BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF023F05

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004241917.1|  PREDICTED: 60S ribosomal protein L15               274   4e-90   Solanum lycopersicum
ref|XP_004242022.1|  PREDICTED: 60S ribosomal protein L15               273   8e-90   Solanum lycopersicum
ref|XP_004236901.1|  PREDICTED: 60S ribosomal protein L15-like          273   1e-89   Solanum lycopersicum
ref|XP_009606590.1|  PREDICTED: 60S ribosomal protein L15               272   2e-89   Nicotiana tomentosiformis
ref|XP_009796395.1|  PREDICTED: 60S ribosomal protein L15-like          272   2e-89   Nicotiana sylvestris
ref|XP_009764605.1|  PREDICTED: 60S ribosomal protein L15-like          271   3e-89   Nicotiana sylvestris
sp|O82528.1|RL15_PETHY  RecName: Full=60S ribosomal protein L15         271   3e-89   Petunia x hybrida [garden petunia]
ref|XP_009607935.1|  PREDICTED: 60S ribosomal protein L15-like          271   7e-89   Nicotiana tomentosiformis
ref|XP_009618098.1|  PREDICTED: 60S ribosomal protein L15-like          270   1e-88   Nicotiana tomentosiformis
ref|XP_009768655.1|  PREDICTED: 60S ribosomal protein L15-like          270   1e-88   Nicotiana sylvestris
ref|XP_008369443.1|  PREDICTED: 60S ribosomal protein L15-1             270   4e-88   
ref|XP_006477158.1|  PREDICTED: 60S ribosomal protein L15-like          268   6e-88   Citrus sinensis [apfelsine]
gb|EYU24942.1|  hypothetical protein MIMGU_mgv1a013374mg                269   6e-88   Erythranthe guttata [common monkey flower]
ref|XP_009334550.1|  PREDICTED: 60S ribosomal protein L15-1             269   6e-88   Pyrus x bretschneideri [bai li]
ref|XP_007157273.1|  hypothetical protein PHAVU_002G057000g             268   8e-88   Phaseolus vulgaris [French bean]
gb|EYU43197.1|  hypothetical protein MIMGU_mgv1a012815mg                269   1e-87   Erythranthe guttata [common monkey flower]
ref|XP_011069801.1|  PREDICTED: 60S ribosomal protein L15               267   2e-87   Sesamum indicum [beniseed]
ref|XP_007209614.1|  hypothetical protein PRUPE_ppa011603mg             266   3e-87   Prunus persica
ref|XP_011076388.1|  PREDICTED: 60S ribosomal protein L15-like          266   3e-87   Sesamum indicum [beniseed]
ref|XP_010529971.1|  PREDICTED: 60S ribosomal protein L15-1             266   4e-87   Tarenaya hassleriana [spider flower]
gb|AGL08210.1|  60S ribosomal protein L15                               266   5e-87   Arachis hypogaea [goober]
ref|XP_002304285.2|  60S ribosomal protein L15                          266   6e-87   Populus trichocarpa [western balsam poplar]
gb|AFK46983.1|  unknown                                                 265   9e-87   Lotus japonicus
ref|XP_007155679.1|  hypothetical protein PHAVU_003G222000g             265   1e-86   Phaseolus vulgaris [French bean]
ref|XP_010667037.1|  PREDICTED: 60S ribosomal protein L15-1             265   2e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006369001.1|  60S ribosomal protein L15                          265   2e-86   Populus trichocarpa [western balsam poplar]
ref|XP_011017435.1|  PREDICTED: 60S ribosomal protein L15-like          265   2e-86   Populus euphratica
ref|XP_011031909.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    264   3e-86   Populus euphratica
ref|XP_010539086.1|  PREDICTED: 60S ribosomal protein L15-1-like        264   3e-86   Tarenaya hassleriana [spider flower]
ref|XP_006490145.1|  PREDICTED: 60S ribosomal protein L15-like          264   3e-86   Citrus sinensis [apfelsine]
gb|KHG00889.1|  60S ribosomal L15                                       264   4e-86   Gossypium arboreum [tree cotton]
ref|XP_010540825.1|  PREDICTED: 60S ribosomal protein L15-1-like        264   4e-86   Tarenaya hassleriana [spider flower]
ref|XP_002530661.1|  ribosomal protein L15, putative                    263   5e-86   Ricinus communis
ref|XP_011076387.1|  PREDICTED: 60S ribosomal protein L15-like          263   6e-86   Sesamum indicum [beniseed]
ref|XP_011080625.1|  PREDICTED: 60S ribosomal protein L15-like          263   6e-86   Sesamum indicum [beniseed]
ref|XP_002301250.1|  60S ribosomal protein L15                          263   6e-86   Populus trichocarpa [western balsam poplar]
ref|XP_010538411.1|  PREDICTED: 60S ribosomal protein L15-1-like        263   7e-86   Tarenaya hassleriana [spider flower]
gb|EPS66678.1|  hypothetical protein M569_08101                         263   8e-86   Genlisea aurea
gb|KDP39891.1|  hypothetical protein JCGZ_03422                         263   1e-85   Jatropha curcas
ref|XP_006421625.1|  hypothetical protein CICLE_v10005611mg             265   1e-85   
gb|KHG16565.1|  60S ribosomal L15-1 -like protein                       262   2e-85   Gossypium arboreum [tree cotton]
ref|XP_002510977.1|  ribosomal protein L15, putative                    262   2e-85   Ricinus communis
ref|XP_007039793.1|  Ribosomal protein L23/L15e family protein is...    262   2e-85   Theobroma cacao [chocolate]
ref|XP_006440278.1|  hypothetical protein CICLE_v10024403mg             263   2e-85   
gb|KHG22797.1|  60S ribosomal L15-1 -like protein                       261   3e-85   Gossypium arboreum [tree cotton]
gb|KJB51842.1|  hypothetical protein B456_008G234000                    261   3e-85   Gossypium raimondii
ref|XP_007038342.1|  Ribosomal protein L23/L15e family protein          261   3e-85   
gb|KHN44085.1|  60S ribosomal protein L15                               261   3e-85   Glycine soja [wild soybean]
ref|NP_001236804.1|  uncharacterized protein LOC100306052               261   3e-85   
gb|ACU24496.1|  unknown                                                 261   4e-85   Glycine max [soybeans]
ref|XP_010686789.1|  PREDICTED: 60S ribosomal protein L15               261   4e-85   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG20796.1|  60S ribosomal L15-1 -like protein                       261   5e-85   Gossypium arboreum [tree cotton]
ref|XP_003549922.1|  PREDICTED: 60S ribosomal protein L15-1-like        261   5e-85   
ref|XP_003593619.1|  Ribosomal protein L15                              263   5e-85   Medicago truncatula
gb|ACJ84067.1|  unknown                                                 261   5e-85   Medicago truncatula
gb|AFK49215.1|  unknown                                                 261   5e-85   Medicago truncatula
ref|XP_010053499.1|  PREDICTED: 60S ribosomal protein L15-2             260   7e-85   Eucalyptus grandis [rose gum]
ref|XP_002277836.1|  PREDICTED: 60S ribosomal protein L15-1             260   7e-85   Vitis vinifera
ref|NP_001235890.1|  uncharacterized protein LOC100305473               260   7e-85   Glycine max [soybeans]
gb|KDP22442.1|  hypothetical protein JCGZ_26273                         260   8e-85   Jatropha curcas
ref|XP_011001078.1|  PREDICTED: 60S ribosomal protein L15-like          260   9e-85   Populus euphratica
ref|XP_010264371.1|  PREDICTED: 60S ribosomal protein L15-like          260   9e-85   Nelumbo nucifera [Indian lotus]
ref|XP_008775187.1|  PREDICTED: 60S ribosomal protein L15               260   1e-84   Phoenix dactylifera
ref|XP_010258850.1|  PREDICTED: 60S ribosomal protein L15               260   1e-84   Nelumbo nucifera [Indian lotus]
ref|XP_010933636.1|  PREDICTED: 60S ribosomal protein L15-1             260   1e-84   Elaeis guineensis
ref|XP_007039791.1|  Ribosomal protein L23/L15e family protein is...    260   1e-84   
gb|AFK37409.1|  unknown                                                 259   1e-84   Lotus japonicus
ref|XP_004146916.1|  PREDICTED: 60S ribosomal protein L15-like is...    259   2e-84   Cucumis sativus [cucumbers]
ref|XP_010062398.1|  PREDICTED: 60S ribosomal protein L15-1             259   2e-84   Eucalyptus grandis [rose gum]
ref|XP_008437057.1|  PREDICTED: 60S ribosomal protein L15-2 isofo...    259   2e-84   Cucumis melo [Oriental melon]
gb|EPS59253.1|  hypothetical protein M569_15555                         259   3e-84   Genlisea aurea
ref|XP_004491939.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    259   3e-84   Cicer arietinum [garbanzo]
gb|ACV50439.1|  ribosomal protein L15                                   259   3e-84   Jatropha curcas
ref|XP_008241281.1|  PREDICTED: 60S ribosomal protein L15-like          259   3e-84   Prunus mume [ume]
ref|XP_003635402.1|  PREDICTED: 60S ribosomal protein L15-1             259   3e-84   Vitis vinifera
ref|XP_010919627.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    258   4e-84   Elaeis guineensis
ref|XP_010933963.1|  PREDICTED: 60S ribosomal protein L15-like          258   4e-84   Elaeis guineensis
ref|NP_193405.1|  60S ribosomal protein L15-1                           258   5e-84   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193470.1|  60S ribosomal protein L15-2                           258   5e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282719.1|  hypothetical protein CARUB_v10005752mg             258   5e-84   Capsella rubella
ref|XP_002868106.1|  60S ribosomal protein L15                          258   5e-84   
ref|XP_010434676.1|  PREDICTED: 60S ribosomal protein L15-1-like        258   5e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010107162.1|  60S ribosomal protein L15                          258   6e-84   Morus notabilis
gb|KFK32179.1|  hypothetical protein AALP_AA6G207900                    258   6e-84   Arabis alpina [alpine rockcress]
ref|XP_008798983.1|  PREDICTED: 60S ribosomal protein L15-like          258   6e-84   Phoenix dactylifera
ref|XP_006837338.1|  hypothetical protein AMTR_s00111p00086580          258   8e-84   Amborella trichopoda
ref|XP_009108318.1|  PREDICTED: 60S ribosomal protein L15-1-like        258   9e-84   Brassica rapa
ref|XP_004152395.1|  PREDICTED: 60S ribosomal protein L15-like is...    258   9e-84   
ref|XP_009136839.1|  PREDICTED: 60S ribosomal protein L15-1             257   1e-83   Brassica rapa
ref|XP_009145572.1|  PREDICTED: 60S ribosomal protein L15-1             257   1e-83   Brassica rapa
