref|XP_004135776.1|  PREDICTED: uncharacterized protein LOC101207642    178   2e-51   
ref|XP_010674074.1|  PREDICTED: 60S ribosomal protein L18-2             172   2e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006386732.1|  hypothetical protein POPTR_0002s20400g             172   2e-51   
emb|CDY40718.1|  BnaC03g34340D                                          173   3e-51   Brassica napus [oilseed rape]
gb|AFK45456.1|  unknown                                                 172   4e-51   Lotus japonicus
ref|XP_008386678.1|  PREDICTED: 60S ribosomal protein L18-2-like        171   5e-51   
emb|CDX74138.1|  BnaA03g29090D                                          172   5e-51   
ref|XP_002874343.1|  60S ribosomal protein L18                          171   6e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_006298640.1|  hypothetical protein CARUB_v10014730mg             171   6e-51   Capsella rubella
gb|EMS45435.1|  60S ribosomal protein L18-2                             171   7e-51   Triticum urartu
ref|XP_010094463.1|  60S ribosomal protein L18-2                        171   7e-51   
ref|XP_010931680.1|  PREDICTED: 60S ribosomal protein L18-2             171   7e-51   Elaeis guineensis
ref|XP_010528904.1|  PREDICTED: 60S ribosomal protein L18-2             171   8e-51   Tarenaya hassleriana [spider flower]
ref|XP_006359857.1|  PREDICTED: 60S ribosomal protein L18-2-like        171   8e-51   Solanum tuberosum [potatoes]
ref|XP_004494383.1|  PREDICTED: 60S ribosomal protein L18-like          171   9e-51   Cicer arietinum [garbanzo]
gb|AAO46881.1|  60S ribosomal protein                                   170   1e-50   Medicago sativa [alfalfa]
ref|XP_009134833.1|  PREDICTED: 60S ribosomal protein L18-2             171   1e-50   Brassica rapa
emb|CBI36879.3|  unnamed protein product                                174   1e-50   Vitis vinifera
ref|XP_009124870.1|  PREDICTED: 60S ribosomal protein L18-2-like        171   1e-50   Brassica rapa
ref|XP_010104147.1|  60S ribosomal protein L18-2                        171   1e-50   
ref|XP_007205962.1|  hypothetical protein PRUPE_ppa012012mg             171   1e-50   Prunus persica
ref|XP_010486014.1|  PREDICTED: 60S ribosomal protein L18-3             170   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002512455.1|  60S ribosomal protein L18, putative                176   2e-50   
gb|AFK34017.1|  unknown                                                 170   2e-50   Medicago truncatula
ref|XP_010429374.1|  PREDICTED: 60S ribosomal protein L18-3-like        170   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006394935.1|  hypothetical protein EUTSA_v10004865mg             171   2e-50   
ref|XP_006855263.1|  hypothetical protein AMTR_s00183p00048560          170   2e-50   Amborella trichopoda
gb|KEH24393.1|  60S ribosomal protein L18-3                             170   2e-50   Medicago truncatula
gb|ACJ85943.1|  unknown                                                 170   2e-50   Medicago truncatula
ref|XP_009338229.1|  PREDICTED: 60S ribosomal protein L18-2-like        170   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_002882427.1|  hypothetical protein ARALYDRAFT_477850             170   2e-50   Arabidopsis lyrata subsp. lyrata
emb|CBI22977.3|  unnamed protein product                                172   2e-50   Vitis vinifera
ref|XP_008775991.1|  PREDICTED: 60S ribosomal protein L18-2             170   2e-50   Phoenix dactylifera
ref|NP_187210.1|  60S ribosomal protein L18-2                           170   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464086.1|  PREDICTED: 60S ribosomal protein L18-3-like        170   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_008388515.1|  PREDICTED: 60S ribosomal protein L18-2-like        170   3e-50   Malus domestica [apple tree]
ref|XP_009335702.1|  PREDICTED: 60S ribosomal protein L18-2             169   3e-50   Pyrus x bretschneideri [bai li]
gb|KFK26512.1|  hypothetical protein AALP_AA8G258600                    169   3e-50   Arabis alpina [alpine rockcress]
ref|XP_008784768.1|  PREDICTED: 60S ribosomal protein L18-2-like        169   3e-50   Phoenix dactylifera
ref|XP_008810211.1|  PREDICTED: 60S ribosomal protein L18-2-like        169   4e-50   Phoenix dactylifera
emb|CDY18813.1|  BnaAnng02780D                                          171   4e-50   Brassica napus [oilseed rape]
ref|XP_007201344.1|  hypothetical protein PRUPE_ppa012001mg             169   5e-50   Prunus persica
ref|XP_008369026.1|  PREDICTED: 60S ribosomal protein L18-2             169   5e-50   
gb|AAA69928.1|  cytoplasmic ribosomal protein L18                       169   5e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002465302.1|  hypothetical protein SORBIDRAFT_01g035860          169   5e-50   Sorghum bicolor [broomcorn]
ref|NP_198137.1|  60S ribosomal protein L18-3                           169   6e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009384409.1|  PREDICTED: 60S ribosomal protein L18-2             169   6e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK26318.1|  unknown                                                 169   6e-50   Picea sitchensis
gb|EMT12638.1|  60S ribosomal protein L18-2                             169   7e-50   
ref|XP_009417724.1|  PREDICTED: 60S ribosomal protein L18-2             168   8e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007050976.1|  Ribosomal protein L18 isoform 3                    168   8e-50   
ref|XP_008370417.1|  PREDICTED: 60S ribosomal protein L18-2             168   9e-50   Malus domestica [apple tree]
gb|KDO39192.1|  hypothetical protein CISIN_1g030771mg                   167   9e-50   Citrus sinensis [apfelsine]
gb|KJB82634.1|  hypothetical protein B456_013G206100                    168   1e-49   Gossypium raimondii
ref|XP_010269589.1|  PREDICTED: 60S ribosomal protein L18-3             168   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_009411663.1|  PREDICTED: 60S ribosomal protein L18-3-like        168   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010914484.1|  PREDICTED: 60S ribosomal protein L18-3             167   2e-49   Elaeis guineensis
ref|XP_004984437.1|  PREDICTED: 60S ribosomal protein L18-2-like        167   2e-49   
ref|XP_006408052.1|  hypothetical protein EUTSA_v10021598mg             167   2e-49   Eutrema salsugineum [saltwater cress]
ref|XP_006840598.1|  hypothetical protein AMTR_s00343p00015240          167   2e-49   
emb|CDY66803.1|  BnaAnng22990D                                          167   2e-49   Brassica napus [oilseed rape]
ref|XP_009111741.1|  PREDICTED: 60S ribosomal protein L18-2-like        167   2e-49   Brassica rapa
gb|ABK22247.1|  unknown                                                 167   2e-49   Picea sitchensis
ref|XP_009151179.1|  PREDICTED: 60S ribosomal protein L18-2             167   3e-49   Brassica rapa
ref|XP_001781485.1|  predicted protein                                  167   4e-49   
emb|CDX99969.1|  BnaC09g03320D                                          167   4e-49   
ref|XP_002461201.1|  hypothetical protein SORBIDRAFT_02g042750          166   5e-49   Sorghum bicolor [broomcorn]
emb|CDY19736.1|  BnaA09g03890D                                          167   5e-49   Brassica napus [oilseed rape]
ref|XP_010228645.1|  PREDICTED: 60S ribosomal protein L18-2-like        166   7e-49   Brachypodium distachyon [annual false brome]
ref|XP_003562459.1|  PREDICTED: 60S ribosomal protein L18-3-like        166   7e-49   
emb|CDY25018.1|  BnaC02g39900D                                          166   8e-49   Brassica napus [oilseed rape]
ref|XP_009129884.1|  PREDICTED: 60S ribosomal protein L18-2-like        167   9e-49   Brassica rapa
emb|CDX80616.1|  BnaC07g28280D                                          167   1e-48   
ref|NP_001050069.1|  Os03g0341100                                       166   1e-48   
ref|NP_001131538.1|  uncharacterized protein LOC100192878               166   1e-48   Zea mays [maize]
gb|ABK21809.1|  unknown                                                 165   1e-48   Picea sitchensis
ref|XP_001760902.1|  predicted protein                                  165   1e-48   
ref|XP_006444385.1|  hypothetical protein CICLE_v10022435mg             165   2e-48   Citrus clementina [clementine]
ref|XP_009402513.1|  PREDICTED: 60S ribosomal protein L18-2-like        165   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
emb|CEF99132.1|  Ribosomal protein L18e, conserved site                 164   3e-48   Ostreococcus tauri
ref|XP_001751734.1|  predicted protein                                  164   5e-48   
gb|KFK37967.1|  hypothetical protein AALP_AA3G053100                    163   7e-48   Arabis alpina [alpine rockcress]
ref|XP_006650060.1|  PREDICTED: 60S ribosomal protein L18-3-like        163   8e-48   Oryza brachyantha
ref|XP_004494578.1|  PREDICTED: 60S ribosomal protein L18-like          163   8e-48   
ref|XP_006288739.1|  hypothetical protein CARUB_v10002048mg             163   8e-48   Capsella rubella
ref|XP_001785869.1|  predicted protein                                  163   9e-48   
gb|AFW81438.1|  hypothetical protein ZEAMMB73_288952                    161   9e-48   
ref|XP_010455077.1|  PREDICTED: 60S ribosomal protein L18-3-like ...    163   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010421566.1|  PREDICTED: 60S ribosomal protein L18-2-like        163   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_001760959.1|  predicted protein                                  162   2e-47   
ref|XP_009381102.1|  PREDICTED: 60S ribosomal protein L18-2-like        161   4e-47   
gb|AFW77276.1|  hypothetical protein ZEAMMB73_917876                    160   5e-47   
gb|EPS67068.1|  hypothetical protein M569_07709                         161   5e-47   Genlisea aurea
ref|NP_001132852.1|  uncharacterized protein LOC100194344               161   6e-47   Zea mays [maize]
ref|XP_001419602.1|  Ribosomal protein L18, component of cytosoli...    161   7e-47   Ostreococcus lucimarinus CCE9901
ref|XP_008789961.1|  PREDICTED: uncharacterized protein LOC103707302    172   9e-47   
ref|XP_008656150.1|  PREDICTED: 60S ribosomal protein L18-3-like        161   1e-46   
gb|EMT18368.1|  60S ribosomal protein L18-2                             160   1e-46   
pdb|3J61|Q  Chain Q, Localization Of The Large Subunit Ribosomal ...    160   1e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002439318.1|  hypothetical protein SORBIDRAFT_09g004290          160   1e-46   Sorghum bicolor [broomcorn]
gb|AFC88838.1|  60S ribosomal protein L18-like protein                  160   1e-46   Miscanthus sinensis
ref|XP_003626231.1|  60S ribosomal protein L18                          160   2e-46   Medicago truncatula
ref|XP_001690885.1|  ribosomal protein L18, component of cytosoli...    160   2e-46   Chlamydomonas reinhardtii
ref|XP_006658116.1|  PREDICTED: 60S ribosomal protein L18-3-like        160   2e-46   Oryza brachyantha
emb|CDY05559.1|  BnaA02g31320D                                          167   2e-46   
dbj|BAJ90421.1|  predicted protein                                      160   2e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004958675.1|  PREDICTED: 60S ribosomal protein L18-3-like        159   2e-46   Setaria italica
ref|XP_010921627.1|  PREDICTED: uncharacterized protein LOC105045157    165   4e-46   
gb|AGV54741.1|  60S ribosomal protein L18-3-like protein                159   1e-45   Phaseolus vulgaris [French bean]
ref|XP_002948325.1|  component of cytosolic 80S ribosome and 60S ...    158   1e-45   Volvox carteri f. nagariensis
ref|XP_003568896.1|  PREDICTED: 60S ribosomal protein L18-2-like        157   1e-45   Brachypodium distachyon [annual false brome]
ref|XP_005643635.1|  ribosomal protein L18 component of cytosolic...    157   2e-45   Coccomyxa subellipsoidea C-169
ref|XP_006654064.1|  PREDICTED: 60S ribosomal protein L18-2-like        156   4e-45   Oryza brachyantha
emb|CDY05183.1|  BnaC05g46200D                                          157   4e-45   
ref|XP_004977069.1|  PREDICTED: 60S ribosomal protein L18-2-like        156   5e-45   Setaria italica
gb|EMS65848.1|  60S ribosomal protein L18-2                             157   7e-45   Triticum urartu
gb|EYU46738.1|  hypothetical protein MIMGU_mgv1a014520mg                155   8e-45   Erythranthe guttata [common monkey flower]
ref|XP_004495692.1|  PREDICTED: 60S ribosomal protein L18-like          155   1e-44   Cicer arietinum [garbanzo]
ref|XP_005843726.1|  hypothetical protein CHLNCDRAFT_37334              155   1e-44   Chlorella variabilis
sp|O65729.1|RL18_CICAR  RecName: Full=60S ribosomal protein L18         155   2e-44   Cicer arietinum [garbanzo]
ref|XP_009629121.1|  PREDICTED: 60S ribosomal protein L18-2             155   2e-44   Nicotiana tomentosiformis
gb|KIZ05100.1|  60S ribosomal protein L18-3                             154   2e-44   Monoraphidium neglectum
ref|NP_001060617.1|  Os07g0674700                                       154   2e-44   
emb|CDP05500.1|  unnamed protein product                                151   2e-44   Coffea canephora [robusta coffee]
ref|NP_001054688.1|  Os05g0155100                                       154   2e-44   
ref|XP_010550997.1|  PREDICTED: 60S ribosomal protein L18-3-like ...    153   8e-44   Tarenaya hassleriana [spider flower]
ref|XP_010524859.1|  PREDICTED: 60S ribosomal protein L18-3             152   1e-43   Tarenaya hassleriana [spider flower]
ref|XP_002985888.1|  hypothetical protein SELMODRAFT_181978             152   3e-43   Selaginella moellendorffii
sp|O22254.3|RL181_ARATH  RecName: Full=Putative 60S ribosomal pro...    152   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002976425.1|  hypothetical protein SELMODRAFT_267976             151   3e-43   Selaginella moellendorffii
gb|KFK32338.1|  hypothetical protein AALP_AA6G228700                    151   5e-43   Arabis alpina [alpine rockcress]
emb|CDP07204.1|  unnamed protein product                                147   7e-43   Coffea canephora [robusta coffee]
ref|XP_007510670.1|  predicted protein                                  152   1e-42   Bathycoccus prasinos
ref|XP_004247404.1|  PREDICTED: 60S ribosomal protein L18-2             149   4e-42   Solanum lycopersicum
ref|XP_008669243.1|  PREDICTED: uncharacterized protein LOC103646289    148   1e-41   
ref|XP_011396696.1|  60S ribosomal protein L18-3                        147   1e-41   Auxenochlorella protothecoides
gb|KJB26287.1|  hypothetical protein B456_004G239000                    147   3e-41   Gossypium raimondii
ref|XP_009611670.1|  PREDICTED: 60S ribosomal protein L18-2-like        145   1e-40   Nicotiana tomentosiformis
emb|CBK21900.2|  Ribosomal protein L18e                                 144   4e-40   Blastocystis hominis
gb|EWM27599.1|  Ribosomal protein L18e/L15P                             143   6e-40   Nannochloropsis gaditana
emb|CBK22327.2|  unnamed protein product                                141   5e-39   Blastocystis hominis
gb|KHG01788.1|  60S ribosomal L18-2 -like protein                       139   2e-38   Gossypium arboreum [tree cotton]
ref|XP_004290808.1|  PREDICTED: 60S ribosomal protein L18-2             139   2e-38   Fragaria vesca subsp. vesca
ref|XP_003056676.1|  predicted protein                                  139   2e-38   Micromonas pusilla CCMP1545
ref|XP_010277700.1|  PREDICTED: uncharacterized protein LOC104612082    144   1e-37   
ref|XP_006677675.1|  hypothetical protein BATDEDRAFT_87003              137   1e-37   Batrachochytrium dendrobatidis JAM81
ref|XP_002506220.1|  ribosomal protein L18                              142   2e-37   Micromonas commoda
gb|EYU21621.1|  hypothetical protein MIMGU_mgv1a014504mg                136   2e-37   Erythranthe guttata [common monkey flower]
gb|EAW52364.1|  ribosomal protein L18, isoform CRA_f                    134   7e-37   Homo sapiens [man]
gb|AFC88843.1|  60S ribosomal protein L18-3-like protein                134   7e-37   Miscanthus sinensis
gb|EDM07303.1|  rCG53680, isoform CRA_b                                 134   7e-37   Rattus norvegicus [brown rat]
gb|ACD65122.1|  putative 60S ribosomal protein RPL18                    133   1e-36   Novocrania anomala
ref|XP_008607735.1|  60S ribosomal protein                              134   1e-36   Saprolegnia diclina VS20
gb|EAW52359.1|  ribosomal protein L18, isoform CRA_b                    134   2e-36   Homo sapiens [man]
ref|XP_004061142.1|  PREDICTED: 60S ribosomal protein L18               134   2e-36   
ref|XP_007074184.1|  PREDICTED: ribosomal protein L18-like              134   2e-36   Panthera tigris altaica
ref|XP_006039668.1|  PREDICTED: 60S ribosomal protein L18-like          132   2e-36   
ref|XP_004089423.1|  PREDICTED: 60S ribosomal protein L18               134   2e-36   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_003801570.1|  PREDICTED: ribosomal protein L18-like              134   2e-36   Otolemur garnettii
ref|XP_005336693.1|  PREDICTED: 60S ribosomal protein L18               134   3e-36   
ref|NP_000970.1|  60S ribosomal protein L18 isoform 1                   134   3e-36   Homo sapiens [man]
ref|XP_010385886.1|  PREDICTED: 60S ribosomal protein L18               134   3e-36   Rhinopithecus roxellana
ref|XP_008567503.1|  PREDICTED: 60S ribosomal protein L18               133   3e-36   Galeopterus variegatus [Malayan flying lemur]
ref|XP_010366954.1|  PREDICTED: 60S ribosomal protein L18               133   4e-36   Rhinopithecus roxellana
ref|NP_001182442.1|  60S ribosomal protein L18                          133   4e-36   Equus caballus [domestic horse]
ref|NP_112364.1|  60S ribosomal protein L18                             133   4e-36   Rattus norvegicus [brown rat]
ref|XP_006868227.1|  PREDICTED: ribosomal protein L18-like              133   4e-36   Chrysochloris asiatica
ref|XP_005664749.1|  PREDICTED: 60S ribosomal protein L18-like          132   4e-36   
ref|XP_009775352.1|  PREDICTED: 60S ribosomal protein L18-2             132   4e-36   Nicotiana sylvestris
ref|XP_008843215.1|  PREDICTED: 60S ribosomal protein L18 isoform X2    133   5e-36   Nannospalax galili
ref|XP_006160253.1|  PREDICTED: 60S ribosomal protein L18               133   5e-36   Tupaia chinensis
ref|XP_004451162.1|  PREDICTED: ribosomal protein L18-like              133   6e-36   Dasypus novemcinctus
ref|XP_005312106.1|  PREDICTED: 60S ribosomal protein L18               133   6e-36   Chrysemys picta bellii
ref|XP_001745439.1|  hypothetical protein                               132   8e-36   Monosiga brevicollis MX1
ref|XP_008843214.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    132   9e-36   Nannospalax galili
ref|XP_008046837.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    132   1e-35   Carlito syrichta
ref|XP_007536290.1|  PREDICTED: 60S ribosomal protein L18               132   1e-35   Erinaceus europaeus [common hedgehog]
ref|NP_001015556.1|  60S ribosomal protein L18                          132   1e-35   Bos taurus [bovine]
ref|XP_005434338.1|  PREDICTED: 60S ribosomal protein L18-like          132   1e-35   
ref|XP_006109734.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    132   1e-35   Myotis lucifugus
ref|XP_009834317.1|  hypothetical protein H257_09702                    132   2e-35   Aphanomyces astaci
gb|AAH21743.1|  Ribosomal protein L18                                   132   2e-35   Homo sapiens [man]
emb|CBK22442.2|  unnamed protein product                                132   2e-35   Blastocystis hominis
ref|NP_001011030.1|  60S ribosomal protein L18                          132   2e-35   Xenopus tropicalis [western clawed frog]
ref|XP_004694311.1|  PREDICTED: 60S ribosomal protein L18               132   2e-35   Condylura cristata
ref|XP_008152619.1|  PREDICTED: 60S ribosomal protein L18               132   2e-35   Eptesicus fuscus
ref|NP_001187045.1|  60S ribosomal protein L18                          131   2e-35   Ictalurus punctatus
emb|CAA28689.1|  ribosomal protein L14                                  131   2e-35   Xenopus laevis [clawed frog]
ref|XP_006779428.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    130   2e-35   
ref|NP_001082683.1|  60S ribosomal protein L18-B                        131   2e-35   Xenopus laevis [clawed frog]
ref|XP_008876054.1|  hypothetical protein H310_11242                    131   2e-35   Aphanomyces invadans
gb|EFB23978.1|  hypothetical protein PANDA_006316                       131   2e-35   Ailuropoda melanoleuca