emb|CAN68893.1|  hypothetical protein VITISV_004609                     257   2e-83   Vitis vinifera
ref|XP_010934657.1|  PREDICTED: 60S ribosomal protein L15-1-like        257   2e-83   Elaeis guineensis
emb|CDX90499.1|  BnaA03g42820D                                          259   2e-83   
emb|CDY60707.1|  BnaC07g50070D                                          259   2e-83   Brassica napus [oilseed rape]
emb|CDY53647.1|  BnaA08g30370D                                          258   2e-83   Brassica napus [oilseed rape]
ref|XP_008452210.1|  PREDICTED: 60S ribosomal protein L15-2-like        256   2e-83   Cucumis melo [Oriental melon]
gb|ACF88005.1|  unknown                                                 256   2e-83   Zea mays [maize]
emb|CDY54747.1|  BnaAnng13420D                                          258   3e-83   Brassica napus [oilseed rape]
ref|XP_009136806.1|  PREDICTED: 60S ribosomal protein L15-1-like        256   4e-83   Brassica rapa
ref|XP_010104882.1|  60S ribosomal protein L15                          257   5e-83   
ref|XP_008796124.1|  PREDICTED: 60S ribosomal protein L15-2             256   5e-83   Phoenix dactylifera
ref|NP_001150716.1|  60S ribosomal protein L15                          256   5e-83   
ref|XP_009352987.1|  PREDICTED: 60S ribosomal protein L15-like          256   5e-83   Pyrus x bretschneideri [bai li]
emb|CAB10520.1|  ribosomal protein                                      256   5e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008437056.1|  PREDICTED: 60S ribosomal protein L15-2 isofo...    256   5e-83   
ref|XP_002268465.1|  PREDICTED: 60S ribosomal protein L15-1-like        256   6e-83   Vitis vinifera
pdb|3J61|N  Chain N, Localization Of The Large Subunit Ribosomal ...    255   6e-83   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001050612.1|  Os03g0598800                                       255   7e-83   
ref|XP_004491938.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    256   8e-83   
emb|CBI16601.3|  unnamed protein product                                255   8e-83   Vitis vinifera
ref|XP_002460708.1|  hypothetical protein SORBIDRAFT_02g033530          255   9e-83   Sorghum bicolor [broomcorn]
ref|XP_006650289.1|  PREDICTED: 60S ribosomal protein L15-like          255   1e-82   Oryza brachyantha
emb|CDY40505.1|  BnaC01g20070D                                          259   1e-82   Brassica napus [oilseed rape]
ref|XP_006837287.1|  hypothetical protein AMTR_s00111p00023340          256   1e-82   
emb|CDY50842.1|  BnaC08g47880D                                          256   2e-82   Brassica napus [oilseed rape]
ref|XP_009406701.1|  PREDICTED: 60S ribosomal protein L15-1-like        254   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001150386.1|  60S ribosomal protein L15                          254   2e-82   
ref|NP_001148378.1|  60S ribosomal protein L15                          254   2e-82   
ref|XP_002879569.1|  60S ribosomal protein L15                          254   2e-82   Arabidopsis lyrata subsp. lyrata
gb|ACF87670.1|  unknown                                                 254   3e-82   Zea mays [maize]
ref|XP_006838929.1|  hypothetical protein AMTR_s00002p00270230          254   3e-82   Amborella trichopoda
ref|NP_001148602.1|  60S ribosomal protein L15                          254   3e-82   Zea mays [maize]
ref|XP_002461521.1|  hypothetical protein SORBIDRAFT_02g004020          253   4e-82   Sorghum bicolor [broomcorn]
ref|XP_009399011.1|  PREDICTED: 60S ribosomal protein L15-1-like        253   4e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004299420.1|  PREDICTED: 60S ribosomal protein L15-1             253   4e-82   Fragaria vesca subsp. vesca
ref|XP_006655163.1|  PREDICTED: 60S ribosomal protein L15-like          254   4e-82   
ref|XP_009418976.1|  PREDICTED: 60S ribosomal protein L15-1             253   6e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398340.1|  PREDICTED: 60S ribosomal protein L15-1-like        253   7e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007202591.1|  hypothetical protein PRUPE_ppa011597mg             252   1e-81   Prunus persica
ref|XP_004512167.1|  PREDICTED: 60S ribosomal protein L15-1-like        252   1e-81   Cicer arietinum [garbanzo]
gb|ADA67930.1|  putative 60S ribosomal protein L15                      252   2e-81   Wolffia arrhiza
ref|XP_003573847.1|  PREDICTED: 60S ribosomal protein L15-2             251   2e-81   Brachypodium distachyon [annual false brome]
ref|XP_004955579.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    251   2e-81   Setaria italica
ref|XP_009408522.1|  PREDICTED: 60S ribosomal protein L15-1-like        251   3e-81   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ95856.1|  predicted protein                                      250   6e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008360544.1|  PREDICTED: 60S ribosomal protein L15               250   6e-81   
ref|XP_004957717.1|  PREDICTED: 60S ribosomal protein L15-1-like        249   1e-80   Setaria italica
ref|XP_001764493.1|  predicted protein                                  249   1e-80   
ref|XP_003563105.1|  PREDICTED: 60S ribosomal protein L15-2             249   2e-80   Brachypodium distachyon [annual false brome]
gb|EEE63068.1|  hypothetical protein OsJ_17876                          255   2e-80   Oryza sativa Japonica Group [Japonica rice]
sp|O65050.1|RL15A_PICMA  RecName: Full=60S ribosomal protein L15-1      249   2e-80   Picea mariana [black spruce]
sp|O65082.1|RL15B_PICMA  RecName: Full=60S ribosomal protein L15-2      249   3e-80   Picea mariana [black spruce]
gb|EEC78893.1|  hypothetical protein OsI_19264                          254   4e-80   Oryza sativa Indica Group [Indian rice]
ref|XP_001753036.1|  predicted protein                                  248   5e-80   
gb|AAK67641.1|  ribosomal protein L15                                   248   6e-80   Homo sapiens [man]
ref|XP_001771165.1|  predicted protein                                  248   8e-80   
dbj|BAD22764.1|  ribosomal protein                                      247   1e-79   Bromus inermis [awnless brome grass]
ref|XP_010516773.1|  PREDICTED: 60S ribosomal protein L15-2-like        247   2e-79   
ref|XP_002961462.1|  hypothetical protein SELMODRAFT_270259             246   2e-79   Selaginella moellendorffii
ref|XP_002971348.1|  hypothetical protein SELMODRAFT_270900             246   2e-79   Selaginella moellendorffii
ref|XP_001757563.1|  predicted protein                                  245   7e-79   
ref|XP_002946380.1|  component of cytosolic 80S ribosome and 60S ...    243   5e-78   Volvox carteri f. nagariensis
ref|XP_001701780.1|  ribosomal protein L15, component of cytosoli...    241   4e-77   Chlamydomonas reinhardtii
gb|EMS52882.1|  60S ribosomal protein L15                               241   3e-76   Triticum urartu
ref|XP_010539199.1|  PREDICTED: 60S ribosomal protein L15-1-like        238   4e-76   Tarenaya hassleriana [spider flower]
ref|XP_006431497.1|  hypothetical protein CICLE_v10002413mg             238   7e-76   
gb|KDO49937.1|  hypothetical protein CISIN_1g028757mg                   237   9e-76   Citrus sinensis [apfelsine]
gb|AFK40278.1|  unknown                                                 237   2e-75   Lotus japonicus
emb|CDP10996.1|  unnamed protein product                                236   2e-75   Coffea canephora [robusta coffee]
ref|XP_008234416.1|  PREDICTED: 60S ribosomal protein L15-like          235   8e-75   Prunus mume [ume]
emb|CDP11952.1|  unnamed protein product                                233   2e-74   Coffea canephora [robusta coffee]
ref|XP_005646118.1|  ribosomal protein L15e                             233   3e-74   Coccomyxa subellipsoidea C-169
ref|XP_004955578.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    233   2e-73   
ref|XP_011031911.1|  PREDICTED: 60S ribosomal protein L15 isoform X3    230   3e-73   Populus euphratica
gb|KDO49939.1|  hypothetical protein CISIN_1g028757mg                   228   1e-72   Citrus sinensis [apfelsine]
ref|XP_005845356.1|  hypothetical protein CHLNCDRAFT_32281              229   2e-72   Chlorella variabilis
gb|KJB39740.1|  hypothetical protein B456_007G028600                    226   2e-71   Gossypium raimondii
emb|CBI25842.3|  unnamed protein product                                224   7e-71   Vitis vinifera
ref|XP_503229.1|  60S ribosomal protein L15                             224   9e-71   Yarrowia lipolytica CLIB122
ref|XP_005717822.1|  60S ribosomal protein L15                          225   1e-70   Chondrus crispus [carageen]
ref|XP_010919628.1|  PREDICTED: 60S ribosomal protein L15 isoform X2    224   1e-70   
emb|CDX76573.1|  BnaA08g08270D                                          223   3e-70   
ref|XP_004152396.1|  PREDICTED: 60S ribosomal protein L15-like is...    222   3e-70   
emb|CDY59531.1|  BnaCnng35130D                                          222   5e-70   Brassica napus [oilseed rape]
emb|CDY09632.1|  BnaC07g34290D                                          222   5e-70   Brassica napus [oilseed rape]
ref|XP_011401241.1|  60S ribosomal protein L15                          230   5e-70   Auxenochlorella protothecoides
emb|CEG01197.1|  Ribosomal protein L15e, conserved site                 222   6e-70   Ostreococcus tauri
tpg|DAA62721.1|  TPA: hypothetical protein ZEAMMB73_667917              222   6e-70   
ref|XP_004348091.1|  ribosomal protein L15                              222   7e-70   Capsaspora owczarzaki ATCC 30864
ref|XP_001416062.1|  Ribosomal protein L15, component of cytosoli...    222   8e-70   Ostreococcus lucimarinus CCE9901
gb|AAT85124.1|  putative 60s ribosomal protein L15                      221   8e-70   Oryza sativa Japonica Group [Japonica rice]
emb|CBI38664.3|  unnamed protein product                                221   1e-69   Vitis vinifera
ref|XP_005703122.1|  60S ribosomal protein L15e isoform 2               221   2e-69   Galdieria sulphuraria
gb|EMT29287.1|  60S ribosomal protein L15                               222   5e-69   