ref|XP_005589842.1|  PREDICTED: uncharacterized LOC101867006 isof...    131   2e-35   Macaca fascicularis [crab eating macaque]
emb|CAB40827.1|  unnamed protein product                                131   3e-35   Xenopus laevis [clawed frog]
gb|ELT99918.1|  hypothetical protein CAPTEDRAFT_159560                  131   3e-35   Capitella teleta
ref|XP_001082813.1|  PREDICTED: 60S ribosomal protein L18-like is...    131   3e-35   
ref|XP_003691391.1|  PREDICTED: 60S ribosomal protein L18-like          131   3e-35   Apis florea [dwarf honeybee]
ref|XP_006561192.1|  PREDICTED: 60S ribosomal protein L18-like          131   3e-35   Apis mellifera [bee]
sp|P02412.4|RL18B_XENLA  RecName: Full=60S ribosomal protein L18-...    131   3e-35   Xenopus laevis [clawed frog]
ref|XP_004271135.1|  PREDICTED: 60S ribosomal protein L18 isoform 1     131   4e-35   Orcinus orca [Orca]
ref|XP_004646586.1|  PREDICTED: 60S ribosomal protein L18               130   4e-35   
ref|XP_006229223.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    131   4e-35   Rattus norvegicus [brown rat]
ref|XP_011351685.1|  PREDICTED: 60S ribosomal protein L18               130   4e-35   Ooceraea biroi
dbj|BAG56896.1|  unnamed protein product                                129   5e-35   Homo sapiens [man]
gb|AFW81440.1|  hypothetical protein ZEAMMB73_288952                    127   5e-35   
ref|XP_006894610.1|  PREDICTED: ribosomal protein L18-like              130   5e-35   
emb|CBJ25909.1|  cytoplasmic ribosomal protein L18                      130   6e-35   
emb|CAN68117.1|  hypothetical protein VITISV_012514                     132   7e-35   
gb|ELR56635.1|  60S ribosomal protein L18                               130   7e-35   
ref|XP_001092745.1|  PREDICTED: 60S ribosomal protein L18-like          130   9e-35   
gb|ELW47918.1|  60S ribosomal protein L18                               130   9e-35   
ref|XP_011372891.1|  PREDICTED: 60S ribosomal protein L18               130   1e-34   
gb|EAW52362.1|  ribosomal protein L18, isoform CRA_d                    128   1e-34   
ref|XP_011135288.1|  PREDICTED: 60S ribosomal protein L18               129   1e-34   
ref|XP_011255380.1|  PREDICTED: 60S ribosomal protein L18               129   1e-34   
gb|EDM07304.1|  rCG53680, isoform CRA_c                                 127   1e-34   
sp|Q95342.3|RL18_PIG  RecName: Full=60S ribosomal protein L18           127   1e-34   
gb|KFM61778.1|  60S ribosomal protein L18                               128   2e-34   
ref|NP_001082681.1|  60S ribosomal protein L18-A                        129   2e-34   
ref|XP_003707499.1|  PREDICTED: 60S ribosomal protein L18-like          129   2e-34   
gb|ABW23172.1|  ribosomal protein rpl18                                 129   3e-34   
ref|XP_005704346.1|  60S ribosomal protein L18e                         128   3e-34   
ref|XP_005787945.1|  hypothetical protein EMIHUDRAFT_433854             128   3e-34   
gb|ABW90395.1|  putative ribosomal protein L18                          128   4e-34   
ref|XP_004619784.1|  PREDICTED: 60S ribosomal protein L18               130   4e-34   
ref|XP_005561217.1|  PREDICTED: 60S ribosomal protein L18-like          128   4e-34   
ref|XP_011497333.1|  PREDICTED: 60S ribosomal protein L18               128   4e-34   
ref|XP_010495537.1|  PREDICTED: 60S ribosomal protein L18-3-like        126   4e-34   
ref|XP_005875781.1|  PREDICTED: 60S ribosomal protein L18-like          128   4e-34   
gb|AAN73382.1|  ribosomal protein L18                                   128   5e-34   
gb|ABR23470.1|  60s ribosomal protein L18                               128   5e-34   
ref|XP_005798872.1|  PREDICTED: 60S ribosomal protein L18-like          128   5e-34   
ref|XP_008201914.1|  PREDICTED: 60S ribosomal protein L18               127   7e-34   
ref|XP_007550032.1|  PREDICTED: 60S ribosomal protein L18               127   7e-34   
ref|XP_008429815.1|  PREDICTED: 60S ribosomal protein L18               127   8e-34   
ref|XP_008546759.1|  PREDICTED: 60S ribosomal protein L18               127   9e-34   
ref|XP_011062886.1|  PREDICTED: 60S ribosomal protein L18               128   9e-34   
ref|XP_006903368.1|  PREDICTED: ribosomal protein L18-like              127   1e-33   
ref|XP_006026818.1|  PREDICTED: 60S ribosomal protein L18               127   1e-33   
ref|XP_968042.1|  PREDICTED: 60S ribosomal protein L18                  127   1e-33   
ref|XP_006138489.1|  PREDICTED: 60S ribosomal protein L18-like          127   1e-33   
ref|XP_004780465.1|  PREDICTED: ribosomal protein L18-like              127   1e-33   
gb|EFN87206.1|  60S ribosomal protein L18                               127   1e-33   
ref|XP_006266602.1|  PREDICTED: 60S ribosomal protein L18               129   1e-33   
gb|ABZ04231.1|  ribosomal protein rpl18                                 127   1e-33   
ref|XP_005822438.1|  large subunit ribosomal protein L18e, cytopl...    127   2e-33   
gb|ACO51847.1|  60S ribosomal protein L18                               126   2e-33   
gb|ESA23412.1|  hypothetical protein GLOINDRAFT_342179                  126   2e-33   
ref|XP_005715661.1|  unnamed protein product                            126   2e-33   
ref|XP_011351645.1|  PREDICTED: 60S ribosomal protein L18-like          126   2e-33   
dbj|BAN21088.1|  ribosomal protein L18                                  126   3e-33   
ref|XP_010883138.1|  PREDICTED: 60S ribosomal protein L18               126   3e-33   
ref|XP_002722941.1|  PREDICTED: 60S ribosomal protein L18               126   3e-33   
gb|EHH59750.1|  hypothetical protein EGM_09937                          125   3e-33   
gb|ABA26976.1|  TO23-2rc                                                123   3e-33   
ref|XP_004358287.1|  eukaryotic ribosomal protein L18, putative         125   4e-33   
gb|ELK25489.1|  60S ribosomal protein L18                               125   4e-33   
ref|XP_008547226.1|  PREDICTED: 60S ribosomal protein L18-like          125   5e-33   
ref|XP_009249236.1|  PREDICTED: 60S ribosomal protein L18               125   5e-33   
ref|XP_009036910.1|  hypothetical protein AURANDRAFT_37496              125   6e-33   
ref|XP_002771969.1|  60S ribosomal protein L18, putative                125   6e-33   
emb|CCD58684.1|  60S ribosomal protein L18, putative                    125   6e-33   
ref|XP_011313252.1|  PREDICTED: 60S ribosomal protein L18               125   7e-33   
ref|XP_010786834.1|  PREDICTED: 60S ribosomal protein L18               125   7e-33   
ref|XP_002595537.1|  hypothetical protein BRAFLDRAFT_275280             125   8e-33   
gb|EHH30225.1|  hypothetical protein EGK_10844                          124   9e-33   
gb|KDR14978.1|  60S ribosomal protein L18                               124   9e-33   
ref|XP_006157526.1|  PREDICTED: 60S ribosomal protein L18-like          125   1e-32   
ref|XP_010373118.1|  PREDICTED: 60S ribosomal protein L18-like          124   1e-32   
gb|EPZ37075.1|  60S ribosomal protein L18-2                             124   1e-32   
ref|XP_003393579.1|  PREDICTED: hypothetical protein LOC100643724       128   2e-32   
ref|XP_011449585.1|  PREDICTED: 60S ribosomal protein L18-like          124   2e-32   
ref|XP_003485273.1|  PREDICTED: hypothetical protein LOC100746406       128   2e-32   
emb|CAX79061.1|  ribosomal protein L18                                  124   2e-32   
gb|AAW25981.1|  SJCHGC06655 protein                                     124   2e-32   
ref|XP_004494575.1|  PREDICTED: 60S ribosomal protein L18-like          120   2e-32   
gb|EHH31865.1|  hypothetical protein EGK_13017                          124   2e-32   
ref|NP_001003432.1|  60S ribosomal protein L18                          123   2e-32   
ref|XP_003977661.1|  PREDICTED: 60S ribosomal protein L18-like          123   2e-32   
gb|AAN73381.1|  ribosomal protein L18                                   123   2e-32   
ref|XP_002161036.1|  PREDICTED: 60S ribosomal protein L18-like          123   3e-32   
ref|XP_011163555.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    125   3e-32   
dbj|BAJ93091.1|  predicted protein                                      124   3e-32   
gb|AAS49555.1|  ribosomal protein L18                                   122   5e-32   
sp|P09897.2|RL18A_XENLA  RecName: Full=60S ribosomal protein L18-...    122   5e-32   
ref|XP_005535130.1|  60S ribosomal protein L18                          122   6e-32   
gb|EFZ15690.1|  hypothetical protein SINV_04174                         122   6e-32   
ref|XP_006754858.1|  PREDICTED: 60S ribosomal protein L18-like          122   6e-32   
emb|CAJ17294.1|  ribosomal protein L18e                                 122   7e-32   
gb|ABO26684.1|  ribosomal protein l18                                   122   7e-32   
emb|CAX72134.1|  ribosomal protein L18                                  122   7e-32   
gb|EKC43150.1|  60S ribosomal protein L18                               121   1e-31   
ref|XP_004991895.1|  ribosomal protein l18                              121   2e-31   
ref|XP_008891573.1|  hypothetical protein PPTG_02269                    121   2e-31   
sp|Q4GXG7.1|RL18_TIMBA  RecName: Full=60S ribosomal protein L18         121   2e-31   
gb|KDD74971.1|  hypothetical protein H632_c955p1                        120   2e-31   
gb|KIL00482.1|  hypothetical protein PAXRUDRAFT_821678                  121   2e-31   
gb|KIK07697.1|  hypothetical protein K443DRAFT_673271                   120   3e-31   
ref|XP_008053791.1|  PREDICTED: 60S ribosomal protein L18-like          120   3e-31   
gb|ACO15258.1|  60S ribosomal protein L18                               120   3e-31   
gb|EPY79702.1|  60S ribosomal protein L18                               120   3e-31   
sp|Q56FG8.1|RL18_LYSTE  RecName: Full=60S ribosomal protein L18         120   3e-31   
gb|EHH21514.1|  hypothetical protein EGK_04601                          120   3e-31   
ref|XP_007067265.1|  PREDICTED: 60S ribosomal protein L18               121   4e-31   
gb|KIJ70376.1|  hypothetical protein HYDPIDRAFT_143674                  120   4e-31   
gb|EHH55004.1|  hypothetical protein EGM_04127                          120   4e-31   
ref|XP_001884425.1|  60S ribosomal protein L18                          120   4e-31   
ref|XP_001100251.1|  PREDICTED: 60S ribosomal protein L18-like          120   4e-31   
ref|XP_006735598.1|  PREDICTED: ribosomal protein L18-like              122   4e-31   
ref|XP_009012591.1|  hypothetical protein HELRODRAFT_156470             120   6e-31   
gb|EFX65754.1|  hypothetical protein DAPPUDRAFT_303528                  120   6e-31   
emb|CAD91422.1|  ribosomal protein L18                                  120   6e-31   
ref|XP_009519518.1|  hypothetical protein PHYSODRAFT_284882             120   6e-31   
gb|ACD65168.1|  putative 60S ribosomal protein RPL18                    119   7e-31   
gb|AEE61752.1|  unknown                                                 119   9e-31   
sp|Q0PXY6.1|RL18_DIACI  RecName: Full=60S ribosomal protein L18         119   9e-31   
ref|XP_009176548.1|  hypothetical protein T265_11593                    119   1e-30   
emb|CBY09036.1|  unnamed protein product                                119   1e-30   
ref|XP_004345091.2|  ribosomal protein L18e                             119   1e-30   
ref|XP_005573720.1|  PREDICTED: 60S ribosomal protein L18-like          120   1e-30   
ref|XP_007305598.1|  60S ribosomal protein L18-B                        119   1e-30   
ref|XP_003385450.1|  PREDICTED: 60S ribosomal protein L18-like          119   1e-30   
emb|CCQ18599.1|  60S ribosomal protein L18                              119   1e-30   
ref|XP_007833554.1|  60S ribosomal protein L18-B                        119   2e-30   
ref|XP_001640445.1|  predicted protein                                  118   2e-30   
ref|XP_008085192.1|  Ribosomal proteins L15p and L18e                   118   3e-30   
gb|KJE95959.1|  ribosomal protein L18e                                  119   3e-30   
ref|XP_006460388.1|  hypothetical protein AGABI2DRAFT_192115            118   3e-30   
gb|ADD54595.1|  putative ribosomal protein L18                          117   3e-30   
emb|CDP22224.1|  unnamed protein product                                115   3e-30   
gb|KIN06517.1|  hypothetical protein OIDMADRAFT_24819                   118   3e-30   
ref|XP_007295858.1|  eukaryotic ribosomal protein L18                   118   4e-30   
gb|ELW70865.1|  60S ribosomal protein L18                               117   4e-30   
ref|XP_002901873.1|  60S ribosomal protein L18-2                        118   4e-30   
emb|CEJ01696.1|  Putative 50S ribosomal protein L18e                    117   5e-30   
emb|CDI96431.1|  60S ribosomal protein L18                              117   5e-30   
ref|XP_005190752.1|  PREDICTED: 60S ribosomal protein L18               117   5e-30   
ref|XP_004526749.1|  PREDICTED: 60S ribosomal protein L18-like          117   5e-30   
gb|ELR09673.1|  hypothetical protein GMDG_04159                         118   5e-30   
gb|ADV03016.1|  ribosomal protein L18                                   117   5e-30   
emb|CBN08626.1|  ribosomal protein L18                                  117   6e-30   
ref|XP_004633481.1|  PREDICTED: translation initiation factor IF-...    122   7e-30   
gb|KIL67232.1|  hypothetical protein M378DRAFT_22860                    117   7e-30   
emb|CDS17705.1|  60S ribosomal protein L18                              117   8e-30   
gb|AAX48850.1|  L18                                                     117   8e-30   
gb|EHB09316.1|  60S ribosomal protein L18                               116   8e-30   
sp|Q962Y8.1|RL18_SPOFR  RecName: Full=60S ribosomal protein L18         117   8e-30   
sp|Q4PM04.1|RL18_IXOSC  RecName: Full=60S ribosomal protein L18         117   9e-30   
ref|XP_002400316.1|  ribosomal protein L18, putative                    117   9e-30   
gb|KIJ19828.1|  hypothetical protein PAXINDRAFT_166053                  117   1e-29   
sp|A3F4S0.1|RL18_TAEAS  RecName: Full=60S ribosomal protein L18         116   1e-29   
gb|KHJ35313.1|  putative 60s ribosomal protein l18                      116   1e-29   
ref|XP_001226565.1|  60S ribosomal protein L18                          116   1e-29   
ref|XP_005587036.1|  PREDICTED: 60S ribosomal protein L18-like          116   1e-29   
ref|XP_002473682.1|  60S ribosomal protein L18                          116   1e-29   
gb|KIO03112.1|  hypothetical protein M404DRAFT_15806                    116   1e-29   
emb|CEG66137.1|  Putative 60S ribosomal protein L18-A                   117   1e-29   
dbj|GAA55611.1|  large subunit ribosomal protein L18e                   117   1e-29   
emb|CCU77907.1|  putative 60S ribosomal protein L18                     116   1e-29   
emb|CEI89354.1|  Putative 60S ribosomal protein L18-A                   116   1e-29   
ref|XP_003945404.1|  PREDICTED: 60S ribosomal protein L18-like          114   1e-29   
ref|XP_001839344.1|  60S ribosomal protein L18                          116   1e-29   
ref|XP_002733428.1|  PREDICTED: 60S ribosomal protein L18-like          116   2e-29   
ref|XP_002130217.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    116   2e-29   
ref|XP_003177852.1|  60S ribosomal protein L18                          116   2e-29   
gb|ELW48392.1|  60S ribosomal protein L18                               117   2e-29   
gb|KDQ28891.1|  hypothetical protein PLEOSDRAFT_1063630                 116   2e-29   
gb|KII96054.1|  hypothetical protein PLICRDRAFT_48977                   116   2e-29   
ref|XP_007381758.1|  60S ribosomal protein L18                          116   2e-29   
ref|XP_002470390.1|  60S ribosomal protein L18                          116   2e-29   
ref|XP_002371723.1|  60S ribosomal protein L18, putative                116   2e-29   
gb|EMD40971.1|  hypothetical protein CERSUDRAFT_80614                   116   2e-29   
gb|KFG34549.1|  ribosomal protein RPL18                                 116   2e-29   
gb|KIK20716.1|  hypothetical protein PISMIDRAFT_576002                  116   2e-29   
gb|EPT03125.1|  hypothetical protein FOMPIDRAFT_1022488                 115   2e-29   
emb|CEP17694.1|  hypothetical protein                                   115   2e-29   
ref|XP_008035100.1|  60S ribosomal protein L18                          116   2e-29   
emb|CDO74156.1|  hypothetical protein BN946_scf185043.g207              115   3e-29   
ref|XP_007862613.1|  60S ribosomal protein L18                          115   3e-29   
ref|XP_008888411.1|  ribosomal protein RPL18                            115   3e-29   
ref|XP_007315262.1|  hypothetical protein SERLADRAFT_381487             115   3e-29   
ref|XP_007847122.1|  60s ribosomal protein l18                          115   3e-29   
ref|XP_001550924.1|  60S ribosomal protein L18                          115   3e-29   
emb|CCI45423.1|  unnamed protein product                                115   4e-29   
emb|CDJ05472.1|  60S ribosomal protein L18                              115   4e-29   
gb|KDR74387.1|  hypothetical protein GALMADRAFT_250303                  115   4e-29   
emb|CEP19927.1|  hypothetical protein                                   115   4e-29   
ref|NP_648091.1|  ribosomal protein L18, isoform A                      115   5e-29   
gb|ABD77169.1|  ribosomal protein L18                                   114   5e-29   
ref|XP_007453395.1|  PREDICTED: 60S ribosomal protein L18-like          115   5e-29   
gb|ABD77165.1|  ribosomal protein L18                                   114   6e-29   
gb|KIP09821.1|  hypothetical protein PHLGIDRAFT_18483                   114   6e-29   
ref|XP_007779084.1|  60S ribosomal protein L18-B                        115   6e-29   
gb|ABD77159.1|  ribosomal protein L18                                   114   6e-29   
gb|ABD77157.1|  ribosomal protein L18                                   114   7e-29   
ref|XP_007364417.1|  60S ribosomal protein L18                          114   7e-29   
emb|CCA16204.1|  60S ribosomal protein L182 putative                    114   8e-29   
gb|ADO33048.1|  ribosomal protein L18                                   114   8e-29   
ref|XP_001588139.1|  60S ribosomal protein L18                          114   8e-29   
dbj|GAN04379.1|  60S ribosomal protein L18                              114   9e-29   
ref|XP_002035667.1|  GM13785                                            114   1e-28   
ref|XP_009497917.1|  50S ribosomal protein L18e                         114   1e-28   
ref|XP_009543935.1|  hypothetical protein HETIRDRAFT_472767             114   1e-28   
gb|KIM67674.1|  hypothetical protein SCLCIDRAFT_13851                   114   1e-28   
gb|KIM83961.1|  hypothetical protein PILCRDRAFT_420376                  114   1e-28   
ref|XP_009244729.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    114   1e-28   
gb|ABD77175.1|  ribosomal protein L18                                   113   1e-28   
ref|XP_308294.3|  AGAP007580-PB                                         114   1e-28   
ref|XP_002047296.1|  GJ13360                                            114   1e-28   
gb|ABD77172.1|  ribosomal protein L18                                   113   2e-28   
dbj|GAD98621.1|  60S ribosomal protein L18                              113   2e-28   
ref|XP_003081305.1|  ribosomal protein L18 (ISS)                        113   2e-28   
gb|KIK65689.1|  hypothetical protein GYMLUDRAFT_70778                   113   2e-28   
ref|XP_007797810.1|  putative 60s ribosomal protein l18 protein         113   2e-28   
gb|EGU80235.1|  hypothetical protein FOXB_09162                         113   2e-28   
ref|XP_003022831.1|  hypothetical protein TRV_03055                     113   2e-28   
ref|XP_001101359.1|  PREDICTED: 60S ribosomal protein L18-like          113   2e-28   
gb|EGD98734.1|  60S ribosomal protein L18                               113   2e-28   
gb|EHH29238.1|  hypothetical protein EGK_09604                          113   2e-28   
gb|AAN73352.1|  ribosomal protein L18                                   112   2e-28   
gb|KEF62683.1|  large subunit ribosomal protein L18e                    113   2e-28   
ref|XP_003011118.1|  hypothetical protein ARB_02640                     113   2e-28   
ref|XP_007423078.1|  PREDICTED: 60S ribosomal protein L18               113   2e-28   
gb|EWG39972.1|  50S ribosomal protein L18e                              113   2e-28   
gb|ETE73081.1|  60S ribosomal protein L18                               113   2e-28   
ref|XP_003886070.1|  Ribosomal protein L18, related                     113   3e-28   