ref|XP_003056552.1|  predicted protein                                  218   2e-68   Micromonas pusilla CCMP1545
ref|XP_003382517.1|  PREDICTED: 60S ribosomal protein L15-like          218   2e-68   Amphimedon queenslandica
gb|EPE06282.1|  60s ribosomal protein l15                               218   3e-68   Ophiostoma piceae UAMH 11346
gb|KDD73446.1|  ribosomal L15                                           218   4e-68   Helicosporidium sp. ATCC 50920
gb|KIY95038.1|  60S ribosomal protein L15-1                             217   6e-68   Monoraphidium neglectum
ref|XP_001624083.1|  predicted protein                                  217   7e-68   Nematostella vectensis
gb|ERS96332.1|  60S ribosomal protein L15                               216   1e-67   Sporothrix schenckii ATCC 58251
gb|EFX04788.1|  60S ribosomal protein l15                               216   2e-67   Grosmannia clavigera kw1407
gb|ESW97334.1|  60S ribosomal protein L15-B                             216   2e-67   Ogataea parapolymorpha DL-1
gb|ACR24948.1|  ribosomal protein L15                                   216   3e-67   Lepidochitona cinerea
gb|KEQ99844.1|  hypothetical protein AUEXF2481DRAFT_25720               217   3e-67   Aureobasidium subglaciale EXF-2481
ref|XP_008713401.1|  60S ribosomal protein L15                          215   4e-67   Cyphellophora europaea CBS 101466
ref|XP_002162844.1|  PREDICTED: 60S ribosomal protein L15-like          215   4e-67   Hydra vulgaris
ref|XP_006822011.1|  PREDICTED: 60S ribosomal protein L15-like is...    215   4e-67   Saccoglossus kowalevskii
emb|CEJ94099.1|  Putative Ribosomal protein L15                         215   5e-67   Torrubiella hemipterigena
gb|AAX48848.1|  L15                                                     214   5e-67   Suberites domuncula
gb|KIE03942.1|  Ribosomal protein L15e                                  214   8e-67   Metarhizium majus ARSEF 297
ref|XP_006690758.1|  ribosomal protein L15-like protein                 214   9e-67   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_003075284.1|  RL15B_PICMA 60S ribosomal protein L15-2 (ISS)      215   9e-67   
gb|AAF67144.1|AF230646_1  large subunit ribosomal protein L15           214   1e-66   Syntrichia ruralis
ref|XP_003233932.1|  60S ribosomal protein L15                          214   1e-66   Trichophyton rubrum CBS 118892
ref|XP_003488628.1|  PREDICTED: 60S ribosomal protein L15-like          214   1e-66   
gb|KIV95599.1|  60S ribosomal protein L15                               214   1e-66   Exophiala mesophila
gb|KEF63356.1|  60S ribosomal protein L15                               214   2e-66   Exophiala aquamarina CBS 119918
gb|KEQ59346.1|  60S ribosomal protein L15                               213   2e-66   Aureobasidium melanogenum CBS 110374
gb|EMS24660.1|  60S ribosomal protein l15                               213   2e-66   Rhodotorula toruloides NP11
ref|XP_008725811.1|  60S ribosomal protein L15                          213   2e-66   Cladophialophora carrionii CBS 160.54
ref|XP_007511637.1|  60S ribosomal protein L15                          213   2e-66   Bathycoccus prasinos
ref|XP_007812013.1|  60S ribosomal protein L15                          213   2e-66   Metarhizium acridum CQMa 102
gb|EWM27504.1|  Ribosomal protein L15e                                  213   3e-66   Nannochloropsis gaditana
gb|ACU45020.1|  60s ribosomal protein L15                               213   3e-66   Pfiesteria piscicida
emb|CEI91883.1|  Putative Ribosomal protein L15                         213   4e-66   Rhizopus microsporus
gb|KID77747.1|  Ribosomal protein L15e                                  213   4e-66   Metarhizium brunneum ARSEF 3297
gb|KIN02516.1|  hypothetical protein OIDMADRAFT_18358                   213   4e-66   Oidiodendron maius Zn
ref|XP_009691154.1|  60S ribosomal protein L15                          213   4e-66   Theileria orientalis strain Shintoku
ref|XP_007925894.1|  hypothetical protein MYCFIDRAFT_58365              213   4e-66   Pseudocercospora fijiensis CIRAD86
ref|XP_007373844.1|  hypothetical protein SPAPADRAFT_59682              212   5e-66   Spathaspora passalidarum NRRL Y-27907
ref|XP_009159952.1|  60S ribosomal protein L15                          212   6e-66   Exophiala dermatitidis NIH/UT8656
gb|KHN95867.1|  Ribosomal protein L15e                                  212   6e-66   Metarhizium album ARSEF 1941
ref|XP_002545593.1|  60S ribosomal protein L15-B                        212   7e-66   Candida tropicalis MYA-3404
gb|KIX01331.1|  60S ribosomal protein L15                               212   7e-66   Rhinocladiella mackenziei CBS 650.93
ref|XP_007762548.1|  ribosomal protein L15e                             212   7e-66   Coniophora puteana RWD-64-598 SS2
gb|KFY50714.1|  hypothetical protein V496_09238                         213   8e-66   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|EIE79210.1|  60S ribosomal protein L15                               212   8e-66   Rhizopus delemar RA 99-880
ref|XP_007671745.1|  hypothetical protein BAUCODRAFT_566278             211   1e-65   Baudoinia panamericana UAMH 10762
gb|EFZ14326.1|  hypothetical protein SINV_15101                         212   1e-65   
gb|EQL00837.1|  Ribosomal protein L15e                                  211   1e-65   Ophiocordyceps sinensis CO18
ref|XP_009226880.1|  60S ribosomal protein L15                          211   1e-65   Gaeumannomyces tritici R3-111a-1
gb|KIW41910.1|  60S ribosomal protein L15                               213   1e-65   Exophiala oligosperma
ref|XP_008558014.1|  PREDICTED: 60S ribosomal protein L15               211   1e-65   Microplitis demolitor
gb|KIX93106.1|  60S ribosomal protein L15                               211   1e-65   Fonsecaea multimorphosa CBS 102226
ref|XP_007759046.1|  60S ribosomal protein L15                          211   1e-65   Cladophialophora yegresii CBS 114405
emb|CDH60822.1|  60s ribosomal protein l15                              211   1e-65   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_957199.1|  60S ribosomal protein L15                             211   2e-65   Neurospora crassa OR74A
gb|KIW07591.1|  60S ribosomal protein L15                               211   2e-65   Verruconis gallopava
ref|XP_001265199.1|  60S ribosomal protein L15                          211   2e-65   Aspergillus fischeri NRRL 181
gb|KIK92970.1|  hypothetical protein PAXRUDRAFT_829457                  211   2e-65   Paxillus rubicundulus Ve08.2h10
ref|XP_006965992.1|  60s ribosomal protein L152/L15B                    211   2e-65   Trichoderma reesei QM6a
gb|KIW20891.1|  60S ribosomal protein L15                               211   2e-65   Exophiala spinifera
emb|CCA75151.1|  probable RPL15A 60S large subunit ribosomal prot...    211   2e-65   Serendipita indica DSM 11827
ref|XP_455872.1|  60S ribosomal protein L15                             211   2e-65   Kluyveromyces lactis
emb|CEG70134.1|  Putative Ribosomal protein L15                         211   2e-65   Rhizopus microsporus
gb|KGQ83010.1|  60S ribosomal protein L15-A                             211   3e-65   Candida albicans P37005
ref|XP_007804051.1|  60S ribosomal protein L15                          211   3e-65   Endocarpon pusillum Z07020
gb|EPQ66314.1|  Protein component of the large (60S) ribosomal su...    210   3e-65   Blumeria graminis f. sp. tritici 96224
gb|ESZ93952.1|  60S ribosomal protein L15                               210   3e-65   Sclerotinia borealis F-4128
gb|KIM27529.1|  hypothetical protein M408DRAFT_329974                   210   3e-65   Serendipita vermifera MAFF 305830
ref|XP_762879.1|  60S ribosomal protein L15                             210   3e-65   Theileria parva strain Muguga
ref|XP_011309078.1|  PREDICTED: 60S ribosomal protein L15               210   3e-65   Fopius arisanus
ref|XP_006678614.1|  hypothetical protein BATDEDRAFT_36929              210   3e-65   Batrachochytrium dendrobatidis JAM81
gb|EJU02043.1|  ribosomal protein L15e                                  210   3e-65   Dacryopinax primogenitus
emb|CDM26463.1|  60S ribosomal protein L15                              210   3e-65   Penicillium roqueforti FM164
ref|XP_007844218.1|  60s ribosomal protein l15                          210   4e-65   
gb|EPS27962.1|  hypothetical protein PDE_02907                          210   4e-65   Penicillium oxalicum 114-2
gb|EHK15888.1|  hypothetical protein TRIVIDRAFT_217112                  210   4e-65   Trichoderma virens Gv29-8
ref|XP_717445.1|  likely cytosolic ribosomal protein L15                210   4e-65   
gb|EOA94531.1|  60S ribosomal protein L15                               210   4e-65   Anas platyrhynchos [duck]
emb|CDH55125.1|  60s ribosomal protein l15                              210   4e-65   Lichtheimia corymbifera JMRC:FSU:9682
gb|KIW77490.1|  60S ribosomal protein L15                               210   4e-65   Fonsecaea pedrosoi CBS 271.37
ref|XP_007864396.1|  60S ribosomal protein L15                          210   4e-65   Gloeophyllum trabeum ATCC 11539
ref|XP_004377436.1|  PREDICTED: 60S ribosomal protein L15 isoform 1     210   5e-65   
ref|XP_001545571.1|  60S ribosomal protein L15                          210   5e-65   
gb|ELR05722.1|  60S ribosomal protein L15                               210   5e-65   Pseudogymnoascus destructans 20631-21
gb|AAS59857.1|  ribosomal protein L15                                   210   5e-65   Acipenser sinensis
ref|XP_001245521.1|  60S ribosomal protein L15                          210   5e-65   Coccidioides immitis RS
ref|NP_001080766.1|  ribosomal protein L15                              210   5e-65   Xenopus laevis [clawed frog]
ref|XP_007589065.1|  putative 60s ribosomal protein l15 protein         209   5e-65   
emb|CDO96181.1|  unnamed protein product                                209   6e-65   Kluyveromyces dobzhanskii CBS 2104
ref|XP_003415776.1|  PREDICTED: 60S ribosomal protein L15               209   6e-65   Loxodonta africana [African bush elephant]
gb|EJT43834.1|  hypothetical protein SKUD_204406                        209   6e-65   Saccharomyces kudriavzevii IFO 1802
gb|EJT43462.1|  RPL15B-like protein                                     209   6e-65   Saccharomyces kudriavzevii IFO 1802
ref|XP_002797110.1|  60S ribosomal protein L15                          209   6e-65   Paracoccidioides lutzii Pb01
ref|XP_001909718.1|  hypothetical protein                               209   7e-65   Podospora anserina S mat+
gb|KDE04267.1|  60S ribosomal protein L15-B                             209   7e-65   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_002286429.1|  RL15, ribosomal protein 15 60S large ribosom...    209   7e-65   Thalassiosira pseudonana CCMP1335
ref|XP_002583622.1|  60S ribosomal protein L15                          209   7e-65   
emb|CCF41498.1|  60S ribosomal protein L15                              209   7e-65   
emb|CDO71546.1|  hypothetical protein BN946_scf184911.g16               209   8e-65   
gb|KFY89477.1|  hypothetical protein V500_05675                         209   8e-65   
ref|NP_001003447.1|  60S ribosomal protein L15                          209   8e-65   
ref|XP_007737355.1|  60S ribosomal protein L15                          209   8e-65   
gb|ENH84342.1|  60s ribosomal protein l15                               209   8e-65   
sp|Q7T3N1.3|RL15_MYLPI  RecName: Full=60S ribosomal protein L15         209   8e-65   
gb|KCW90850.1|  hypothetical protein EUGRSUZ_A02903                     208   9e-65   
gb|EMF14509.1|  ribosomal protein L15e                                  209   9e-65   
gb|KIM66174.1|  hypothetical protein SCLCIDRAFT_1211398                 209   9e-65   
ref|XP_003350788.1|  60S ribosomal protein L15                          209   9e-65   
gb|ADO28804.1|  60S ribosomal protein l15                               209   9e-65   
ref|XP_010986099.1|  PREDICTED: 60S ribosomal protein L15               209   9e-65   
gb|EEQ87750.1|  60S ribosomal protein L15                               209   1e-64   
gb|EME46361.1|  hypothetical protein DOTSEDRAFT_70383                   209   1e-64   
ref|XP_001820015.1|  60S ribosomal protein L15                          209   1e-64   
ref|XP_001541513.1|  60S ribosomal protein L15                          209   1e-64   
ref|XP_007788991.1|  putative 60s ribosomal protein l15 protein         209   1e-64   
ref|XP_002623870.1|  60S ribosomal protein L15                          209   1e-64   
ref|XP_007505229.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    209   1e-64   
dbj|BAO40104.1|  60S ribosomal protein L15-B                            209   1e-64   
gb|EHH51712.1|  hypothetical protein EGM_11144                          207   1e-64   
gb|AJS80338.1|  Rpl15bp                                                 209   1e-64   
ref|XP_001644954.1|  hypothetical protein Kpol_1025p16                  209   1e-64   
ref|XP_007741637.1|  60S ribosomal protein L15                          209   1e-64   
gb|KFZ12787.1|  hypothetical protein V502_06922                         217   1e-64   
dbj|GAM89956.1|  hypothetical protein ANO11243_079960                   209   1e-64   
ref|XP_008596519.1|  60S ribosomal protein L15                          209   1e-64   
ref|NP_001187212.1|  60S ribosomal protein L15                          209   1e-64   
ref|XP_007068583.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    209   1e-64   
ref|XP_004198963.1|  Piso0_002360                                       209   1e-64   
ref|XP_007835687.1|  60S ribosomal protein L15                          209   1e-64   
ref|XP_011414691.1|  PREDICTED: 60S ribosomal protein L15-like          209   1e-64   
ref|XP_003709740.1|  60S ribosomal protein L15                          209   1e-64   
ref|XP_396588.2|  PREDICTED: 60S ribosomal protein L15                  209   2e-64   
gb|AAX62392.1|  ribosomal protein L15                                   209   2e-64   
ref|XP_007915208.1|  putative 60s ribosomal protein l15 protein         208   2e-64   
ref|XP_001212942.1|  60S ribosomal protein L15                          208   2e-64   
emb|CDH59121.1|  60s ribosomal protein l15                              209   2e-64   
ref|XP_007421748.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    208   2e-64   
emb|CAH91644.1|  hypothetical protein                                   208   2e-64   
gb|KGK38943.1|  hypothetical protein JL09_g1954                         208   2e-64   
gb|EHN00844.1|  Rpl15bp                                                 208   2e-64   
gb|KEY77864.1|  60S ribosomal protein L15                               208   2e-64   
ref|XP_007595397.1|  ribosomal L15                                      208   2e-64   
ref|XP_003957065.1|  hypothetical protein KAFR_0D02820                  208   2e-64   
emb|CAJ82575.1|  ribosomal protein L15                                  208   2e-64   
ref|XP_005029295.1|  PREDICTED: 60S ribosomal protein L15               208   2e-64   
ref|XP_003706183.1|  PREDICTED: 60S ribosomal protein L15-like          208   2e-64   
ref|XP_003869213.1|  Rpl15a ribosomal protein                           208   2e-64   
ref|XP_002907494.1|  60S ribosomal protein L15-1                        208   2e-64   
gb|KFH71724.1|  60S ribosomal protein L15                               208   2e-64   
ref|XP_009502210.1|  PREDICTED: 60S ribosomal protein L15               208   2e-64   
ref|XP_004588348.1|  PREDICTED: 60S ribosomal protein L15               208   2e-64   
ref|XP_002150249.1|  60S ribosomal protein L15                          208   2e-64   
ref|XP_003884098.1|  hypothetical protein NCLIV_045010                  208   2e-64   
ref|NP_001292094.1|  60S ribosomal protein L15                          208   2e-64   
emb|CEP13977.1|  hypothetical protein                                   208   2e-64   
emb|CCA20982.1|  60S ribosomal protein L151 putative                    208   2e-64   
ref|XP_008897085.1|  60S ribosomal protein                              208   2e-64   
ref|XP_011148451.1|  PREDICTED: 60S ribosomal protein L15               208   2e-64   
gb|ERE87094.1|  60S ribosomal protein L15-like protein                  208   2e-64   
ref|XP_001525424.1|  60S ribosomal protein L15-B                        208   2e-64   
ref|XP_011054650.1|  PREDICTED: 60S ribosomal protein L15               208   2e-64   
gb|KFO70740.1|  60S ribosomal protein L15                               208   2e-64   
tpg|DAA32565.1|  TPA: ribosomal protein L15-like                        208   2e-64   
ref|XP_006986589.1|  PREDICTED: 60S ribosomal protein L15-like          208   2e-64   
emb|CCX31468.1|  Similar to 60S ribosomal protein L15; acc. no. Q...    208   2e-64   
gb|AAH14837.1|  Ribosomal protein L15                                   208   2e-64   
tpg|DAA16199.1|  TPA: ribosomal protein L15-like                        208   2e-64   
ref|XP_006635829.1|  PREDICTED: 60S ribosomal protein L15-like          208   2e-64   
dbj|BAB27107.1|  unnamed protein product                                208   2e-64   
ref|XP_002616462.1|  conserved hypothetical protein                     208   2e-64   
gb|EKG10086.1|  Ribosomal protein L15e                                  208   2e-64   
ref|NP_985761.1|  60S ribosomal protein L15                             208   3e-64   
ref|XP_002759698.1|  PREDICTED: 60S ribosomal protein L15               208   3e-64   
ref|NP_001266930.1|  60S ribosomal protein L15                          208   3e-64   
ref|XP_002484013.1|  60S ribosomal protein L15                          208   3e-64   
ref|XP_005534852.1|  60S ribosomal protein L15                          208   3e-64   
ref|XP_002366469.1|  ribosomal protein L15, putative                    208   3e-64   
gb|KIW51029.1|  60S ribosomal protein L15                               208   3e-64   
ref|XP_011104444.1|  rpl15ap                                            208   3e-64   
dbj|GAA24916.1|  K7_Rpl15ap                                             208   3e-64   
ref|XP_003657786.1|  60S ribosomal protein L15                          208   3e-64   
ref|XP_003686547.1|  60S ribosomal protein L15                          208   3e-64   
gb|AAX36167.1|  ribosomal protein L15                                   208   3e-64   
gb|ACD65166.1|  putative 60S ribosomal protein RPL15                    208   3e-64   
gb|EHN01315.1|  Rpl15bp                                                 208   3e-64   
ref|XP_011123288.1|  hypothetical protein AOL_s00081g168                208   3e-64   
gb|AAV38477.1|  ribosomal protein L15                                   208   3e-64   
ref|NP_079862.1|  60S ribosomal protein L15                             208   3e-64   
gb|EFN78553.1|  60S ribosomal protein L15                               208   3e-64   
gb|KIK28524.1|  hypothetical protein PISMIDRAFT_673552                  207   3e-64   
gb|EFQ32205.1|  ribosomal L15                                           207   3e-64   
gb|KIO08255.1|  hypothetical protein M404DRAFT_997181                   207   3e-64   
ref|XP_003856171.1|  60S ribosomal protein L15                          207   3e-64   
gb|KEY67005.1|  hypothetical protein S7711_05126                        207   3e-64   
ref|XP_003666937.1|  hypothetical protein MYCTH_2312102                 207   3e-64   
gb|AAX43023.1|  ribosomal protein L15                                   207   3e-64   
sp|Q7T3N7.3|RL15_CYPCA  RecName: Full=60S ribosomal protein L15         207   3e-64   
dbj|GAM38142.1|  60S ribosomal protein                                  207   3e-64   
ref|XP_008831372.1|  PREDICTED: 60S ribosomal protein L15               207   3e-64   
ref|XP_008080630.1|  Ribosomal proteins S24e, L23 and L15e              207   3e-64   
ref|XP_011102974.1|  rpl15bp                                            207   4e-64   
ref|XP_003647297.1|  hypothetical protein Ecym_6084                     207   4e-64   