>ref|XP_009625475.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   189 bits (481),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLIS+  GKEDKIAV+VGTITDDVRAY+VP LKVCA
Sbjct  61   PLSLSRLISYAKGKEDKIAVIVGTITDDVRAYDVPTLKVCA  101



>ref|XP_009629074.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
 ref|XP_009788537.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=187

 Score =   188 bits (478),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLIS+  GKEDK+ V+VGTITDDVRAYEVPALKVCA
Sbjct  61   PLSLSRLISYAKGKEDKVVVIVGTITDDVRAYEVPALKVCA  101



>ref|XP_009783807.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   188 bits (477),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGK+K+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLIS+T GKEDKIAV+VG++TDDVRAYEVP L VCA
Sbjct  61   PLSLSRLISYTKGKEDKIAVIVGSVTDDVRAYEVPTLMVCA  101



>gb|KDP28183.1| hypothetical protein JCGZ_13954 [Jatropha curcas]
Length=187

 Score =   186 bits (473),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLISFT GKEDKIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLISFTKGKEDKIAVVVGTVTDDIRVYEVPALKVTA  101



>ref|XP_009630920.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   186 bits (472),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGK+K+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFN VILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNTVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLIS+T GKEDKIAV+VG++TDDVRAYEVP L VCA
Sbjct  61   PLSLSRLISYTKGKEDKIAVIVGSVTDDVRAYEVPTLMVCA  101



>ref|XP_009772706.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
 ref|XP_009772708.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTG KFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGCKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLIS+  GKE KIAV+VGTITDDVRAY+VP LKVCA
Sbjct  61   PLSLSRLISYAKGKEGKIAVIVGTITDDVRAYDVPTLKVCA  101



>ref|XP_002301485.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE80758.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   184 bits (467),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI+F  GKEDKIAV+VGTITDD+R YEVPALKV A
Sbjct  61   PLSLSRLITFMKGKEDKIAVVVGTITDDIRVYEVPALKVTA  101



>ref|XP_010025256.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW61872.1| hypothetical protein EUGRSUZ_H04551 [Eucalyptus grandis]
Length=187

 Score =   182 bits (463),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAV+LKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVVLKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKEDKIAV+VGTITDD+R +EVPALKV A
Sbjct  61   PLSLSRLIRYTQGKEDKIAVVVGTITDDIRVHEVPALKVTA  101



>gb|KJB41868.1| hypothetical protein B456_007G127300 [Gossypium raimondii]
Length=178

 Score =   181 bits (460),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKEDKIAV+VG +TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIQFMKGKEDKIAVVVGAVTDDIRVYEVPALKVTA  101



>ref|XP_010313195.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum lycopersicum]
Length=187

 Score =   181 bits (460),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLIS+  GK DK  VLVGT+TDDVRAYEVP LKVCA
Sbjct  61   PLSLSRLISYAEGKGDKTVVLVGTVTDDVRAYEVPKLKVCA  101



>ref|XP_011042004.1| PREDICTED: 60S ribosomal protein L18-2-like [Populus euphratica]
Length=187

 Score =   181 bits (459),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI++  GKE KIAV+VGTITDD+R YEVPA+KV A
Sbjct  61   PLSLSRLITYMKGKEGKIAVVVGTITDDIRVYEVPAIKVTA  101



>ref|XP_006344694.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score =   181 bits (459),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLIS+  GK DK  VLVGT+TDDVRAYEVP LKVCA
Sbjct  61   PLSLSRLISYAEGKGDKTVVLVGTVTDDVRAYEVPKLKVCA  101



>ref|NP_001237789.1| uncharacterized protein LOC100500164 [Glycine max]
 gb|ACU15099.1| unknown [Glycine max]
 gb|KHN16096.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   181 bits (459),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKEDKIAV+VG ITDD+R YEVPALKV A
Sbjct  61   PLSLSRLIKYTKGKEDKIAVVVGNITDDIRVYEVPALKVTA  101



>gb|KJB45331.1| hypothetical protein B456_007G301700 [Gossypium raimondii]
Length=195

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTA  101



>ref|XP_002320999.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93820.1| unknown [Populus trichocarpa]
 gb|EEE99314.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   181 bits (459),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PL+LSRLI++  GKE KIAV+VGTITDD+R YEVPALKV A
Sbjct  61   PLALSRLITYMKGKEGKIAVVVGTITDDIRVYEVPALKVTA  101



>gb|KJB23304.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=159

 Score =   180 bits (456),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTA  101



>gb|KJB41867.1| hypothetical protein B456_007G127300 [Gossypium raimondii]
Length=187

 Score =   181 bits (458),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKEDKIAV+VG +TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIQFMKGKEDKIAVVVGAVTDDIRVYEVPALKVTA  101



>ref|XP_009796134.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   181 bits (458),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKL+VKLYRFLV+RTGSKFN VILK LFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLIVKLYRFLVQRTGSKFNTVILKWLFMSKTNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLIS+  GKEDKI V+VGTITDDVRAY+VP LKVCA
Sbjct  61   PLSLSRLISYAKGKEDKIVVIVGTITDDVRAYDVPTLKVCA  101



>gb|KJB45330.1| hypothetical protein B456_007G301700 [Gossypium raimondii]
Length=187

 Score =   180 bits (457),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTA  101



>gb|KJB82632.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=187

 Score =   179 bits (455),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVK+YRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKIYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTA  101



>gb|KJB23303.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=187

 Score =   179 bits (455),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTA  101



>gb|KHN43503.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   179 bits (455),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKEDKIAV+VG +TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEVPALKVTA  101



>ref|NP_001236701.1| uncharacterized protein LOC100306301 [Glycine max]
 gb|ACU14418.1| unknown [Glycine max]
Length=187

 Score =   179 bits (455),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKEDKIAV+VG +TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEVPALKVTA  101



>gb|KHN03962.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   179 bits (454),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRLI +T GKEDKIAV+VGT+TDD+R YEVPALK+ A
Sbjct  61   PISLSRLIKYTKGKEDKIAVIVGTVTDDIRVYEVPALKITA  101



>ref|XP_007031040.1| Ribosomal protein L18 [Theobroma cacao]
 gb|EOY11542.1| Ribosomal protein L18 [Theobroma cacao]
Length=187

 Score =   179 bits (454),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTA  101



>ref|XP_009630742.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   179 bits (454),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+DLK GGKSK+TKRT PKSDDVYLKLLVKLYRF VRRT SKFNAVILKRLFMSKTNKP
Sbjct  1    MGVDLKVGGKSKKTKRTTPKSDDVYLKLLVKLYRFFVRRTESKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLIS+  GKE+KIAV+VGTITDDVRAY+VP LKVCA
Sbjct  61   PLSLSRLISYVKGKENKIAVIVGTITDDVRAYDVPTLKVCA  101



>gb|KHF98574.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
 gb|KJB22518.1| hypothetical protein B456_004G052100 [Gossypium raimondii]
Length=187

 Score =   179 bits (454),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +  GKEDKIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIQYMKGKEDKIAVVVGTVTDDIRVYEVPALKVTA  101



>ref|XP_007163123.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
 gb|ESW35117.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
Length=187

 Score =   179 bits (453),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKE+KIAV+VG +TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIRYTKGKENKIAVVVGAVTDDIRVYEVPALKVTA  101



>ref|XP_007147006.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
 gb|ESW19000.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
Length=187

 Score =   179 bits (453),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKEDKIAV+VGTITDD+R YEVP LK+ A
Sbjct  61   PLSLSRLIRYTKGKEDKIAVVVGTITDDIRVYEVPQLKITA  101



>ref|XP_002523106.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF39291.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=187

 Score =   179 bits (453),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI+F  GKE+KIAV+VGT+TDDVR YEVPALKV A
Sbjct  61   PLSLSRLITFMKGKENKIAVIVGTVTDDVRVYEVPALKVTA  101



>ref|XP_010544997.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   179 bits (453),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +  GKED+I V+VGT+TDD R YEVPALK+ A
Sbjct  61   PLSLSRLIRYMQGKEDQIGVIVGTVTDDARVYEVPALKITA  101



>ref|XP_010559184.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=145

 Score =   177 bits (449),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +  GK+DKI V+VGT+TDD R YEVPALK+ A
Sbjct  61   PLSLSRLIRYMQGKKDKIGVIVGTVTDDARVYEVPALKITA  101



>ref|XP_011036896.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score =   178 bits (451),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLK GGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLKRGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI+F  GKEDKIAVLVGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLITFMKGKEDKIAVLVGTVTDDIRVYEVPALKVTA  101



>ref|XP_006382454.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93398.1| unknown [Populus trichocarpa]
 gb|ABK93783.1| unknown [Populus trichocarpa]
 gb|ERP60251.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLK GGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLKRGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI+F  GKEDKIAVLVGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLITFMKGKEDKIAVLVGTVTDDIRVYEVPALKVTA  101



>ref|XP_010523956.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +  GKED I V+VGT+TDD R YEVPALK+ A
Sbjct  61   PLSLSRLIRYMEGKEDNIGVIVGTVTDDARVYEVPALKITA  101



>ref|XP_003556523.1| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
Length=187

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKEDKIAV+VG+ITDD+R YEVP LKV A
Sbjct  61   PLSLSRLIKYTKGKEDKIAVVVGSITDDIRVYEVPPLKVTA  101



>gb|KHN20393.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=274

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  88   MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  147

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKEDKIAV+VG +TDD+R YEVPALKV A
Sbjct  148  PLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEVPALKVTA  188



>ref|XP_010559185.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +  GK+DKI V+VGT+TDD R YEVPALK+ A
Sbjct  61   PLSLSRLIRYMQGKKDKIGVIVGTVTDDARVYEVPALKITA  101



>ref|XP_007144959.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
 gb|ESW16953.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
Length=187

 Score =   177 bits (449),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKE KIAV+VGTITDD+R YEVP+LKV A
Sbjct  61   PLSLSRLIKYTKGKEGKIAVVVGTITDDIRVYEVPSLKVTA  101



>gb|KJB41866.1| hypothetical protein B456_007G127300, partial [Gossypium raimondii]
Length=227

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
             GIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  41   QGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  100

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKEDKIAV+VG +TDD+R YEVPALKV A
Sbjct  101  PLSLSRLIQFMKGKEDKIAVVVGAVTDDIRVYEVPALKVTA  141



>ref|XP_002270635.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score =   177 bits (448),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRLI +  GKEDKIAVLVGT+TDD+R YEVP LKV A
Sbjct  61   PMSLSRLIRYMQGKEDKIAVLVGTVTDDLRVYEVPTLKVTA  101



>ref|NP_001236071.1| uncharacterized protein LOC100499789 [Glycine max]
 gb|ACU13660.1| unknown [Glycine max]
Length=187

 Score =   177 bits (448),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +  GKEDKIAV+VG +TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIRYAKGKEDKIAVVVGAVTDDIRVYEVPALKVTA  101



>gb|KHG07157.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
Length=207

 Score =   177 bits (450),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFM K NKP
Sbjct  21   MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMCKVNKP  80

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV A
Sbjct  81   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRIYEVPALKVTA  121



>gb|KDP23459.1| hypothetical protein JCGZ_23292 [Jatropha curcas]
Length=187

 Score =   176 bits (447),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKT  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKE KIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIRFMKGKESKIAVVVGTVTDDIRVYEVPALKVTA  101



>ref|NP_001235897.1| uncharacterized protein LOC100527681 [Glycine max]
 gb|ACU16823.1| unknown [Glycine max]
Length=187

 Score =   176 bits (446),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYR LVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRSLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRLI +T GKEDKIAV+VGT+TDD+R YEVPALK+ A
Sbjct  61   PISLSRLIKYTKGKEDKIAVIVGTVTDDIRVYEVPALKITA  101



>ref|XP_007050975.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
 gb|EOX95132.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
Length=180

 Score =   176 bits (446),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F   KEDKIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEVPALKVTA  101



>gb|KGN66048.1| hypothetical protein Csa_1G569250 [Cucumis sativus]
Length=244

 Score =   178 bits (451),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  58   MGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  117

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI FT GKE KIAV+VGTITDD+R YEVPALKV A
Sbjct  118  PLSLSRLIQFTKGKESKIAVVVGTITDDIRVYEVPALKVAA  158



>ref|XP_010659657.1| PREDICTED: 60S ribosomal protein L18-2-like [Vitis vinifera]
 emb|CAN65685.1| hypothetical protein VITISV_022459 [Vitis vinifera]
Length=187

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ +  GKE KIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLVRYMGGKEGKIAVVVGTVTDDIRVYEVPALKVTA  101



>ref|XP_010043043.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW85064.1| hypothetical protein EUGRSUZ_B01908 [Eucalyptus grandis]
Length=187

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKEDKIAV+VGT+TDD+R Y+VPALKV A
Sbjct  61   PLSLSRLIRYTQGKEDKIAVVVGTVTDDIRVYDVPALKVTA  101



>emb|CDP17112.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   177 bits (449),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFN VILKRLFMSK NKP
Sbjct  48   MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNVVILKRLFMSKINKP  107

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
             LSLSRLI++T GKEDKIAV+VGT+TDD R YEVP+LKV A
Sbjct  108  ALSLSRLITYTKGKEDKIAVVVGTVTDDTRVYEVPSLKVTA  148



>emb|CBI39539.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            TMGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK
Sbjct  62   TMGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNK  121

Query  267  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PPLSLSRL+ +  GKE KIAV+VGT+TDD+R YEVPALKV A
Sbjct  122  PPLSLSRLVRYMGGKEGKIAVVVGTVTDDIRVYEVPALKVTA  163



>ref|XP_008450608.1| PREDICTED: 60S ribosomal protein L18-2 [Cucumis melo]
Length=187

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKE KIAV+VGTITDD+R YEVPALKV A
Sbjct  61   PLSLSRLIQFMKGKESKIAVVVGTITDDIRVYEVPALKVAA  101



>gb|KHN20252.1| 60S ribosomal protein L18-3, partial [Glycine soja]
Length=187

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
             GIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    QGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKEDKIAV+VG+ITDD+R YEVP LKV A
Sbjct  61   PLSLSRLIKYTKGKEDKIAVVVGSITDDIRVYEVPPLKVTA  101



>ref|XP_006433452.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 gb|ESR46692.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 gb|KDO39193.1| hypothetical protein CISIN_1g030771mg [Citrus sinensis]
Length=171

 Score =   175 bits (443),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTDSNFNKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI+F  GKEDKIAV+VGT+TDD+RAYEVPALKV A
Sbjct  61   PLSLSRLINFMKGKEDKIAVVVGTVTDDIRAYEVPALKVTA  101



>ref|XP_007050974.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
 gb|EOX95131.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
Length=187

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F   KEDKIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEVPALKVTA  101



>emb|CDO98841.1| unnamed protein product [Coffea canephora]
Length=243

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGK K+TKRTAPKS D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMSKTNKP
Sbjct  57   MGIDLKAGGKVKKTKRTAPKSHDIYLKLLVKLYRFLVRRTGSRFNAVLLKRLFMSKTNKP  116

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F  GKEDKIAVLVGT+TDD R YEVP LKV A
Sbjct  117  PLSLSRLVKFMEGKEDKIAVLVGTVTDDTRVYEVPTLKVAA  157



>ref|XP_011023716.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score =   175 bits (444),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI++T GKE KIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEVPALKVTA  101



>ref|XP_003554636.2| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
 gb|KHN43312.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=214

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK NKP
Sbjct  28   MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNKP  87

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRLI +T GKEDKIAV+VGT+TDD+R YEVPALK+ A
Sbjct  88   PISLSRLIKYTKGKEDKIAVVVGTVTDDIRVYEVPALKITA  128



>ref|XP_006433453.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 ref|XP_006472133.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR46693.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
Length=187

 Score =   174 bits (442),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTDSNFNKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI+F  GKEDKIAV+VGT+TDD+RAYEVPALKV A
Sbjct  61   PLSLSRLINFMKGKEDKIAVVVGTVTDDIRAYEVPALKVTA  101



>ref|XP_010938374.1| PREDICTED: 60S ribosomal protein L18-2-like [Elaeis guineensis]
Length=187

 Score =   174 bits (441),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVIL+RLFMSK NKP
Sbjct  1    MGIDLKAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSRFNAVILRRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSL RL++F  GKEDKIAV+VGT+TDD R YEVPA+KV A
Sbjct  61   PLSLKRLVTFMQGKEDKIAVIVGTVTDDKRVYEVPAMKVTA  101



>ref|XP_010684349.1| PREDICTED: 60S ribosomal protein L18-2-like [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   174 bits (441),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+DVYLKLLVKLYRFLVRRTGSKFNAV+LKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDVYLKLLVKLYRFLVRRTGSKFNAVVLKRLFMSKINKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ +  GK+ +IAVLVGTITDD+R YEVP +KVCA
Sbjct  61   PLSLSRLVKYMEGKDGRIAVLVGTITDDIRVYEVPTMKVCA  101



>ref|XP_011079632.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
 ref|XP_011084062.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
Length=187

 Score =   174 bits (441),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMS+ N+P
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSRFNAVVLKRLFMSRVNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLIS  +GKEDKIAVLVG++TDD+R +EVPALKV A
Sbjct  61   PLSLSRLISLMNGKEDKIAVLVGSVTDDIRVHEVPALKVTA  101



>ref|XP_010273829.1| PREDICTED: 60S ribosomal protein L18-2-like [Nelumbo nucifera]
Length=187

 Score =   174 bits (441),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMS+ NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSRVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRLI F  GKEDKIAV+VG +TDD R YE+PALKV A
Sbjct  61   PISLSRLIKFMKGKEDKIAVVVGAVTDDTRVYELPALKVTA  101



>ref|XP_004144773.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 ref|XP_004158733.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 gb|KGN60965.1| hypothetical protein Csa_2G032220 [Cucumis sativus]
Length=187

 Score =   174 bits (440),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRLI + +GKE +IAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PISLSRLIKYMNGKEGRIAVIVGTVTDDIRVYEVPALKVTA  101



>ref|XP_010546736.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score =   174 bits (440),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F  GKED+I V+VGT+TDDVR YEVPALKV A
Sbjct  61   PLSLSRLVRFMQGKEDQIGVIVGTVTDDVRVYEVPALKVTA  101



>gb|AFK49563.1| unknown [Lotus japonicus]
Length=187

 Score =   174 bits (440),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKR APKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRIAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRLI +  GKEDK+ V+VGT+TDD+R YEVPALKV A
Sbjct  61   PISLSRLIKYAKGKEDKVVVIVGTVTDDIRVYEVPALKVTA  101



>ref|XP_011079633.1| PREDICTED: 60S ribosomal protein L18-2-like [Sesamum indicum]
Length=187

 Score =   173 bits (439),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMS+ N+P
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSRFNAVVLKRLFMSRVNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLIS  +GKEDKIAVLVG++TDD+R +EVPALKV A
Sbjct  61   PLSLSRLISLMNGKEDKIAVLVGSVTDDMRVHEVPALKVTA  101



>ref|XP_008454015.1| PREDICTED: 60S ribosomal protein L18-3 [Cucumis melo]
Length=187

 Score =   173 bits (439),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRLI +  GKE KIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PISLSRLIKYMKGKEAKIAVVVGTVTDDIRVYEVPALKVTA  101



>ref|XP_002319502.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE95425.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   173 bits (439),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI++T GKE KIAV+VGT+TDD+R YEVP LKV A
Sbjct  61   PLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEVPTLKVTA  101



>gb|ABK92688.1| unknown [Populus trichocarpa]
Length=187

 Score =   173 bits (439),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI++T GKE KIAV+VGT+TDD+R YEVP LKV A
Sbjct  61   PLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEVPTLKVTA  101



>ref|XP_010259492.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score =   173 bits (439),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMS+ NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSRVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRLISF  GKEDKIAV+VGT+TDD R YEVPALKV A
Sbjct  61   PMSLSRLISFMKGKEDKIAVIVGTVTDDTRVYEVPALKVTA  101



>ref|XP_003591163.1| Ribosomal protein L18 [Medicago truncatula]
 gb|AES61414.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=187

 Score =   173 bits (438),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGK+K+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T+GKE KIAV+VG ITDDVR  EVPA+KV A
Sbjct  61   PLSLSRLIKYTNGKEGKIAVVVGAITDDVRVNEVPAIKVTA  101



>ref|XP_010088293.1| 60S ribosomal protein L18-3 [Morus notabilis]
 gb|EXB33518.1| 60S ribosomal protein L18-3 [Morus notabilis]
Length=197

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK NKPP
Sbjct  12   GIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSKVNKPP  71

Query  273  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            LSLSRLI F  GKEDK+AV+VGT+TDD+R YEVPALKV A
Sbjct  72   LSLSRLIRFMKGKEDKVAVVVGTVTDDIRVYEVPALKVTA  111



>ref|XP_002271179.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score =   172 bits (437),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKRTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ +  GKE KIAV+VGT+TDD+R YEVP LKV A
Sbjct  61   PLSLSRLVRYMDGKEGKIAVVVGTVTDDLRVYEVPCLKVTA  101



>ref|XP_004135776.1| PREDICTED: uncharacterized protein LOC101207642 [Cucumis sativus]
 ref|XP_004169487.1| PREDICTED: uncharacterized protein LOC101228164 [Cucumis sativus]
Length=389

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  203  MGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  262

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI FT GKE KIAV+VGTITDD+R YEVPALKV A
Sbjct  263  PLSLSRLIQFTKGKESKIAVVVGTITDDIRVYEVPALKVAA  303



>ref|XP_010674074.1| PREDICTED: 60S ribosomal protein L18-2 [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   172 bits (436),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+DVYLKLLVKLYRFLVRRTGS FN V+LKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDVYLKLLVKLYRFLVRRTGSSFNGVVLKRLFMSKINKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI++  GKEDKIAV+VG +TDD+R YEVPALKV A
Sbjct  61   PLSLSRLITYMKGKEDKIAVIVGAVTDDIRVYEVPALKVTA  101



>ref|XP_006386732.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
 gb|ERP64529.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
Length=184

 Score =   172 bits (436),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 93/101 (92%), Gaps = 3/101 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI+F  G   KIAV+VGTITDD+R YEVPALKV A
Sbjct  61   PLSLSRLITFMKG---KIAVVVGTITDDIRVYEVPALKVTA  98



>emb|CDY40718.1| BnaC03g34340D [Brassica napus]
Length=227

 Score =   173 bits (439),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            TMGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK
Sbjct  40   TMGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNK  99

Query  267  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
             PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV A
Sbjct  100  APLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTA  141



>gb|AFK45456.1| unknown [Lotus japonicus]
Length=187

 Score =   172 bits (435),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FN+VILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNSVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPALKVAA  101



>ref|XP_008386678.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score =   171 bits (434),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI + +GKE KIAV+VGT+TDD+R YEVP LKV A
Sbjct  61   PLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYEVPCLKVTA  101



>emb|CDX74138.1| BnaA03g29090D [Brassica napus]
Length=213

 Score =   172 bits (436),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            TMGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK
Sbjct  26   TMGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNK  85

Query  267  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
             PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV A
Sbjct  86   APLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTA  127



>ref|XP_002874343.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50602.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
Length=187

 Score =   171 bits (434),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV A
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTA  101



>ref|XP_006298640.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
 gb|EOA31538.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
Length=187

 Score =   171 bits (434),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F  GKEDKIAVLVGT+TDDVR +E+PA+KV A
Sbjct  61   PLSLSRLVEFMEGKEDKIAVLVGTVTDDVRVHEIPAMKVTA  101