ref|XP_007344080.1|  60S ribosomal protein L15                          207   4e-64   
gb|KIM85231.1|  hypothetical protein PILCRDRAFT_817231                  207   4e-64   
ref|XP_658049.1|  RL15_ASPNG 60S RIBOSOMAL PROTEIN L15                  207   4e-64   
gb|AJS74671.1|  Rpl15bp                                                 207   4e-64   
emb|CCE42581.1|  hypothetical protein CPAR2_202240                      207   4e-64   
ref|XP_003226267.1|  PREDICTED: 60S ribosomal protein L15               207   4e-64   
ref|NP_013840.1|  ribosomal 60S subunit protein L15B                    207   4e-64   
ref|XP_007378639.1|  60S ribosomal protein L15                          207   4e-64   
gb|AJS78588.1|  Rpl15bp                                                 207   4e-64   
sp|Q7T3P0.3|RL15_HYPNO  RecName: Full=60S ribosomal protein L15         207   4e-64   
gb|EGA57755.1|  Rpl15ap                                                 207   4e-64   
gb|AJS95152.1|  Rpl15bp                                                 207   4e-64   
gb|KFY44566.1|  hypothetical protein V494_01413                         216   4e-64   
ref|XP_007359911.1|  60S ribosomal protein L15                          207   4e-64   
gb|EWG89405.1|  Rpl15bp                                                 207   4e-64   
gb|EWG94065.1|  Rpl15bp                                                 207   5e-64   
ref|XP_011499448.1|  PREDICTED: 60S ribosomal protein L15               207   5e-64   
ref|XP_011227834.1|  PREDICTED: 60S ribosomal protein L15               207   5e-64   
ref|XP_007298295.1|  60S ribosomal protein L15                          207   5e-64   
gb|EMT18644.1|  60S ribosomal protein L15                               206   6e-64   
ref|XP_009937095.1|  PREDICTED: 60S ribosomal protein L15               207   6e-64   
ref|XP_009517997.1|  hypothetical protein PHYSODRAFT_353776             207   6e-64   
ref|XP_003837801.1|  hypothetical protein LEMA_P121210.1                208   6e-64   
ref|XP_003678734.1|  60S ribosomal protein L15                          207   6e-64   
gb|EWG84044.1|  Rpl15bp                                                 207   6e-64   
sp|P61369.2|RL15_SILAS  RecName: Full=60S ribosomal protein L15         207   6e-64   
ref|XP_003394894.1|  PREDICTED: 60S ribosomal protein L15-like is...    207   7e-64   
ref|XP_001225510.1|  60S ribosomal protein L15                          207   7e-64   
gb|EPZ35492.1|  60S ribosomal protein L15                               207   7e-64   
ref|XP_444915.1|  60S ribosomal protein L15                             207   7e-64   
ref|XP_625397.1|  60S ribosomal protein L15                             207   7e-64   
emb|CEP61029.1|  LALA0S02e05138g1_1                                     207   7e-64   
gb|KFR14077.1|  60S ribosomal protein L15                               207   7e-64   
ref|XP_001388776.1|  60S ribosomal protein L15                          207   7e-64   
emb|CCO29354.1|  60S ribosomal protein L15                              207   7e-64   
ref|XP_001600472.1|  PREDICTED: 60S ribosomal protein L15               207   7e-64   
ref|XP_003673359.1|  hypothetical protein NCAS_0A04140                  209   7e-64   
ref|XP_006021253.1|  PREDICTED: 60S ribosomal protein L15               207   7e-64   
ref|XP_002561234.1|  Pc16g09160                                         207   7e-64   
emb|CCE30070.1|  probable ribosomal protein L15.e.B, cytosolic          215   7e-64   
gb|KIK63705.1|  hypothetical protein GYMLUDRAFT_40770                   207   8e-64   
emb|CCD34791.1|  hypothetical protein BofuT4_P098500.1                  209   8e-64   
ref|XP_006005298.1|  PREDICTED: 60S ribosomal protein L15               207   8e-64   
ref|XP_007724541.1|  60S ribosomal protein L15                          207   8e-64   
gb|KEZ43818.1|  hypothetical protein SAPIO_CDS3973                      207   8e-64   
sp|Q7T2N4.3|RL15_SILME  RecName: Full=60S ribosomal protein L15         207   8e-64   
dbj|BAE31437.1|  unnamed protein product                                207   8e-64   
gb|AAG44837.1|  60S ribosomal protein L15                               207   8e-64   
ref|XP_003936085.1|  PREDICTED: 60S ribosomal protein L15               207   9e-64   
ref|XP_004634243.1|  PREDICTED: 60S ribosomal protein L15               206   9e-64   
gb|EPB90299.1|  60S ribosomal protein L15                               206   1e-63   
ref|NP_001232361.1|  putative 60S ribosomal protein L10                 206   1e-63   
gb|EGA77362.1|  Rpl15bp                                                 206   1e-63   
ref|XP_005040971.1|  PREDICTED: 60S ribosomal protein L15               206   1e-63   
ref|XP_008020295.1|  hypothetical protein SETTUDRAFT_40911              206   1e-63   
ref|XP_006810809.1|  PREDICTED: 60S ribosomal protein L15-like          206   1e-63   
emb|CCK68268.1|  hypothetical protein KNAG_0A06060                      206   1e-63   
gb|EPB89957.1|  60S ribosomal protein L15                               206   1e-63   
ref|XP_003322415.1|  60S ribosomal protein L15                          206   1e-63   
ref|XP_009887238.1|  PREDICTED: 60S ribosomal protein L15               206   1e-63   
ref|XP_011260293.1|  PREDICTED: 60S ribosomal protein L15               207   1e-63   
gb|AJS76851.1|  Rpl15bp                                                 206   1e-63   
ref|XP_002553867.1|  60S ribosomal protein L15                          206   1e-63   
gb|KFO06064.1|  60S ribosomal protein L15                               206   1e-63   
ref|XP_004561077.1|  PREDICTED: 60S ribosomal protein L15-like          206   1e-63   
ref|XP_003455275.1|  PREDICTED: 60S ribosomal protein L15-like is...    206   1e-63   
ref|XP_007414800.1|  hypothetical protein MELLADRAFT_91790              206   1e-63   
gb|KGL96424.1|  60S ribosomal protein L15                               206   1e-63   
gb|KFM13801.1|  60S ribosomal protein L15                               206   1e-63   
gb|AJS94717.1|  Rpl15bp                                                 206   1e-63   
gb|ETE59074.1|  60S ribosomal protein L15                               206   1e-63   
sp|P61368.2|RL15_HYDVU  RecName: Full=60S ribosomal protein L15         206   1e-63   
gb|KFY33682.1|  hypothetical protein V495_08272                         214   1e-63   
ref|XP_003670245.1|  ribosomal protein L15                              206   1e-63   
gb|KFX94172.1|  hypothetical protein O988_06437                         214   1e-63   
gb|KIO23924.1|  hypothetical protein M407DRAFT_244610                   206   1e-63   
gb|KFA61144.1|  hypothetical protein S40285_02203                       206   1e-63   
dbj|BAB79461.1|  ribosomal protein L15                                  206   1e-63   
gb|KIW64984.1|  60S ribosomal protein L15                               216   1e-63   
ref|XP_007872719.1|  ribosomal L15                                      206   1e-63   
gb|EZF35745.1|  60S ribosomal protein L15                               208   2e-63   
gb|AJS96882.1|  Rpl15bp                                                 206   2e-63   
ref|XP_461011.1|  60S ribosomal protein L15                             206   2e-63   
gb|KDQ57849.1|  hypothetical protein JAAARDRAFT_35542                   206   2e-63   
ref|NP_013129.1|  ribosomal 60S subunit protein L15A                    206   2e-63   
ref|XP_004991174.1|  ribosomal protein L15                              206   2e-63   
ref|XP_006670037.1|  60S ribosomal protein L15                          206   2e-63   
gb|EWG94650.1|  Rpl15ap                                                 205   2e-63   
gb|KIV77401.1|  60S ribosomal protein L15                               214   2e-63   
ref|XP_003281126.1|  PREDICTED: 60S ribosomal protein L15-like is...    206   2e-63   
ref|XP_003296271.1|  60S ribosomal protein L15                          207   2e-63   
emb|CAG00252.1|  unnamed protein product                                206   2e-63   
ref|XP_001269695.1|  60S ribosomal protein L15                          206   2e-63   
ref|XP_001386507.1|  60S ribosomal protein L15                          206   2e-63   
ref|NP_001011478.1|  ribosomal protein L15                              206   2e-63   
gb|AAX08723.1|  ribosomal protein L15                                   206   2e-63   
sp|Q7T3N4.3|RL15_MEGAM  RecName: Full=60S ribosomal protein L15         206   2e-63   
ref|XP_003969112.1|  PREDICTED: 60S ribosomal protein L15-like          206   2e-63   
ref|XP_004832605.1|  60S ribosomal protein L15, putative                206   2e-63   
gb|KFH46732.1|  60S ribosomal protein-like protein                      206   2e-63   
ref|XP_006686733.1|  hypothetical protein CANTEDRAFT_114246             206   2e-63   
gb|KFY08345.1|  hypothetical protein V492_06315                         213   2e-63   
ref|XP_001873807.1|  60S ribosomal protein L15                          205   3e-63   
sp|P61367.2|RL15_EPICO  RecName: Full=60S ribosomal protein L15         205   3e-63   
gb|ACO09170.1|  60S ribosomal protein L15                               205   3e-63   
ref|XP_002598589.1|  hypothetical protein BRAFLDRAFT_113717             205   3e-63   
gb|KIJ68425.1|  hypothetical protein HYDPIDRAFT_146507                  205   3e-63   
gb|KIH94692.1|  large subunit ribosomal protein L15e                    205   3e-63   
ref|XP_007296945.1|  60S ribosomal protein L15                          205   3e-63   
gb|EGA61325.1|  Rpl15ap                                                 205   3e-63   
ref|XP_010871756.1|  PREDICTED: 60S ribosomal protein L15               205   4e-63   
ref|XP_001484435.1|  60S ribosomal protein L15-A                        205   4e-63   
gb|KDB17596.1|  60S ribosomal protein L15                               213   5e-63   
ref|XP_002836891.1|  60S ribosomal protein L15                          204   5e-63   
gb|EUC65212.1|  60S ribosomal protein L15                               204   6e-63   