>gb|EMS45435.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=187

 Score =   171 bits (433),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRTAPKSDDVYLKLLVKLYRFLVRRTKSQFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLS+ RL+ F  GKEDKIAV+VGTITDD R YE+PA+KV A
Sbjct  61   PLSMRRLVRFMEGKEDKIAVIVGTITDDQRVYEIPAMKVAA  101



>ref|XP_010094463.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB56096.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=198

 Score =   171 bits (434),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
             GID+ AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  12   QGIDIVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  71

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKE KIAV+VGT+TDD+R Y+VPALKV A
Sbjct  72   PLSLSRLIRFMQGKESKIAVVVGTVTDDIRVYDVPALKVTA  112



>ref|XP_010931680.1| PREDICTED: 60S ribosomal protein L18-2 [Elaeis guineensis]
Length=187

 Score =   171 bits (433),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SL RLI F  GKEDKIAV+VGT+TDD R YEVPA+KV A
Sbjct  61   PISLKRLIRFMEGKEDKIAVIVGTVTDDKRVYEVPAMKVTA  101



>ref|XP_010528904.1| PREDICTED: 60S ribosomal protein L18-2 [Tarenaya hassleriana]
Length=187

 Score =   171 bits (433),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRVAPKSDDVYLKLLVKLYRFLVRRTGSSFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRL+ F  GKEDK+AV+VGT+TDD+R YEVPALKV A
Sbjct  61   PISLSRLVRFMQGKEDKVAVIVGTVTDDLRVYEVPALKVTA  101



>ref|XP_006359857.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score =   171 bits (433),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRIAPKSDDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+++ +GKED IAV+VGT+TDDVRAYEVP +KV A
Sbjct  61   PLSLSRLVTYMTGKEDNIAVIVGTVTDDVRAYEVPKIKVTA  101



>ref|XP_004494383.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   171 bits (433),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESSFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKE KIAV+VG +TDD+R YEVPA+KV A
Sbjct  61   PLSLSRLIRFMKGKEGKIAVVVGAVTDDIRVYEVPAIKVTA  101



>gb|AAO46881.1| 60S ribosomal protein [Medicago sativa]
Length=164

 Score =   170 bits (430),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPA+KV A
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPAIKVTA  101



>ref|XP_009134833.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV A
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTA  101



>emb|CBI36879.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  111  MGIDLVAGGKSKRTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  170

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ +  GKE KIAV+VGT+TDD+R YEVP LKV A
Sbjct  171  PLSLSRLVRYMDGKEGKIAVVVGTVTDDLRVYEVPCLKVTA  211



>ref|XP_009124870.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV A
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTA  101



>ref|XP_010104147.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB98712.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=209

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
             GID+ AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  23   QGIDIVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  82

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GKE KIAV+VGT+TDD+R Y+VPALKV A
Sbjct  83   PLSLSRLIRFMQGKESKIAVVVGTVTDDIRVYDVPALKVTA  123



>ref|XP_007205962.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
 ref|XP_008245548.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ07161.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
Length=187

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +  GK++KIAV+VGT+TDD+R YEVP LKV A
Sbjct  61   PLSLSRLIRYMQGKDNKIAVVVGTVTDDIRVYEVPQLKVTA  101



>ref|XP_010486014.1| PREDICTED: 60S ribosomal protein L18-3 [Camelina sativa]
Length=187

 Score =   170 bits (431),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFLVRRTESKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F SGKEDKIAVLVGT+TDD+R +E+PA+KV A
Sbjct  61   PLSLSRLVEFMSGKEDKIAVLVGTVTDDLRVHEIPAMKVTA  101



>ref|XP_002512455.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF49907.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=403

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            +MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK
Sbjct  216  SMGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINK  275

Query  267  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
             PLSLSRLI+F  GKE K AV+VGT+TDD+R YEVPALKV A
Sbjct  276  APLSLSRLITFMKGKESKTAVVVGTVTDDIRVYEVPALKVTA  317



>gb|AFK34017.1| unknown [Medicago truncatula]
Length=188

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPA+KV A
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPAIKVTA  101



>ref|XP_010429374.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRL+ F SGKEDKIAVLVGTITDD+R +E+PA+KV A
Sbjct  61   PISLSRLVEFMSGKEDKIAVLVGTITDDLRVHEIPAMKVTA  101



>ref|XP_006394935.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
 gb|ESQ32221.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
Length=230

 Score =   171 bits (434),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+GSKFNAVILKRLFMSK NK 
Sbjct  44   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSGSKFNAVILKRLFMSKVNKA  103

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL++F  GKE KIAVLVGTITDD+R +E+PA+KV A
Sbjct  104  PLSLSRLVTFMKGKEGKIAVLVGTITDDLRIHEIPAMKVTA  144



>ref|XP_006855263.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
 gb|ERN16730.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
Length=187

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+ AGGKSK+T RTAPKS DVYLK+LVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDIVAGGKSKKTHRTAPKSGDVYLKILVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F +GKEDK+AV+VGT+TDD R YEVPALKV A
Sbjct  61   PLSLSRLIKFMAGKEDKVAVIVGTVTDDTRVYEVPALKVTA  101



>gb|KEH24393.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=188

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPA+KV A
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPAIKVTA  101



>gb|ACJ85943.1| unknown [Medicago truncatula]
 gb|AFK48653.1| unknown [Medicago truncatula]
Length=174

 Score =   170 bits (430),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPA+KV A
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPAIKVTA  101



>ref|XP_009338229.1| PREDICTED: 60S ribosomal protein L18-2-like [Pyrus x bretschneideri]
Length=187

 Score =   170 bits (430),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +  GK++KIAV+VGT+TDD+R YEVP +KV A
Sbjct  61   PLSLSRLIKYMQGKDNKIAVVVGTVTDDIRVYEVPQMKVTA  101



>ref|XP_002882427.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58686.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score =   170 bits (430),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F +GKEDKIAVLVGT+TDD+R +E+PA+KV A
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTVTDDLRVHEIPAMKVTA  101



>emb|CBI22977.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +3

Query  96   IDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPL  275
            IDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPP+
Sbjct  70   IDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKPPM  129

Query  276  SLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            SLSRLI +  GKEDKIAVLVGT+TDD+R YEVP LKV A
Sbjct  130  SLSRLIRYMQGKEDKIAVLVGTVTDDLRVYEVPTLKVTA  168



>ref|XP_008775991.1| PREDICTED: 60S ribosomal protein L18-2 [Phoenix dactylifera]
Length=187

 Score =   170 bits (430),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ KRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKAKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SL +LI+F  GKEDKIAVLVGT+TDD R YEVPA+ V A
Sbjct  61   PISLKKLITFMEGKEDKIAVLVGTVTDDKRVYEVPAMTVTA  101



>ref|NP_187210.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
 sp|P42791.2|RL182_ARATH RecName: Full=60S ribosomal protein L18-2 [Arabidopsis thaliana]
 gb|AAF26138.1|AC011620_14 putative 60S ribosomal protein L18 [Arabidopsis thaliana]
 gb|AAK59824.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AAL31164.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AEE74263.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
Length=187

 Score =   170 bits (430),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFN VILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV A
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAMKVTA  101



>ref|XP_010464086.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score =   170 bits (430),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFLVRRTESKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F SGKEDKIAVLVGT+TDD+R +E+PA+K+ A
Sbjct  61   PLSLSRLVEFMSGKEDKIAVLVGTVTDDLRVHEIPAMKITA  101



>ref|XP_008388515.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score =   170 bits (430),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +  GK+ KIAV+VGT+TDD+R YEVP LKV A
Sbjct  61   PLSLSRLIKYMQGKDSKIAVVVGTVTDDIRVYEVPQLKVTA  101



>ref|XP_009335702.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
 ref|XP_009335725.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
Length=187

 Score =   169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI + +GKE KIAV+VGT+TDD+R Y+VP LKV A
Sbjct  61   PLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYDVPCLKVTA  101



>gb|KFK26512.1| hypothetical protein AALP_AA8G258600 [Arabis alpina]
Length=187

 Score =   169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSDSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL  F  GKEDKIAVLVGTITDD+R +E+PALKV A
Sbjct  61   PLSLSRLAEFLKGKEDKIAVLVGTITDDLRVHEIPALKVTA  101



>ref|XP_008784768.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score =   169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLIAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SL RL++F  GK+DKIAV+VGT+TDD R YEVPA+KV A
Sbjct  61   PISLKRLVTFMQGKDDKIAVIVGTVTDDKRVYEVPAMKVTA  101



>ref|XP_008810211.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score =   169 bits (428),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SL RLI F  GKEDKI V+VGT+TDD R YEVPA+KV A
Sbjct  61   PISLKRLIRFMEGKEDKIVVIVGTVTDDKRVYEVPAMKVTA  101



>emb|CDY18813.1| BnaAnng02780D [Brassica napus]
Length=249

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  63   MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  122

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV A
Sbjct  123  PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTA  163



>ref|XP_007201344.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
 ref|XP_008235116.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ02543.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
Length=187

 Score =   169 bits (428),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFSAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI + +GK+ KIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIRYMNGKDGKIAVVVGTVTDDIRVYEVPALKVTA  101



>ref|XP_008369026.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008345218.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008355492.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score =   169 bits (428),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTSSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI + +GKE KIAV+VGT+TDD+R YEVP LKV A
Sbjct  61   PLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYEVPCLKVTA  101



>gb|AAA69928.1| cytoplasmic ribosomal protein L18 [Arabidopsis thaliana]
Length=187

 Score =   169 bits (428),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFN VILKRLFMSK N+ 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNRA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV A
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAMKVTA  101



>ref|XP_002465302.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
 gb|EER92300.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
Length=187

 Score =   169 bits (427),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSL RL++F  GKE++IAV+VGT+TDD R YEVPA+KV A
Sbjct  61   PLSLRRLVNFMEGKENQIAVIVGTVTDDKRVYEVPAMKVAA  101



>ref|NP_198137.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
 sp|Q940B0.1|RL183_ARATH RecName: Full=60S ribosomal protein L18-3 [Arabidopsis thaliana]
 gb|AAL07220.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAM67529.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAN31854.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AED93736.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
Length=187

 Score =   169 bits (427),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ S FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSNFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F +GK+DKIAVLVGTITDD+R +E+PA+KV A
Sbjct  61   PLSLSRLVEFMTGKDDKIAVLVGTITDDLRVHEIPAMKVTA  101



>ref|XP_009384409.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   169 bits (427),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SL RLI+F +GK++KIAV+VGT+TDD R YEVPALKV A
Sbjct  61   PISLKRLITFMNGKDNKIAVIVGTVTDDKRVYEVPALKVTA  101



>gb|ABK26318.1| unknown [Picea sitchensis]
Length=187

 Score =   169 bits (427),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSKQT+RTAPKS+D+YLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTNKP
Sbjct  1    MGIDLIAGGKSKQTRRTAPKSEDIYLKLLVKLYRFLVRRTSSRFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL  +  GKEDKIAV+VGTITDD R YE+P +K+ A
Sbjct  61   PLSLSRLARYMQGKEDKIAVVVGTITDDNRVYELPPVKITA  101



>gb|EMT12638.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=187

 Score =   169 bits (427),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRTAPKSDDVYLKLLVKLYRFLVRRTKSQFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLS+ RL+ F  GK DKIAV+VGTITDD R YE+PA+KV A
Sbjct  61   PLSMRRLVRFMEGKADKIAVIVGTITDDQRVYEIPAMKVAA  101



>ref|XP_009417724.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   168 bits (426),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+ AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDIVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SL RLI+F +GK+DKIAV+VGT+TDD R YEVPA+KV A
Sbjct  61   PISLKRLITFMNGKDDKIAVIVGTVTDDKRVYEVPAMKVTA  101



>ref|XP_007050976.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
 gb|EOX95133.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
Length=186

 Score =   168 bits (426),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 1/101 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLL +LYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLL-QLYRFLVRRTGSKFNAVILKRLFMSKVNKP  59

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F   KEDKIAV+VGT+TDD+R YEVPALKV A
Sbjct  60   PLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEVPALKVTA  100



>ref|XP_008370417.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score =   168 bits (426),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTASKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +  GK++KIAV+VGTITDD+R YEVP +KV A
Sbjct  61   PLSLSRLIKYMQGKDNKIAVVVGTITDDIRVYEVPQMKVTA  101



>gb|KDO39192.1| hypothetical protein CISIN_1g030771mg [Citrus sinensis]
Length=170

 Score =   167 bits (424),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 1/101 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTDSNFNKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI+F  GK DKIAV+VGT+TDD+RAYEVPALKV A
Sbjct  61   PLSLSRLINFMKGK-DKIAVVVGTVTDDIRAYEVPALKVTA  100



>gb|KJB82634.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=184

 Score =   168 bits (425),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 91/101 (90%), Gaps = 3/101 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVK+YRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKIYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  G   KIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PLSLSRLIEFMKG---KIAVVVGTVTDDIRVYEVPALKVTA  98



>ref|XP_010269589.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score =   168 bits (425),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMS+ NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSRVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRLI +  GKE+KIAVLVGT+TDD R Y+VPALKV A
Sbjct  61   PMSLSRLIRYMEGKENKIAVLVGTVTDDTRVYDVPALKVTA  101



>ref|XP_009411663.1| PREDICTED: 60S ribosomal protein L18-3-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   168 bits (425),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+ AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDIVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SL RLI+F +GK++KIAV+VGT+TDD R YEVPALKV A
Sbjct  61   PISLKRLITFMNGKDNKIAVIVGTVTDDKRVYEVPALKVTA  101



>ref|XP_010914484.1| PREDICTED: 60S ribosomal protein L18-3 [Elaeis guineensis]
Length=187

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SL RL  F  GK+DKIAV+VGT+TDD R YEVPA+KV A
Sbjct  61   PISLKRLAKFMEGKDDKIAVIVGTVTDDKRVYEVPAMKVTA  101



>ref|XP_004984437.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=187

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSDFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSL RL++F  GKE++IAV+VGT+TDD R YEVPA+KV A
Sbjct  61   PLSLRRLVNFMKGKENQIAVIVGTVTDDKRVYEVPAMKVAA  101



>ref|XP_006408052.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
 gb|ESQ49505.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
Length=187

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFL RRT SKFN VILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLFRRTNSKFNGVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV A
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTA  101



>ref|XP_006840598.1| hypothetical protein AMTR_s00343p00015240, partial [Amborella 
trichopoda]
 gb|ERN02273.1| hypothetical protein AMTR_s00343p00015240, partial [Amborella 
trichopoda]
Length=165

 Score =   167 bits (422),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GIDL AGGKSK+TKRTAPKS D+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+PP
Sbjct  1    GIDLVAGGKSKKTKRTAPKSGDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRPP  60

Query  273  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            +SLSRLI F  GKE KI V+VG +TDD R YEVPALKV A
Sbjct  61   ISLSRLIKFMQGKEGKIGVIVGCVTDDTRVYEVPALKVAA  100



>emb|CDY66803.1| BnaAnng22990D, partial [Brassica napus]
Length=200

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
             MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK
Sbjct  13   AMGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNK  72

Query  267  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
             PLSLS+L+ F +GK+ KIAVLVGTITDD+R +E+PA+KV A
Sbjct  73   APLSLSKLVEFMNGKDGKIAVLVGTITDDLRVHEIPAMKVTA  114



>ref|XP_009111741.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score =   167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV A
Sbjct  61   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTA  101



>gb|ABK22247.1| unknown [Picea sitchensis]
Length=187

 Score =   167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSKQTKRTAPKS+D+YLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTNKP
Sbjct  1    MGIDLIAGGKSKQTKRTAPKSEDIYLKLLVKLYRFLVRRTSSRFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL  +  GK+DK+AV+VGTITDD R YE+P +KV A
Sbjct  61   PLSLSRLARYMQGKDDKVAVVVGTITDDNRVYELPPVKVTA  101



>ref|XP_009151179.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score =   167 bits (423),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV A
Sbjct  61   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTA  101



>ref|XP_001781485.1| predicted protein [Physcomitrella patens]
 gb|EDQ53665.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   167 bits (422),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+TN+ 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSQNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSRTNRA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLS+SRL+ + +GKE KIAVLVGTITDDVR +EVPALKVCA
Sbjct  61   PLSMSRLVKYMTGKEGKIAVLVGTITDDVRQFEVPALKVCA  101



>emb|CDX99969.1| BnaC09g03320D [Brassica napus]
Length=210

 Score =   167 bits (423),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  24   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  83

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV A
Sbjct  84   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTA  124



>ref|XP_002461201.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
 gb|EER97722.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
Length=187

 Score =   166 bits (421),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLS+ RL+ F  GK D+IAV+VGT+TDD R  EVPA+KVCA
Sbjct  61   PLSMRRLVKFMEGKSDQIAVIVGTVTDDKRINEVPAMKVCA  101