>ref|XP_004241917.1| PREDICTED: 60S ribosomal protein L15 [Solanum lycopersicum]
 ref|XP_006355022.1| PREDICTED: 60S ribosomal protein L15-like [Solanum tuberosum]
 ref|XP_006356521.1| PREDICTED: 60S ribosomal protein L15 [Solanum tuberosum]
Length=204

 Score =   274 bits (700),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 154/159 (97%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDQAHAAIRNDPRINWICNPVHKHR  159



>ref|XP_004242022.1| PREDICTED: 60S ribosomal protein L15 [Solanum lycopersicum]
 ref|XP_006363900.1| PREDICTED: 60S ribosomal protein L15-like [Solanum tuberosum]
Length=204

 Score =   273 bits (698),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 152/159 (96%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVIL+D+AHAAIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILIDSAHAAIRNDPRINWICNPVHKHR  159



>ref|XP_004236901.1| PREDICTED: 60S ribosomal protein L15-like [Solanum lycopersicum]
Length=204

 Score =   273 bits (697),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/159 (96%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AHA IRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDQAHAGIRNDPRINWICNPVHKHR  159



>ref|XP_009606590.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana tomentosiformis]
 ref|XP_009601449.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana tomentosiformis]
 ref|XP_009780055.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana sylvestris]
Length=204

 Score =   272 bits (695),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 154/159 (97%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDQAHAAIRNDPRINWICNPVHKHR  159



>ref|XP_009796395.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   272 bits (695),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 154/159 (97%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDQAHAAIRNDPRINWICNPVHKHR  159



>ref|XP_009764605.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   271 bits (694),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/159 (96%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVIL+D AHAA+RNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILIDAAHAAVRNDPRINWICNPVHKHR  159



>sp|O82528.1|RL15_PETHY RecName: Full=60S ribosomal protein L15 [Petunia x hybrida]
 gb|AAD13389.1| ribosomal protein L15 [Petunia x hybrida]
Length=204

 Score =   271 bits (694),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 154/159 (97%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRTKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDQAHAAIRNDPRINWICNPVHKHR  159



>ref|XP_009607935.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana tomentosiformis]
Length=204

 Score =   271 bits (692),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 153/159 (96%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+EVILVD AHAAIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYYEVILVDAAHAAIRNDPRINWICNPVHKHR  159



>ref|XP_009618098.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana tomentosiformis]
Length=204

 Score =   270 bits (690),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 151/159 (95%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+EVIL+D AHAA+RNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYYEVILIDAAHAAVRNDPRINWICNPVHKHR  159



>ref|XP_009768655.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   270 bits (690),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/159 (96%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDAAHAAIRNDPRINWICNPVHKHR  159



>ref|XP_008369443.1| PREDICTED: 60S ribosomal protein L15-1 [Malus domestica]
 ref|XP_008363794.1| PREDICTED: 60S ribosomal protein L15-1 [Malus domestica]
Length=236

 Score =   270 bits (690),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  21   PEPKNFSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKAR  200
            P      S  AMGAY YVSE+WRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKAR
Sbjct  22   PCASQLISEPAMGAYKYVSEIWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKAR  81

Query  201  RLGYKAKQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRK  380
            RLGYKAKQGYVVYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRK
Sbjct  82   RLGYKAKQGYVVYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRK  141

Query  381  LGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            LGGLRVLNSYW+NEDSTYKYFEVI+VD AH AIRNDPRINWLCNPVHKHR
Sbjct  142  LGGLRVLNSYWLNEDSTYKYFEVIMVDVAHNAIRNDPRINWLCNPVHKHR  191



>ref|XP_006477158.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis]
 gb|KDO61391.1| hypothetical protein CISIN_1g028730mg [Citrus sinensis]
Length=204

 Score =   268 bits (686),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 154/159 (97%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYT+VSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHR  159



>gb|EYU24942.1| hypothetical protein MIMGU_mgv1a013374mg [Erythranthe guttata]
Length=222

 Score =   269 bits (687),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = +3

Query  39   SSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKA  218
            ++ T MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT PTRPDKARRLGYKA
Sbjct  14   AAATVMGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKA  73

Query  219  KQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  398
            KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRV
Sbjct  74   KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRV  133

Query  399  LNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            LNSYWINEDSTYKYFEVIL+D AH  +RNDPRINW+CNPVHKHR
Sbjct  134  LNSYWINEDSTYKYFEVILIDPAHTTVRNDPRINWICNPVHKHR  177



>ref|XP_009334550.1| PREDICTED: 60S ribosomal protein L15-1 [Pyrus x bretschneideri]
 ref|XP_009334556.1| PREDICTED: 60S ribosomal protein L15-1 [Pyrus x bretschneideri]
Length=235

 Score =   269 bits (688),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  21   PEPKNFSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKAR  200
            P      S  AMGAY YVSE+WRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKAR
Sbjct  21   PCASQLISDPAMGAYKYVSEIWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKAR  80

Query  201  RLGYKAKQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRK  380
            RLGYKAKQGYVVYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRK
Sbjct  81   RLGYKAKQGYVVYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRK  140

Query  381  LGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            LGGLRVLNSYW+NEDSTYKYFEVI+VD AH AIRNDPRINWLCNPVHKHR
Sbjct  141  LGGLRVLNSYWLNEDSTYKYFEVIMVDVAHNAIRNDPRINWLCNPVHKHR  190



>ref|XP_007157273.1| hypothetical protein PHAVU_002G057000g [Phaseolus vulgaris]
 gb|ESW29267.1| hypothetical protein PHAVU_002G057000g [Phaseolus vulgaris]
Length=204

 Score =   268 bits (685),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 152/159 (96%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEV+LVD AHAAIRNDPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEVVLVDVAHAAIRNDPRINWLCNPVHKHR  159



>gb|EYU43197.1| hypothetical protein MIMGU_mgv1a012815mg [Erythranthe guttata]
Length=239

 Score =   269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = +3

Query  39   SSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKA  218
            ++ T MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT PTRPDKARRLGYKA
Sbjct  31   AAATVMGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKA  90

Query  219  KQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  398
            KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRV
Sbjct  91   KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRV  150

Query  399  LNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            LNSYWINEDSTYKYFEVILVD AH  +RNDPRINW+CNPVHKHR
Sbjct  151  LNSYWINEDSTYKYFEVILVDPAHTTVRNDPRINWICNPVHKHR  194



>ref|XP_011069801.1| PREDICTED: 60S ribosomal protein L15 [Sesamum indicum]
Length=204

 Score =   267 bits (683),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVIL+D AHA +RNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILIDPAHATVRNDPRINWICNPVHKHR  159