>emb|CDY19736.1| BnaA09g03890D [Brassica napus]
Length=215

 Score =   167 bits (423),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  29   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  88

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV A
Sbjct  89   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTA  129



>ref|XP_010228645.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=187

 Score =   166 bits (420),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT + FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKNHFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSL RL+ F  GKE++IAV+VGTITDD + YEVPA+KV A
Sbjct  61   PLSLRRLVKFMEGKENQIAVIVGTITDDKKVYEVPAMKVAA  101



>ref|XP_003562459.1| PREDICTED: 60S ribosomal protein L18-3-like [Brachypodium distachyon]
Length=187

 Score =   166 bits (420),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSHFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLS+ RL+ F  GK D+IAV+VGTITDD R YE+PA+KV A
Sbjct  61   PLSMRRLVRFMEGKGDQIAVIVGTITDDKRVYEIPAMKVAA  101



>emb|CDY25018.1| BnaC02g39900D [Brassica napus]
Length=197

 Score =   166 bits (421),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
             MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK
Sbjct  10   AMGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNK  69

Query  267  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
             PLSLS+L  F  GK+ KIAVLVGTITDD+R +E+PA+KV A
Sbjct  70   APLSLSKLAEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTA  111



>ref|XP_009129884.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=222

 Score =   167 bits (422),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
             MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK
Sbjct  35   AMGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNK  94

Query  267  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
             PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV A
Sbjct  95   APLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTA  136



>emb|CDX80616.1| BnaC07g28280D [Brassica napus]
Length=232

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  46   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  105

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV A
Sbjct  106  PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTA  146



>ref|NP_001050069.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|ABF95861.1| 60S ribosomal protein L18, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11983.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|EEC75232.1| hypothetical protein OsI_11506 [Oryza sativa Indica Group]
 gb|EEE59035.1| hypothetical protein OsJ_10788 [Oryza sativa Japonica Group]
Length=187

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKL+VKLYRFLVRRT S FNAVIL+RLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLIVKLYRFLVRRTKSPFNAVILRRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSL RL+ F  GKE++IAV+VGT+TDD R YEVPA+KV A
Sbjct  61   PLSLRRLVRFMEGKENQIAVIVGTVTDDKRVYEVPAMKVAA  101



>ref|NP_001131538.1| uncharacterized protein LOC100192878 [Zea mays]
 gb|ACG24841.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG31936.1| 60S ribosomal protein L18 [Zea mays]
 tpg|DAA64098.1| TPA: ribosomal protein L18 [Zea mays]
Length=187

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLS+ RL+ F  GK D+IAV+VGT+TDD R  EVPA+KVCA
Sbjct  61   PLSMRRLVRFMEGKGDQIAVIVGTVTDDKRISEVPAMKVCA  101



>gb|ABK21809.1| unknown [Picea sitchensis]
 gb|ABK26564.1| unknown [Picea sitchensis]
Length=187

 Score =   165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSKTNKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSEDIYLKLLVKLYRFLVRRTSSSFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL  +  GK+DKIAV+VGTITDD R YE+P +KV A
Sbjct  61   PLSLSRLARYMQGKDDKIAVVVGTITDDNRVYELPPVKVTA  101



>ref|XP_001760902.1| predicted protein [Physcomitrella patens]
 gb|EDQ74291.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+ N+ 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSQNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSRINRA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLS+SRL+ + +GK+DKIAVLVGTITDDVR +EVPALKVCA
Sbjct  61   PLSMSRLVKYMAGKDDKIAVLVGTITDDVRQFEVPALKVCA  101



>ref|XP_006444385.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 ref|XP_006479993.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR57625.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 gb|KDO87175.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
 gb|KDO87176.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
Length=187

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKS+D+YLKLLVKLYRFLVRRT S F+ VILKRLFMSK NKP
Sbjct  1    MGIDLIAGGKSKKSKRTAPKSNDIYLKLLVKLYRFLVRRTDSNFDKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRL  F  GKEDKIAV+VGT+TDD+R YEVPALKV A
Sbjct  61   PMSLSRLTKFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTA  101



>ref|XP_009402513.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ +RTA +SDDVYLKLLVKLYRFLVRRTGSKFNAVIL+RLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKARRTASRSDDVYLKLLVKLYRFLVRRTGSKFNAVILRRLFMSKINRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SL RLI+F  GK+DKIAV+VGT+TDD R YEVPA+KV A
Sbjct  61   PISLKRLITFMQGKDDKIAVIVGTVTDDKRVYEVPAMKVTA  101



>emb|CEF99132.1| Ribosomal protein L18e, conserved site [Ostreococcus tauri]
Length=186

 Score =   164 bits (416),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG++K+T RTAPKSD+VYLKLLVKLYRFL RRTGSKFN  +LKRLFMSKTN+P
Sbjct  1    MGIDLKAGGRNKKTSRTAPKSDNVYLKLLVKLYRFLARRTGSKFNETVLKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L  F  GKE K+A +VGTITDDVR ++VP LKVCA
Sbjct  61   PLSLSKLAKFMKGKEGKVAAVVGTITDDVRMFDVPKLKVCA  101



>ref|XP_001751734.1| predicted protein [Physcomitrella patens]
 gb|EDQ83169.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   164 bits (414),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FN+VILKRLFMS+TN+ 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSGNVYLKLLVKLYRFLVRRTDAPFNSVILKRLFMSRTNRA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLS+SRL+ + +GK+DKIAVLVGTITDDVR +EVPALKV A
Sbjct  61   PLSMSRLVKYMAGKDDKIAVLVGTITDDVRQFEVPALKVAA  101



>gb|KFK37967.1| hypothetical protein AALP_AA3G053100 [Arabis alpina]
Length=187

 Score =   163 bits (413),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT S FN VILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSNFNKVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+   SGK+DKIAVLVGTITDDVR +++PA+KV A
Sbjct  61   PLSLSRLVELMSGKDDKIAVLVGTITDDVRVHDIPAIKVAA  101



>ref|XP_006650060.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score =   163 bits (413),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAP+S+DVYLKL+VKLYRFLVRRT S FNAVIL+RLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYLKLIVKLYRFLVRRTKSPFNAVILRRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSL RL+ F  GKE++IAV+VGT+TDD R YEVPA+KV A
Sbjct  61   PLSLRRLVRFMEGKENQIAVIVGTVTDDKRVYEVPAMKVAA  101



>ref|XP_004494578.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   163 bits (413),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGK+K+TKRT+PKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+P
Sbjct  1    MGIDLKAGGKNKKTKRTSPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +  GKE KI V+VG +TDD+R Y+VPA+KV A
Sbjct  61   PLSLSRLIKYMQGKEGKIGVVVGAVTDDIRVYDVPAIKVTA  101



>ref|XP_006288739.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
 gb|EOA21637.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
Length=187

 Score =   163 bits (413),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L+SF  GK+ KI VLVGTITDD+R  E+PA+K+ A
Sbjct  61   PLSLSKLVSFMEGKDGKIGVLVGTITDDLRIQEIPAMKITA  101



>ref|XP_001785869.1| predicted protein [Physcomitrella patens]
 gb|EDQ49322.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   163 bits (413),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG++K+TKRTAPKSD+VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+ N+P
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSDNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSRINRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+S+SRL+ + +GKE KIAV+VGT+TDD R YEVPALKV A
Sbjct  61   PISMSRLVKYMTGKEGKIAVIVGTVTDDTRIYEVPALKVAA  101



>gb|AFW81438.1| hypothetical protein ZEAMMB73_288952 [Zea mays]
Length=130

 Score =   161 bits (408),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+S+ RL+ F  GKE  IAV+VGT+TDD R  EVPA+KV A
Sbjct  61   PISMRRLVKFMEGKEKNIAVIVGTVTDDKRIQEVPAMKVTA  101



>ref|XP_010455077.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Camelina 
sativa]
Length=187

 Score =   163 bits (412),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L+SF +GK+ KI VLVGTITDD+R +++PA+K+ A
Sbjct  61   PLSLSKLVSFMNGKDGKIGVLVGTITDDLRVHDIPAMKITA  101



>ref|XP_010421566.1| PREDICTED: 60S ribosomal protein L18-2-like [Camelina sativa]
Length=187

 Score =   163 bits (412),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L+SF +GK+ KI VLVGTITDD+R +++PA+K+ A
Sbjct  61   PLSLSKLVSFMNGKDGKIGVLVGTITDDLRVHDIPAMKITA  101



>ref|XP_001760959.1| predicted protein [Physcomitrella patens]
 gb|EDQ74348.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   162 bits (410),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FNAV+LKRLFMS+ N+P
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSGNVYLKLLVKLYRFLVRRTDAPFNAVVLKRLFMSRINRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+S+SRL+ +  GKEDKIAV+VG++TDD R YEVPALKV A
Sbjct  61   PISMSRLVRYMKGKEDKIAVIVGSVTDDTRIYEVPALKVAA  101



>ref|XP_009381102.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   161 bits (408),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTESKFNAVILKRLFMSKNNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SL RLI+F   K+DKIAV+VGT+TDD R Y+VPA+KV A
Sbjct  61   PISLKRLITFMERKDDKIAVIVGTVTDDKRVYDVPAMKVTA  101



>gb|AFW77276.1| hypothetical protein ZEAMMB73_917876 [Zea mays]
Length=160

 Score =   160 bits (406),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+S+ RL+ F  GKE  IAV+VGT+TDD R  EVPA+KV A
Sbjct  61   PISMRRLVKFMEGKEKNIAVIVGTVTDDKRIQEVPAMKVTA  101



>gb|EPS67068.1| hypothetical protein M569_07709, partial [Genlisea aurea]
Length=186

 Score =   161 bits (408),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT SKFN V+LKRLFMS+ N+PP
Sbjct  1    GIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESKFNGVVLKRLFMSRVNRPP  60

Query  273  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            L LSRLI+   GKEDKIAVLVGTITDD R +EVP LKV A
Sbjct  61   LRLSRLIAHMKGKEDKIAVLVGTITDDNRIHEVPPLKVTA  100



>ref|NP_001132852.1| uncharacterized protein LOC100194344 [Zea mays]
 gb|ACG24961.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG34787.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG39589.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACR34137.1| unknown [Zea mays]
 gb|AFW77275.1| ribosomal protein L18 [Zea mays]
 gb|AFW81439.1| ribosomal protein L18 [Zea mays]
 gb|AGS43131.1| hypothetical protein [Zea mays]
Length=187

 Score =   161 bits (407),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+S+ RL+ F  GKE  IAV+VGT+TDD R  EVPA+KV A
Sbjct  61   PISMRRLVKFMEGKEKNIAVIVGTVTDDKRIQEVPAMKVTA  101



>ref|XP_001419602.1| Ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97895.1| Ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=186

 Score =   161 bits (407),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG++K+T RTAPKSD+VYLKLLVKLYRFL RRT SKFN  +LKRLFMSKTN+P
Sbjct  1    MGIDLKAGGRNKKTNRTAPKSDNVYLKLLVKLYRFLARRTDSKFNDTVLKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS++  F  GKE K+A +VGT+TDDVR ++VPALKVCA
Sbjct  61   PLSLSKVAKFMKGKEGKVAAIVGTVTDDVRLHDVPALKVCA  101



>ref|XP_008789961.1| PREDICTED: uncharacterized protein LOC103707302 [Phoenix dactylifera]
Length=988

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ KRTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK N+P
Sbjct  802  MGIDLIAGGRSKKAKRTAPKSDDVYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKVNRP  861

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SL RL++F  GKEDKIAV+VGT+TDD R YEVPA+KV A
Sbjct  862  PISLKRLVTFMQGKEDKIAVIVGTVTDDKRVYEVPAMKVTA  902



>ref|XP_008656150.1| PREDICTED: 60S ribosomal protein L18-3-like [Zea mays]
Length=222

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  36   MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  95

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+S+ RL+ F  GKE  IAV+VGT+TDD R  EVPA+KV A
Sbjct  96   PISMRRLVKFMEGKEKNIAVIVGTVTDDKRIQEVPAMKVTA  136



>gb|EMT18368.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=188

 Score =   160 bits (405),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCA  392
            PLS+ RL +F  GKE+K IAV+VGTITDD+R  EVPA+KV A
Sbjct  61   PLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQEVPAMKVTA  102



>pdb|3J61|Q Chain Q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50985.1| ribosomal protein L18 [Triticum aestivum]
Length=188

 Score =   160 bits (405),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCA  392
            PLS+ RL +F  GKE+K IAV+VGTITDD+R  EVPA+KV A
Sbjct  61   PLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQEVPAMKVTA  102



>ref|XP_002439318.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
 gb|EES17748.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
Length=188

 Score =   160 bits (405),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 1/102 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCA  392
            P+SL RL+ F  GKE+K IAV+VGT+TDD R  EVPA+KV A
Sbjct  61   PISLRRLVKFMEGKEEKNIAVIVGTVTDDKRIQEVPAMKVTA  102



>gb|AFC88838.1| 60S ribosomal protein L18-like protein [Miscanthus sinensis]
Length=188

 Score =   160 bits (405),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 1/102 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCA  392
            P+SL RL+ F  GKE+K IAV+VGT+TDD R  EVPA+KV A
Sbjct  61   PISLRRLVKFMEGKEEKNIAVIVGTVTDDKRIQEVPAMKVTA  102



>ref|XP_003626231.1| 60S ribosomal protein L18 [Medicago truncatula]
 gb|ACJ85938.1| unknown [Medicago truncatula]
 gb|AES82449.1| 60S ribosomal protein L18-3 [Medicago truncatula]
 gb|AFK48984.1| unknown [Medicago truncatula]
Length=187

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK TKRT PKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+P
Sbjct  1    MGIDLKAGGKSKNTKRTEPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLS++I +  GK+ KI V+VG +TDD+R YEVP LK+ A
Sbjct  61   PISLSKMIEYMKGKDGKIGVVVGAVTDDIRVYEVPVLKIAA  101



>ref|XP_001690885.1| ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 ref|XP_010832938.1| PREDICTED: 60S ribosomal protein L18-2-like [Bison bison bison]
 gb|EDP05331.1| ribosomal protein L18 [Chlamydomonas reinhardtii]
Length=187

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG+SK+  RTAPKS +VYL LLVKLYRFLVRRT SKFN VILKRLFMSKTN+P
Sbjct  1    MGIDLKAGGRSKKVHRTAPKSQNVYLALLVKLYRFLVRRTESKFNKVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L +F  GKE K+AV+V T+TDDVR +EVP L+VCA
Sbjct  61   PLSLSKLAAFMKGKESKVAVIVATVTDDVRLFEVPKLRVCA  101



>ref|XP_006658116.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAP+S+DVY+KLLVKLYRFL RRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYVKLLVKLYRFLERRTKSHFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLS+ RL+ F  GK D+IAV+VGT+TDD R YEVPA+KV A
Sbjct  61   PLSMRRLVRFMEGKGDQIAVIVGTVTDDKRVYEVPAMKVAA  101



>emb|CDY05559.1| BnaA02g31320D [Brassica napus]
Length=503

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  36   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  95

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV A
Sbjct  96   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTA  136



>dbj|BAJ90421.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88976.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCA  392
            PLS+ RL +F  GKE+K IAV+VGTITDD+R  E+PA+KV A
Sbjct  61   PLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQEIPAMKVTA  102



>ref|XP_004958675.1| PREDICTED: 60S ribosomal protein L18-3-like [Setaria italica]
Length=187

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+ 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSPFNAVILKRLFMSKANRS  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLS+ RL+ F  GK D+IAV+VGT+TDD R  EVPA+KVCA
Sbjct  61   PLSMRRLVKFMEGKGDQIAVIVGTVTDDKRITEVPAMKVCA  101



>ref|XP_010921627.1| PREDICTED: uncharacterized protein LOC105045157 [Elaeis guineensis]
Length=398

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            + GIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK N+
Sbjct  211  SQGIDLIAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKINR  270

Query  267  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PP+SL RL++F  GK DKIAV+VGT+TDD R Y+VPALKV A
Sbjct  271  PPISLKRLVTFMEGKGDKIAVIVGTVTDDKRVYDVPALKVTA  312



>gb|AGV54741.1| 60S ribosomal protein L18-3-like protein [Phaseolus vulgaris]
Length=222

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 93/136 (68%), Gaps = 35/136 (26%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID KAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDFKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGK-----------------------------------EDKIAVLVGTI  344
            PLSLSRLI +T GK                                   EDKIAV+VGTI
Sbjct  61   PLSLSRLIRYTKGKVCLSIFFTSCTGVASSHIVLLIIAYISTFYFCQMLEDKIAVVVGTI  120

Query  345  TDDVRAYEVPALKVCA  392
            TDD+R YEVP LK+ A
Sbjct  121  TDDIRVYEVPQLKITA  136



>ref|XP_002948325.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ50732.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=187

 Score =   158 bits (399),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG+SK+  RTAPKS +VYL LLVKLYRFLVRRT SKFN VILKRLFMSKTN+P
Sbjct  1    MGIDLKAGGRSKKVHRTAPKSQNVYLALLVKLYRFLVRRTDSKFNKVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L +F  GKE+K+AV+V T+TDDVR YEVP L+V A
Sbjct  61   PLSLSKLATFMKGKENKVAVIVATVTDDVRLYEVPKLRVVA  101



>ref|XP_003568896.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=188

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYL+LLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLRLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCA  392
            PLS+ RL +F  GK++K IAV+VGTITDD R  E+PA+KV A
Sbjct  61   PLSMRRLSNFMKGKDEKSIAVIVGTITDDKRIQEIPAMKVTA  102



>ref|XP_005643635.1| ribosomal protein L18 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE19091.1| ribosomal protein L18 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=186

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL+AGG++K+T RTAPKS++VYLKLLVKLY FLVRRT SKFN V+LKRLFMS+TN+P
Sbjct  1    MGIDLEAGGRNKKTWRTAPKSENVYLKLLVKLYTFLVRRTESKFNKVVLKRLFMSRTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L +F  GKEDK AVL+GTITDDVR +EVP L V A
Sbjct  61   PLSLSKLATFMKGKEDKTAVLIGTITDDVRLFEVPKLTVVA  101



>ref|XP_006654064.1| PREDICTED: 60S ribosomal protein L18-2-like [Oryza brachyantha]
Length=188

 Score =   156 bits (395),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAP+SDDVYLKL+VKLYRFL RRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSDDVYLKLIVKLYRFLYRRTKSKFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCA  392
            PLSL RL  F  GKE+K IAV+VGT+TDD R  E+PA+KV A
Sbjct  61   PLSLRRLAKFMEGKEEKNIAVIVGTVTDDKRIQEIPAMKVTA  102



>emb|CDY05183.1| BnaC05g46200D [Brassica napus]
Length=223

 Score =   157 bits (398),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
             GIDL AGGKSK+TKRTAPKSDDVYL      YRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  37   QGIDLIAGGKSKKTKRTAPKSDDVYLSSPESFYRFLVRRTQSKFNAVILKRLFMSKVNKA  96

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F +GKEDKIAVLVGTITDD+R +E+PA+KV A
Sbjct  97   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTA  137



>ref|XP_004977069.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=188

 Score =   156 bits (395),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSSFNAVILKRLFMSKANRP  60

Query  270  PLSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCA  392
            P+SL RL +F  GKE+K IAV+VGT+TDD R  E+PA+KV A
Sbjct  61   PISLRRLANFMKGKEEKNIAVIVGTVTDDKRIQEIPAMKVTA  102



>gb|EMS65848.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=229

 Score =   157 bits (397),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 90/101 (89%), Gaps = 1/101 (1%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GIDL AGG++K+TKR APKS+DVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+PP
Sbjct  8    GIDLVAGGRNKRTKRVAPKSNDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRPP  67

Query  273  LSLSRLISFTSGKEDK-IAVLVGTITDDVRAYEVPALKVCA  392
            LS+ RL +F  GKE+K IAV+VGTITDD+R  EVPA+KV A
Sbjct  68   LSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQEVPAMKVTA  108



>gb|EYU46738.1| hypothetical protein MIMGU_mgv1a014520mg [Erythranthe guttata]
Length=187

 Score =   155 bits (393),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRT PKSDD+Y+KLLVKLY FLVRRTGSKFN V+ KRL MS+ N+P
Sbjct  1    MGIDLVAGGKSKKTKRTKPKSDDIYIKLLVKLYSFLVRRTGSKFNEVVRKRLTMSRVNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL +   GKE++IAVLVG++TDD+R +E+PA+KV A
Sbjct  61   PLSLSRLSALMKGKENQIAVLVGSVTDDIRVHEIPAMKVAA  101



>ref|XP_004495692.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   155 bits (392),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK++KRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKSKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI +T GKE KIAV+VG ITDD+R YEVPA+KV A
Sbjct  61   PLSLSRLIKYTKGKEGKIAVVVGAITDDIRVYEVPAIKVTA  101



>ref|XP_005843726.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
 gb|EFN51624.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
Length=187

 Score =   155 bits (392),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+  RTAPKS++ Y+KLLVKLYRFLVRRT S FN V+LKRLFMSKTN+P
Sbjct  1    MGIDLIAGGRNKRVHRTAPKSENPYVKLLVKLYRFLVRRTESDFNKVVLKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L+ F  GKE K+AVLVGTITDD R +EVP L+VCA
Sbjct  61   PLSLSKLVKFMEGKEGKLAVLVGTITDDTRLFEVPKLRVCA  101



>sp|O65729.1|RL18_CICAR RecName: Full=60S ribosomal protein L18, partial [Cicer arietinum]
 emb|CAA06246.1| ribosomal protein L18 [Cicer arietinum]
Length=183

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  99   DLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLS  278
            DLKAGGK+K+TKRT+PKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+PPLS
Sbjct  1    DLKAGGKNKKTKRTSPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNRPPLS  60

Query  279  LSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            LSRLI +  GKE KI V+VG +TDD+R Y+VP +KV A
Sbjct  61   LSRLIKYMQGKEGKIGVVVGAVTDDIRVYDVPTIKVTA  98



>ref|XP_009629121.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
Length=187

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI++  GKEDK+AV+VGT+TDDVRAYEVP+LKV A
Sbjct  61   PLSLSRLITYMKGKEDKVAVVVGTVTDDVRAYEVPSLKVTA  101



>gb|KIZ05100.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
 gb|KIZ07537.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
Length=187

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++ +  RTAPKSD+VYLKLLVKLYRFL RRT S FNAV+LKRLFMSK N+P
Sbjct  1    MGIDLVAGGRNTKKHRTAPKSDNVYLKLLVKLYRFLERRTESNFNAVVLKRLFMSKINRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L  F +GKEDK+AVLVGT+TDDVR +EVP L+V A
Sbjct  61   PLSLSKLAKFMAGKEDKVAVLVGTVTDDVRLHEVPKLRVTA  101



>ref|NP_001060617.1| Os07g0674700 [Oryza sativa Japonica Group]
 dbj|BAC83538.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAD31974.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAF22531.1| Os07g0674700 [Oryza sativa Japonica Group]
 gb|EAZ05118.1| hypothetical protein OsI_27311 [Oryza sativa Indica Group]
 dbj|BAG89915.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67806.1| hypothetical protein OsJ_25556 [Oryza sativa Japonica Group]
Length=195

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 90/109 (83%), Gaps = 8/109 (7%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAP+S+DVYLKL+VKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYLKLIVKLYRFLVRRTKSHFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGK--------EDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLS+ RL+ F  GK         D+IAV+VGT+TDD R YEVPA+KV A
Sbjct  61   PLSMRRLVRFMEGKVPDRHAISGDQIAVIVGTVTDDKRIYEVPAMKVAA  109



>emb|CDP05500.1| unnamed protein product [Coffea canephora]
Length=89

 Score =   151 bits (382),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGK K+TKRTAPKSDD+Y+KLLVKLYRFLVRRTGS+FNAV+LKRLFMSK NKP
Sbjct  1    MGIDLKAGGKVKKTKRTAPKSDDIYIKLLVKLYRFLVRRTGSRFNAVLLKRLFMSKINKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTI  344
            PLSLSRL+ F  GKEDKIAVLVGTI
Sbjct  61   PLSLSRLVKFMEGKEDKIAVLVGTI  85



>ref|NP_001054688.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|AAV32218.1| cytoplasmic ribosomal protein L18 [Oryza sativa Japonica Group]
 dbj|BAF16602.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|EAY96610.1| hypothetical protein OsI_18515 [Oryza sativa Indica Group]
 gb|ABR25945.1| 60S ribosomal protein l18 [Oryza sativa Indica Group]
 dbj|BAG88175.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00211.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62383.1| hypothetical protein OsJ_17172 [Oryza sativa Japonica Group]
Length=188

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAP+SDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKED-KIAVLVGTITDDVRAYEVPALKVCA  392
            PLSL RL  F  GKE+  IAV+VGT+TDD R  E+P +KV A
Sbjct  61   PLSLRRLAKFMEGKEENNIAVIVGTVTDDKRIQEIPKMKVTA  102



>ref|XP_010550997.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Tarenaya 
hassleriana]
Length=187

 Score =   153 bits (386),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSSFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL++F  GKEDKI V+VGT+TDDVR YEVPALKV A
Sbjct  61   PLSLSRLVNFMQGKEDKIGVVVGTVTDDVRVYEVPALKVTA  101



>ref|XP_010524859.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score =   152 bits (385),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ F  GKEDKI V+VGT+TDDVR YEVPALKV A
Sbjct  61   PLSLSRLVRFMQGKEDKIGVVVGTVTDDVRVYEVPALKVTA  101



>ref|XP_002985888.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
 gb|EFJ13065.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
Length=187

 Score =   152 bits (383),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID++AGG++K+TKRTAPKSD+VYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDIEAGGRNKKTKRTAPKSDNVYLKLLVKLYRFLVRRTNSKFNAVILKRLFMSKTNQP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRL +    K  KIAVLVGT+TDD R   VPA+ V A
Sbjct  61   PVSLSRLSASMEKKSGKIAVLVGTVTDDPRLAAVPAMTVVA  101



>sp|O22254.3|RL181_ARATH RecName: Full=Putative 60S ribosomal protein L18-1 [Arabidopsis 
thaliana]
Length=188

 Score =   152 bits (383),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRT PKSDDVYLKLLVK  R+LVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTEPKSDDVYLKLLVKANRYLVRRTESKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+ +  GK+ KIAV+VGT+TDDVR  +VPAL V A
Sbjct  61   PLSLSRLVRYMDGKDGKIAVIVGTVTDDVRIEDVPALTVTA  101



>ref|XP_002976425.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
 gb|EFJ22685.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
Length=187

 Score =   151 bits (382),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID++AGG++K+TKRTAPKSD+VYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDIEAGGRNKKTKRTAPKSDNVYLKLLVKLYRFLVRRTNSKFNAVILKRLFMSKTNQP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRL +    K  KIAVLVGT+TDD R   VPA+ V A
Sbjct  61   PVSLSRLSASMEKKSGKIAVLVGTVTDDPRLATVPAMTVVA  101



>gb|KFK32338.1| hypothetical protein AALP_AA6G228700 [Arabis alpina]
Length=197

 Score =   151 bits (382),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT S FN VILKRLFMSK NK P
Sbjct  14   GIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSNFNKVILKRLFMSKVNKAP  73

Query  273  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
             SLSRL+   SGK+DKIAVLVGTI DDV  +++ A+KV A
Sbjct  74   FSLSRLVELMSGKDDKIAVLVGTIIDDVSVHDILAIKVAA  113



>emb|CDP07204.1| unnamed protein product [Coffea canephora]
Length=86

 Score =   147 bits (372),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGK K+TKRTAPKSDD+YLKLLVKLYRFL RRTGS+FNAV+LKRLFMSK +KP
Sbjct  1    MGIDLKAGGKVKKTKRTAPKSDDIYLKLLVKLYRFLERRTGSRFNAVLLKRLFMSKIDKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTI  344
            PLSLSRL+ F  GKEDKIAVLVGTI
Sbjct  61   PLSLSRLVKFMEGKEDKIAVLVGTI  85



>ref|XP_007510670.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18203.1| predicted protein [Bathycoccus prasinos]
Length=240

 Score =   152 bits (383),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GIDL+AGG++K+TKRT+ KS++VYL LLVKLYRFL RRT SKFN  +LKRLFMSKTN+PP
Sbjct  56   GIDLEAGGRNKKTKRTSQKSENVYLALLVKLYRFLARRTDSKFNQTVLKRLFMSKTNRPP  115

Query  273  LSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            LSLS+L  F  GKE K+A +VGTITDDVR +EVP L VCA
Sbjct  116  LSLSKLAKFMKGKEGKVACVVGTITDDVRMFEVPKLTVCA  155



>ref|XP_004247404.1| PREDICTED: 60S ribosomal protein L18-2 [Solanum lycopersicum]
Length=187

 Score =   149 bits (375),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRIAPKSDDVYLKLLVKLYRFLSRRTGSKFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+++ +GKED IAV+VGT+TDDVRAYEVP +KV A
Sbjct  61   PLSLSRLVTYMTGKEDNIAVVVGTVTDDVRAYEVPKIKVTA  101



>ref|XP_008669243.1| PREDICTED: uncharacterized protein LOC103646289 [Zea mays]
Length=201

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVR  359
            PLS+ RL+ F  GK D+IAV+VGT+TDD R
Sbjct  61   PLSMRRLVRFMEGKGDQIAVIVGTVTDDKR  90



>ref|XP_011396696.1| 60S ribosomal protein L18-3 [Auxenochlorella protothecoides]
 gb|KFM23818.1| 60S ribosomal protein L18-3 [Auxenochlorella protothecoides]
Length=187

 Score =   147 bits (372),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL+AGG++ +  RTAPKS + Y+KLLVKLYRFLVRRT S FN VILKRLFMSK N+P
Sbjct  1    MGIDLRAGGRNTKVHRTAPKSQNPYVKLLVKLYRFLVRRTESDFNKVILKRLFMSKVNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L  FT+G+  KIAVLVGT+TDD+R +EVP ++V A
Sbjct  61   PLSLSKLAKFTAGQPGKIAVLVGTVTDDIRLHEVPKIRVAA  101



>gb|KJB26287.1| hypothetical protein B456_004G239000 [Gossypium raimondii]
Length=224

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 86/109 (79%), Gaps = 8/109 (7%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRR GS FNAVILKRLFM K NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRAGSNFNAVILKRLFMRKVNKP  60

Query  270  PLSLSRL--------ISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSL  +        +++    EDKI V+VGT+TDD+R YEVPAL V A
Sbjct  61   PLSLYFICGSGFLGSLNYCWFGEDKIGVVVGTVTDDIRVYEVPALTVTA  109



>ref|XP_009611670.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   145 bits (365),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TK TAPKS DVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKCTAPKSGDVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI++  GKEDK+ V+VGT+TDDVRAYEVP+LKV A
Sbjct  61   PLSLSRLITYMKGKEDKVVVVVGTVTDDVRAYEVPSLKVTA  101



>emb|CBK21900.2| Ribosomal protein L18e [Blastocystis hominis]
Length=189

 Score =   144 bits (362),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 83/102 (81%), Gaps = 1/102 (1%)
 Frame = +3

Query  90   MGIDLKAGGKS-KQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            MGIDL AGG++    KR APKS++VYL LLV LYRFL RRT ++F  V+LKRL+MS+ N+
Sbjct  3    MGIDLVAGGRNCGHKKRQAPKSENVYLALLVNLYRFLARRTNARFPEVVLKRLYMSRINR  62

Query  267  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PP+SLSRL+    GKEDKIAV+VGT+TDD+R  EVPALKVCA
Sbjct  63   PPMSLSRLMKHMQGKEDKIAVIVGTVTDDIRVIEVPALKVCA  104



>gb|EWM27599.1| Ribosomal protein L18e/L15P [Nannochloropsis gaditana]
Length=191

 Score =   143 bits (361),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTK-RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            MGIDLK+GG+    K RTAPKSD+VYLKLLVKLYRFL RRT S FNAVILKRLFMSK N+
Sbjct  1    MGIDLKSGGRRTGHKTRTAPKSDNVYLKLLVKLYRFLARRTDSNFNAVILKRLFMSKNNR  60

Query  267  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PP+++SRL+    GKE K AV+VGTITDD R  EVP L V A
Sbjct  61   PPIAISRLVRHMKGKEGKTAVIVGTITDDARMLEVPKLSVAA  102



>emb|CBK22327.2| unnamed protein product [Blastocystis hominis]
Length=194

 Score =   141 bits (355),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +3

Query  93   GIDLKAGGKS-KQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            GIDL AGG++    KR APKS++VYL LLV LYRFL RRT ++F  V+LKRL+MS+ N+P
Sbjct  9    GIDLVAGGRNCGHKKRQAPKSENVYLALLVNLYRFLARRTNARFPEVVLKRLYMSRINRP  68

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+SLSRL+    GKEDKIAV+VGT+TDD+R  EVPALKVCA
Sbjct  69   PMSLSRLMKHMQGKEDKIAVIVGTVTDDIRVIEVPALKVCA  109