>ref|XP_007209614.1| hypothetical protein PRUPE_ppa011603mg [Prunus persica]
 ref|XP_008238447.1| PREDICTED: 60S ribosomal protein L15 [Prunus mume]
 gb|EMJ10813.1| hypothetical protein PRUPE_ppa011603mg [Prunus persica]
Length=204

 Score =   266 bits (681),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 153/159 (96%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSE+WRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSEIWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHR  159



>ref|XP_011076388.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
 ref|XP_011076389.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   266 bits (681),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+EVIL+D AHA +RNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYYEVILIDPAHATVRNDPRINWICNPVHKHR  159



>ref|XP_010529971.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
 ref|XP_010529975.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
Length=204

 Score =   266 bits (680),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+EVILVDTAH+AIRNDPR+NW+CNPVHKHR
Sbjct  121  INEDSTYKYYEVILVDTAHSAIRNDPRVNWICNPVHKHR  159



>gb|AGL08210.1| 60S ribosomal protein L15 [Arachis hypogaea]
 gb|AGL08221.1| 60S ribosomal protein L15 [Arachis hypogaea]
Length=204

 Score =   266 bits (679),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEE+AGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEEKAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFE+I+VD AH AIRNDPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEIIMVDVAHTAIRNDPRINWLCNPVHKHR  159



>ref|XP_002304285.2| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_006376227.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011031910.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Populus euphratica]
 gb|ABK93503.1| unknown [Populus trichocarpa]
 gb|ERP54024.1| 60S ribosomal protein L15 [Populus trichocarpa]
 gb|EEE79264.2| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   266 bits (679),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 153/159 (96%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHR  159



>gb|AFK46983.1| unknown [Lotus japonicus]
Length=204

 Score =   265 bits (678),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+ILVD AH AIRNDPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYYEIILVDVAHTAIRNDPRINWLCNPVHKHR  159



>ref|XP_007155679.1| hypothetical protein PHAVU_003G222000g [Phaseolus vulgaris]
 gb|ESW27673.1| hypothetical protein PHAVU_003G222000g [Phaseolus vulgaris]
Length=204

 Score =   265 bits (677),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSV+EERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVSEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEV+LVD AH+A+RNDPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEVVLVDVAHSAVRNDPRINWLCNPVHKHR  159



>ref|XP_010667037.1| PREDICTED: 60S ribosomal protein L15-1 [Beta vulgaris subsp. 
vulgaris]
Length=204

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWR+KQSDVMRF+LRVRCWEYRQLPSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVLRVRCWEYRQLPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEVILVDTAH A+RN+PRINW+CNPVHKHR
Sbjct  121  LNEDSTYKYFEVILVDTAHNAVRNNPRINWICNPVHKHR  159



>ref|XP_006369001.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011001458.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
 gb|ABK93954.1| unknown [Populus trichocarpa]
 gb|ERP65570.1| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/159 (96%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYR+RVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHR  159



>ref|XP_011017435.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
Length=228

 Score =   265 bits (677),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = +3

Query  39   SSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKA  218
            S  T MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKA
Sbjct  20   SRATTMGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKA  79

Query  219  KQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  398
            KQGYVVYR+RVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+V
Sbjct  80   KQGYVVYRIRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKV  139

Query  399  LNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            LNSYWINEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHR
Sbjct  140  LNSYWINEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHR  183



>ref|XP_011031909.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Populus euphratica]
Length=206

 Score =   264 bits (674),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 152/159 (96%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            +GAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  3    IGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  62

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  63   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  122

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHR
Sbjct  123  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHR  161



>ref|XP_010539086.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=204

 Score =   264 bits (674),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYR+RV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRIRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+EVILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYYEVILVDPAHKAVRNDPRINWICNPVHKHR  159



>ref|XP_006490145.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis]
 gb|KDO49938.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=204

 Score =   264 bits (674),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 151/159 (95%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHR
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHR  159



>gb|KHG00889.1| 60S ribosomal L15 [Gossypium arboreum]
 gb|KJB40093.1| hypothetical protein B456_007G046500 [Gossypium raimondii]
Length=204

 Score =   264 bits (674),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 151/159 (95%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVDTAH AIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDTAHNAIRNDPRINWICNPVHKHR  159



>ref|XP_010540825.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
 ref|XP_010542214.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
Length=204

 Score =   264 bits (674),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYR+RV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRIRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+EVILVD AH A+RNDPR+NW+CNPVHKHR
Sbjct  121  INEDSTYKYYEVILVDVAHKAVRNDPRMNWICNPVHKHR  159



>ref|XP_002530661.1| ribosomal protein L15, putative [Ricinus communis]
 gb|EEF31730.1| ribosomal protein L15, putative [Ricinus communis]
Length=204

 Score =   263 bits (673),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/159 (95%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARR+GYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRMGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINWLC PVHKHR
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCKPVHKHR  159



>ref|XP_011076387.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   263 bits (672),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHSTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+EVILVD AHA +RNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYYEVILVDPAHATVRNDPRINWICNPVHKHR  159



>ref|XP_011080625.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   263 bits (672),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHSTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVIL+D AH  IRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILIDPAHTTIRNDPRINWICNPVHKHR  159



>ref|XP_002301250.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_006375250.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011033124.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
 gb|EEE80523.1| 60S ribosomal protein L15 [Populus trichocarpa]
 gb|ERP53047.1| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   263 bits (672),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYR+RVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICNPVHKHR  159



>ref|XP_010538411.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=204

 Score =   263 bits (672),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYR+RV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRIRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+EVILVD AH A+RNDPR+NW+CNPVHKHR
Sbjct  121  INEDSTYKYYEVILVDPAHKAVRNDPRMNWICNPVHKHR  159



>gb|EPS66678.1| hypothetical protein M569_08101, partial [Genlisea aurea]
Length=203

 Score =   263 bits (671),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  57   GAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvv  236
            GAYTY SELWRKKQSDVMRF+LR+RCWEYRQLP++VR+TRPTRPDKA RLGYKAKQGYV+
Sbjct  1    GAYTYCSELWRKKQSDVMRFVLRIRCWEYRQLPAVVRITRPTRPDKAHRLGYKAKQGYVI  60

Query  237  yrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWI  416
            YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+
Sbjct  61   YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWV  120

Query  417  NEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            NEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHR
Sbjct  121  NEDSTYKYFEVILVDPAHAAIRNDPRINWVCNPVHKHR  158



>gb|KDP39891.1| hypothetical protein JCGZ_03422 [Jatropha curcas]
Length=204

 Score =   263 bits (671),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 151/159 (95%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINWLC+PVHKHR
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCDPVHKHR  159



>ref|XP_006421625.1| hypothetical protein CICLE_v10005611mg [Citrus clementina]
 gb|ESR34865.1| hypothetical protein CICLE_v10005611mg [Citrus clementina]
Length=273

 Score =   265 bits (677),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +3

Query  51   AMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgy  230
             MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGY
Sbjct  69   TMGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGY  128

Query  231  vvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSY  410
            VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSY
Sbjct  129  VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSY  188

Query  411  WINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            WINEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHR
Sbjct  189  WINEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHR  228



>gb|KHG16565.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
Length=204

 Score =   262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWICNPVHKHR  159



>ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus communis]
 gb|EEF51579.1| ribosomal protein L15, putative [Ricinus communis]
Length=204

 Score =   262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARR+GYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRMGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHR
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHR  159



>ref|XP_007039793.1| Ribosomal protein L23/L15e family protein isoform 3 [Theobroma 
cacao]
 gb|EOY24294.1| Ribosomal protein L23/L15e family protein isoform 3 [Theobroma 
cacao]
Length=204

 Score =   262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWICNPVHKHR  159



>ref|XP_006440278.1| hypothetical protein CICLE_v10024403mg [Citrus clementina]
 gb|ESR53518.1| hypothetical protein CICLE_v10024403mg [Citrus clementina]
Length=230

 Score =   263 bits (671),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 152/157 (97%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +3

Query  60   AYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvy  239
            AYT+VSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVY
Sbjct  29   AYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVY  88

Query  240  rvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWIN  419
            RVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWIN
Sbjct  89   RVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWIN  148

Query  420  EDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            EDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHR
Sbjct  149  EDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHR  185



>gb|KHG22797.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
 gb|KJB07871.1| hypothetical protein B456_001G049600 [Gossypium raimondii]
Length=204

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDPAHNAIRNDPRINWICNPVHKHR  159



>gb|KJB51842.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51843.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51844.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51846.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
Length=204

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSI+RV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIIRVNHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWICNPVHKHR  159



>ref|XP_007038342.1| Ribosomal protein L23/L15e family protein [Theobroma cacao]
 gb|EOY22843.1| Ribosomal protein L23/L15e family protein [Theobroma cacao]
Length=204

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDPAHNAIRNDPRINWICNPVHKHR  159



>gb|KHN44085.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   261 bits (667),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEVILVD AH+A+RNDPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEVILVDVAHSAVRNDPRINWLCNPVHKHR  159



>ref|NP_001236804.1| uncharacterized protein LOC100306052 [Glycine max]
 gb|ACU14044.1| unknown [Glycine max]
Length=204

 Score =   261 bits (667),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEVILVD AH+A+RNDPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEVILVDVAHSAVRNDPRINWLCNPVHKHR  159



>gb|ACU24496.1| unknown [Glycine max]
Length=204

 Score =   261 bits (667),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEVILVD AH+A+RNDPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEVILVDVAHSAVRNDPRINWLCNPVHKHR  159



>ref|XP_010686789.1| PREDICTED: 60S ribosomal protein L15 [Beta vulgaris subsp. vulgaris]
Length=204