>gb|KHG01788.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
Length=160

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 78/101 (77%), Gaps = 13/101 (13%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFN VILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNTVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI F  GK              +  YEVPALKV A
Sbjct  61   PLSLSRLIQFMKGK-------------GLWVYEVPALKVTA  88



>ref|XP_004290808.1| PREDICTED: 60S ribosomal protein L18-2 [Fragaria vesca subsp. 
vesca]
Length=187

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK T+RT+P+S D+YLKL VKLY F+ RRT S F+ VI  RL MSK NK 
Sbjct  1    MGIDLVAGGKSKNTRRTSPRSQDIYLKLTVKLYDFIHRRTKSHFSKVIRHRLCMSKVNKA  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL  +  G EDKIAVLVGT+TDDVR  EVPALKV A
Sbjct  61   PLSLSRLCRYMQGHEDKIAVLVGTVTDDVRIAEVPALKVTA  101



>ref|XP_003056676.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58321.1| predicted protein [Micromonas pusilla CCMP1545]
Length=183

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 81/101 (80%), Gaps = 3/101 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL+AGG++K   RTAPKS++VYLKLLVKLYRFL RRT S FN  +LKRLFMSK N+P
Sbjct  1    MGIDLEAGGRNKVKHRTAPKSENVYLKLLVKLYRFLARRTDSDFNKTVLKRLFMSKINRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L  F  G    ++ +VGT+TDD R +EVPA+KVCA
Sbjct  61   PLSLSKLAKFHKG---GVSAIVGTVTDDARMFEVPAMKVCA  98



>ref|XP_010277700.1| PREDICTED: uncharacterized protein LOC104612082 [Nelumbo nucifera]
Length=491

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 80/95 (84%), Gaps = 4/95 (4%)
 Frame = +3

Query  108  AGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSR  287
            AGGKSK+TKRTAPKS D+YLKL    YRFL+RRTGS FNAVILKRLFMS+ NK P+SLS 
Sbjct  282  AGGKSKKTKRTAPKSKDIYLKL----YRFLIRRTGSNFNAVILKRLFMSRVNKAPMSLSI  337

Query  288  LISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            LISF  GKEDKI V+VGT+TDD + YEVPALKV A
Sbjct  338  LISFMKGKEDKIVVIVGTVTDDTQVYEVPALKVTA  372



>ref|XP_006677675.1| hypothetical protein BATDEDRAFT_87003 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82239.1| hypothetical protein BATDEDRAFT_87003 [Batrachochytrium dendrobatidis 
JAM81]
Length=186

 Score =   137 bits (345),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+DL+     K+  R APKSD+VYL+LLVKLYRFL RRT SKFN V+LKRLFMS+ N+P
Sbjct  1    MGVDLQKKHHQKKGARVAPKSDNVYLRLLVKLYRFLARRTNSKFNQVVLKRLFMSRVNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            P+S+SRL  + SGKE+KIAV+VGT+TDD R  EVP + V A
Sbjct  61   PISISRLSKYLSGKENKIAVVVGTVTDDNRLLEVPKISVAA  101



>ref|XP_002506220.1| ribosomal protein L18 [Micromonas sp. RCC299]
 gb|ACO67478.1| ribosomal protein L18 [Micromonas sp. RCC299]
Length=386

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 84/102 (82%), Gaps = 2/102 (2%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            + GID++AGG++K+  RTAPKS++VYLKLLVKLYRFLVRRT SK N  ILKRLFMSK N+
Sbjct  202  SQGIDIEAGGRNKKKSRTAPKSENVYLKLLVKLYRFLVRRTDSKVNETILKRLFMSKINR  261

Query  267  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PPLSLS+L  F   K  +I+ +VGTITDD R +EVPAL+VCA
Sbjct  262  PPLSLSKLAKFA--KPGQISAVVGTITDDARMFEVPALRVCA  301



>gb|EYU21621.1| hypothetical protein MIMGU_mgv1a014504mg [Erythranthe guttata]
Length=187

 Score =   136 bits (343),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAP+S+DVY+KLLVKLYRFL RRTGS FN++ILKRL MS+ N+P
Sbjct  1    MGIDLVAGGKSKKTKRTAPRSNDVYIKLLVKLYRFLTRRTGSSFNSIILKRLIMSRVNRP  60

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL S   GKE +IAVLVG+ITDD+R +E+PA+KV A
Sbjct  61   PLSLSRLSSLMKGKEGQIAVLVGSITDDIRVHEIPAMKVAA  101



>gb|EAW52364.1| ribosomal protein L18, isoform CRA_f [Homo sapiens]
Length=142

 Score =   134 bits (336),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCA  102



>gb|AFC88843.1| 60S ribosomal protein L18-3-like protein, partial [Miscanthus 
sinensis]
Length=166

 Score =   134 bits (338),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  144  PKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTSGKEDKI  323
            PKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+ PLS+ RL+ F  GK D+I
Sbjct  1    PKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRAPLSMRRLVKFMEGKGDQI  60

Query  324  AVLVGTITDDVRAYEVPALKVCA  392
            AV+VGT+TDD R  EVPA+KVCA
Sbjct  61   AVIVGTVTDDKRINEVPAMKVCA  83



>gb|EDM07303.1| rCG53680, isoform CRA_b [Rattus norvegicus]
Length=146

 Score =   134 bits (336),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRILEVPKLKVCA  102



>gb|ACD65122.1| putative 60S ribosomal protein RPL18 [Novocrania anomala]
Length=132

 Score =   133 bits (334),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 82/103 (80%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID++     ++ +R APKS D+YL+LLVKLYRFL RRT +KFN ++LKRLFMSK+N+P
Sbjct  1    MGIDIRHKN-DRKVRRKAPKSQDIYLRLLVKLYRFLARRTNAKFNKIVLKRLFMSKSNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRL+      G+EDKI V+VGTITDD+R  ++P LKVCA
Sbjct  60   PLSLSRLVRKMKLKGREDKITVVVGTITDDIRITDIPKLKVCA  102



>ref|XP_008607735.1| 60S ribosomal protein [Saprolegnia diclina VS20]
 gb|EQC38911.1| 60S ribosomal protein [Saprolegnia diclina VS20]
 gb|KDO29707.1| 60S ribosomal protein [Saprolegnia parasitica CBS 223.65]
Length=192

 Score =   134 bits (338),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 83/102 (81%), Gaps = 1/102 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTK-RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            MG D+ AGGKS   K RTAPKS++VYL LLV+LYRFL RRT +KFN V+LKRL+MS+TN+
Sbjct  1    MGKDIIAGGKSTGRKSRTAPKSENVYLNLLVRLYRFLARRTDAKFNEVVLKRLYMSRTNQ  60

Query  267  PPLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PP+S++R+  +   KEDKIAV+VGTITDD+R ++VP L + A
Sbjct  61   PPMSIARVARYMKNKEDKIAVVVGTITDDIRLFDVPKLTIAA  102



>gb|EAW52359.1| ribosomal protein L18, isoform CRA_b [Homo sapiens]
Length=164

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCA  102



>ref|XP_004061142.1| PREDICTED: 60S ribosomal protein L18 [Gorilla gorilla gorilla]
Length=188

 Score =   134 bits (337),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCA  102



>ref|XP_007074184.1| PREDICTED: ribosomal protein L18-like [Panthera tigris altaica]
Length=188

 Score =   134 bits (337),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSRLI      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRLIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCA  102



>ref|XP_006039668.1| PREDICTED: 60S ribosomal protein L18-like, partial [Bubalus bubalis]
Length=138

 Score =   132 bits (333),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFTS--GKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGREGKTAVVVGTITDDVRVQEVPKLKVCA  102



>ref|XP_004089423.1| PREDICTED: 60S ribosomal protein L18 [Nomascus leucogenys]
Length=183

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 81/101 (80%), Gaps = 4/101 (4%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR++    G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRML---PGRENKTAVVVGTITDDVRVQEVPKLKVCA  97



>ref|XP_003801570.1| PREDICTED: ribosomal protein L18-like [Otolemur garnettii]
Length=188

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCA  102



>ref|XP_005336693.1| PREDICTED: 60S ribosomal protein L18 [Ictidomys tridecemlineatus]
Length=188

 Score =   134 bits (336),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCA  102



>ref|NP_000970.1| 60S ribosomal protein L18 isoform 1 [Homo sapiens]
 ref|NP_001180492.1| 60S ribosomal protein L18 [Macaca mulatta]
 ref|NP_001272313.1| 60S ribosomal protein L18 [Macaca fascicularis]
 ref|XP_008014743.1| PREDICTED: 60S ribosomal protein L18 [Chlorocebus sabaeus]
 ref|XP_008964949.1| PREDICTED: 60S ribosomal protein L18 [Pan paniscus]
 ref|XP_009193151.1| PREDICTED: 60S ribosomal protein L18 [Papio anubis]
 ref|XP_009434263.1| PREDICTED: 60S ribosomal protein L18 [Pan troglodytes]
 sp|Q07020.2|RL18_HUMAN RecName: Full=60S ribosomal protein L18 [Homo sapiens]
 sp|Q4R5H8.1|RL18_MACFA RecName: Full=60S ribosomal protein L18 [Macaca fascicularis]
 pdb|3J3B|Q Chain Q, Structure Of The Human 60s Ribosomal Proteins
 pdb|4CXD|Q Chain Q, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4UPX|Q Chain Q, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Pre-like State
 pdb|4UQ1|Q Chain Q, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Post-like State
 gb|AAA16329.1| ribosomal protein L18 [Homo sapiens]
 gb|AAH00374.1| Ribosomal protein L18 [Homo sapiens]
 gb|AAH09708.1| Ribosomal protein L18 [Homo sapiens]
 dbj|BAB79463.1| ribosomal protein L18 [Homo sapiens]
 dbj|BAE01647.1| unnamed protein product [Macaca fascicularis]
 gb|EAW52360.1| ribosomal protein L18, isoform CRA_c [Homo sapiens]
 gb|EAW52361.1| ribosomal protein L18, isoform CRA_c [Homo sapiens]
 gb|ABM82377.1| ribosomal protein L18 [synthetic construct]
 gb|ABM85556.1| ribosomal protein L18 [synthetic construct]
 dbj|BAG73671.1| ribosomal protein L18 [synthetic construct]
 gb|AIC63154.1| RPL18, partial [synthetic construct]
Length=188

 Score =   134 bits (336),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCA  102



>ref|XP_010385886.1| PREDICTED: 60S ribosomal protein L18 [Rhinopithecus roxellana]
Length=188

 Score =   134 bits (336),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCA  102



>ref|XP_008567503.1| PREDICTED: 60S ribosomal protein L18 [Galeopterus variegatus]
Length=188

 Score =   133 bits (335),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCA  102



>ref|XP_010366954.1| PREDICTED: 60S ribosomal protein L18 [Rhinopithecus roxellana]
Length=188

 Score =   133 bits (335),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCA  102



>ref|NP_001182442.1| 60S ribosomal protein L18 [Equus caballus]
 ref|NP_001238887.1| 60S ribosomal protein L18 [Canis lupus familiaris]
 ref|NP_001291837.1| ribosomal protein L18 [Ailuropoda melanoleuca]
 ref|XP_003997581.1| PREDICTED: 60S ribosomal protein L18 [Felis catus]
 ref|XP_004381744.1| PREDICTED: ribosomal protein L18-like [Trichechus manatus latirostris]
 ref|XP_004440284.1| PREDICTED: ribosomal protein L18-like isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004710471.1| PREDICTED: ribosomal protein L18-like [Echinops telfairi]
 ref|XP_004767483.1| PREDICTED: ribosomal protein L18-like [Mustela putorius furo]
 ref|XP_004811872.1| PREDICTED: ribosomal protein L18-like [Mustela putorius furo]
 ref|XP_006745427.1| PREDICTED: ribosomal protein L18-like [Leptonychotes weddellii]
 ref|XP_007956290.1| PREDICTED: 60S ribosomal protein L18 [Orycteropus afer afer]
 ref|XP_008504764.1| PREDICTED: 60S ribosomal protein L18 [Equus przewalskii]
 ref|XP_008682731.1| PREDICTED: 60S ribosomal protein L18 [Ursus maritimus]
 ref|XP_010584836.1| PREDICTED: 60S ribosomal protein L18 [Loxodonta africana]
 sp|D0VWQ3.2|RL18_CANFA RecName: Full=Ribosomal protein L18 [Canis lupus familiaris]
 gb|AEA39512.1| ribosomal protein L18 [Ailuropoda melanoleuca]
 gb|AEA39563.1| ribosomal protein L18 [Ailuropoda melanoleuca]
Length=188

 Score =   133 bits (335),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCA  102



>ref|NP_112364.1| 60S ribosomal protein L18 [Rattus norvegicus]
 sp|P12001.2|RL18_RAT RecName: Full=60S ribosomal protein L18 [Rattus norvegicus]
 gb|AAA42070.1| ribosomal protein L18 [Rattus norvegicus]
 gb|AAH84727.1| Ribosomal protein L18 [Rattus norvegicus]
 gb|EDM07307.1| rCG53680, isoform CRA_e [Rattus norvegicus]
Length=188

 Score =   133 bits (335),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRILEVPKLKVCA  102



>ref|XP_006868227.1| PREDICTED: ribosomal protein L18-like [Chrysochloris asiatica]
Length=188

 Score =   133 bits (335),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCA  102



>ref|XP_005664749.1| PREDICTED: 60S ribosomal protein L18-like [Sus scrofa]
Length=163

 Score =   132 bits (333),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGREGKTAVVVGTITDDVRVQEVPKLKVCA  102



>ref|XP_009775352.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=173

 Score =   132 bits (333),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRT P+SDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTTPQSDDVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTSGKEDK  320
            PLSLSRLI++  GKEDK
Sbjct  61   PLSLSRLITYMKGKEDK  77



>ref|XP_008843215.1| PREDICTED: 60S ribosomal protein L18 isoform X2 [Nannospalax 
galili]
Length=185

 Score =   133 bits (334),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 81/101 (80%), Gaps = 2/101 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR++    G+E+K AV+VGTITDDVR  +VP LKVCA
Sbjct  60   PLSLSRMMKL-PGRENKTAVVVGTITDDVRVLDVPKLKVCA  99



>ref|XP_006160253.1| PREDICTED: 60S ribosomal protein L18 [Tupaia chinensis]
 gb|ELW47166.1| 60S ribosomal protein L18 [Tupaia chinensis]
Length=188

 Score =   133 bits (334),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRIQEVPKLKVCA  102



>ref|XP_004451162.1| PREDICTED: ribosomal protein L18-like [Dasypus novemcinctus]
 ref|XP_006897320.1| PREDICTED: ribosomal protein L18-like [Elephantulus edwardii]
Length=188

 Score =   133 bits (334),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRIQEVPKLKVCA  102



>ref|XP_005312106.1| PREDICTED: 60S ribosomal protein L18 [Chrysemys picta bellii]
Length=188

 Score =   133 bits (334),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 84/103 (82%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +RT PKS D+YL+LLVKLYRFL RRT S+FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRTEPKSQDIYLRLLVKLYRFLARRTSSRFNKVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+++K AV+VGT+TDD+R +++P LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRDNKTAVVVGTVTDDIRIHDIPKLKVCA  102



>ref|XP_001745439.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90017.1| predicted protein [Monosiga brevicollis MX1]
Length=185

 Score =   132 bits (333),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID++    +K+ +RTAP+S+D YL+LLVKLYRFL RRT S FN V+L+RLFMS+ N+P
Sbjct  1    MGIDIRHH-HAKKGRRTAPESEDPYLRLLVKLYRFLARRTESSFNKVVLRRLFMSRINRP  59

Query  270  PLSLSRLISFTSGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLS+L++    +E KIAV+VGT+TDDVR  EVP L VCA
Sbjct  60   PLSLSKLMTHMKKQESKIAVIVGTVTDDVRVIEVPKLTVCA  100



>ref|XP_008843214.1| PREDICTED: 60S ribosomal protein L18 isoform X1 [Nannospalax 
galili]
Length=188

 Score =   132 bits (332),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  +VP LKVCA
Sbjct  60   PLSLSRMIQKMKLPGRENKTAVVVGTITDDVRVLDVPKLKVCA  102



>ref|XP_008046837.1| PREDICTED: 60S ribosomal protein L18 isoform X1 [Tarsius syrichta]
Length=188

 Score =   132 bits (332),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS++N+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRSNRP  59

Query  270  PLSLSRLISFT--SGKEDKIAVLVGTITDDVRAYEVPALKVCA  392
            PLSLSR+I      G+E+K AV+VGTITDDVR  EVP LKVCA
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRIQEVPKLKVCA  102



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559124820270