 Score =   261 bits (667),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELWR+KQSDVMRF  RVRCWEYRQLPSIVRVT PTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYMQELWRRKQSDVMRFTQRVRCWEYRQLPSIVRVTHPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVMNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVDTAH AIRNDPR+NW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDTAHNAIRNDPRVNWICNPVHKHR  159



>gb|KHG20796.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
 gb|KJB39739.1| hypothetical protein B456_007G028600 [Gossypium raimondii]
Length=204

 Score =   261 bits (666),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ P+IVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPAIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWICNPVHKHR  159



>ref|XP_003549922.1| PREDICTED: 60S ribosomal protein L15-1-like [Glycine max]
 gb|KHN09835.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   261 bits (666),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEVILVD AH A+RNDPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEVILVDVAHTAVRNDPRINWLCNPVHKHR  159



>ref|XP_003593619.1| Ribosomal protein L15 [Medicago truncatula]
 gb|AES63870.1| 60S ribosomal protein L15-1 [Medicago truncatula]
Length=252

 Score =   263 bits (671),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  24   EPKNFSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARR  203
            +P +      MGAY Y+SELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARR
Sbjct  39   QPASVRQTEKMGAYKYISELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARR  98

Query  204  LGYKAKQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL  383
            LGYKAKQGYVVYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL
Sbjct  99   LGYKAKQGYVVYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL  158

Query  384  GGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            GGLRVLNSYW+NEDST+KYFEVILVD AH+AIRNDPRINWL NPVHKHR
Sbjct  159  GGLRVLNSYWVNEDSTFKYFEVILVDVAHSAIRNDPRINWLTNPVHKHR  207



>gb|ACJ84067.1| unknown [Medicago truncatula]
Length=204

 Score =   261 bits (666),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDST+KYFEVILVD AH+AIRNDPRINWL NPVHKHR
Sbjct  121  VNEDSTFKYFEVILVDVAHSAIRNDPRINWLTNPVHKHR  159



>gb|AFK49215.1| unknown [Medicago truncatula]
 gb|KEH35101.1| 60S ribosomal protein L15-1 [Medicago truncatula]
Length=204

 Score =   261 bits (666),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDST+KYFEVILVD AH+AIRNDPRINWL NPVHKHR
Sbjct  121  VNEDSTFKYFEVILVDVAHSAIRNDPRINWLTNPVHKHR  159



>ref|XP_010053499.1| PREDICTED: 60S ribosomal protein L15-2 [Eucalyptus grandis]
 gb|KCW77807.1| hypothetical protein EUGRSUZ_D02096 [Eucalyptus grandis]
Length=204

 Score =   260 bits (665),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH  IR DPRI+WLCNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDVAHTTIRRDPRISWLCNPVHKHR  159



>ref|XP_002277836.1| PREDICTED: 60S ribosomal protein L15-1 [Vitis vinifera]
Length=204

 Score =   260 bits (665),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYMYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+E+ILVD AH AIRNDPRINW+C PVHKHR
Sbjct  121  INEDSTYKYYEIILVDAAHNAIRNDPRINWICKPVHKHR  159



>ref|NP_001235890.1| uncharacterized protein LOC100305473 [Glycine max]
 ref|XP_003538942.1| PREDICTED: 60S ribosomal protein L15-1-like [Glycine max]
 gb|ACU13151.1| unknown [Glycine max]
 gb|KHN34919.1| 60S ribosomal protein L15 [Glycine soja]
 gb|KHN42683.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   260 bits (665),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEVILVD AHAAIRNDPRINWL NPVHKHR
Sbjct  121  VNEDSTYKYFEVILVDVAHAAIRNDPRINWLANPVHKHR  159



>gb|KDP22442.1| hypothetical protein JCGZ_26273 [Jatropha curcas]
Length=204

 Score =   260 bits (665),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHR
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHR  159



>ref|XP_011001078.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
Length=204

 Score =   260 bits (665),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 151/159 (95%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVKHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPV KHR
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVQKHR  159



>ref|XP_010264371.1| PREDICTED: 60S ribosomal protein L15-like [Nelumbo nucifera]
Length=204

 Score =   260 bits (665),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGI+YGKPTNQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIMYGKPTNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+E+ILVD AH AIRNDPRINW+C PVHKHR
Sbjct  121  INEDSTYKYYEIILVDAAHNAIRNDPRINWICKPVHKHR  159



>ref|XP_008775187.1| PREDICTED: 60S ribosomal protein L15 [Phoenix dactylifera]
Length=204

 Score =   260 bits (664),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+EVILVD AH+AIRNDPRINW+C  VHKHR
Sbjct  121  VNEDSTYKYYEVILVDAAHSAIRNDPRINWICKGVHKHR  159



>ref|XP_010258850.1| PREDICTED: 60S ribosomal protein L15 [Nelumbo nucifera]
Length=204

 Score =   260 bits (664),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGI+YGKPTNQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIMYGKPTNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+E+ILVD AH AIRNDPRINW+C PVHKHR
Sbjct  121  INEDSTYKYYEIILVDAAHNAIRNDPRINWICKPVHKHR  159



>ref|XP_010933636.1| PREDICTED: 60S ribosomal protein L15-1 [Elaeis guineensis]
Length=204

 Score =   260 bits (664),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLP+IVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPAIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINW+CN VHKHR
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICNGVHKHR  159



>ref|XP_007039791.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007039792.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24292.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24293.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
Length=206

 Score =   260 bits (664),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            +GAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  3    VGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  62

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  63   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  122

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHR
Sbjct  123  INEDSTYKYFEVILVDVAHNAIRNDPRINWICNPVHKHR  161



>gb|AFK37409.1| unknown [Lotus japonicus]
Length=204

 Score =   259 bits (663),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFE+ILV  AH AIRNDPRINWLC PVH HR
Sbjct  121  VNEDSTYKYFEIILVGIAHTAIRNDPRINWLCKPVHNHR  159



>ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004146917.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 ref|XP_004167164.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004167165.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 gb|KGN53150.1| hypothetical protein Csa_4G022860 [Cucumis sativus]
 gb|KGN56283.1| hypothetical protein Csa_3G112770 [Cucumis sativus]
 gb|KGN56284.1| hypothetical protein Csa_3G112780 [Cucumis sativus]
Length=204

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+EVILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYYEVILVDVAHNAVRNDPRINWICNPVHKHR  159



>ref|XP_010062398.1| PREDICTED: 60S ribosomal protein L15-1 [Eucalyptus grandis]
 gb|KCW90851.1| hypothetical protein EUGRSUZ_A02903 [Eucalyptus grandis]
Length=204

 Score =   259 bits (662),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEVILVD AH  IR DPRINW+CNPVHKHR
Sbjct  121  LNEDSTYKYFEVILVDAAHNTIRKDPRINWICNPVHKHR  159



>ref|XP_008437057.1| PREDICTED: 60S ribosomal protein L15-2 isoform X2 [Cucumis melo]
 ref|XP_008453903.1| PREDICTED: 60S ribosomal protein L15-2 [Cucumis melo]
Length=204

 Score =   259 bits (662),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+EVILVD AH AIRNDPRI W+CNPVHKHR
Sbjct  121  INEDSTYKYYEVILVDVAHNAIRNDPRIKWICNPVHKHR  159



>gb|EPS59253.1| hypothetical protein M569_15555, partial [Genlisea aurea]
Length=203

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  57   GAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvv  236
            GAYTY SELWRKKQSDVMRF+LR+RCWEYRQLP++VR+TRPTRPDKA RLGYKAKQGYV+
Sbjct  1    GAYTYCSELWRKKQSDVMRFVLRIRCWEYRQLPAVVRITRPTRPDKAHRLGYKAKQGYVI  60

Query  237  yrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWI  416
            YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+
Sbjct  61   YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWV  120

Query  417  NEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            NEDSTYKY+EVIL+D AHA +RNDPRINW+CNPVHKHR
Sbjct  121  NEDSTYKYYEVILIDPAHAVVRNDPRINWICNPVHKHR  158



>ref|XP_004491939.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X2 [Cicer 
arietinum]
Length=204

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDST+KYFEVILVD AH AIRNDPRINWL NPVHKHR
Sbjct  121  VNEDSTFKYFEVILVDVAHTAIRNDPRINWLVNPVHKHR  159



>gb|ACV50439.1| ribosomal protein L15 [Jatropha curcas]
Length=204

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFE ILVDTAH AIRNDPRINW+C PVHKHR
Sbjct  121  INEDSTYKYFEDILVDTAHNAIRNDPRINWICKPVHKHR  159



>ref|XP_008241281.1| PREDICTED: 60S ribosomal protein L15-like [Prunus mume]
Length=204

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MG Y Y SE+WRKKQSD+MRF+ RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGGYKYQSEIWRKKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYR+RVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVAKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHR  159



>ref|XP_003635402.1| PREDICTED: 60S ribosomal protein L15-1 [Vitis vinifera]
Length=204

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+E+ILVD AH  IRNDPRINW+C PVHKHR
Sbjct  121  INEDSTYKYYEIILVDAAHNTIRNDPRINWICKPVHKHR  159



>ref|XP_010919627.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Elaeis guineensis]
Length=204

 Score =   258 bits (660),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINW+C  VHKHR
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICKGVHKHR  159



>ref|XP_010933963.1| PREDICTED: 60S ribosomal protein L15-like [Elaeis guineensis]
Length=204

 Score =   258 bits (660),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+RVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEVILVD AH AIRNDPRINW+C  VHKHR
Sbjct  121  VNEDSTYKYFEVILVDAAHNAIRNDPRINWICKGVHKHR  159



>ref|NP_193405.1| 60S ribosomal protein L15-1 [Arabidopsis thaliana]
 ref|XP_002868071.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006391552.1| hypothetical protein EUTSA_v10019144mg [Eutrema salsugineum]
 ref|XP_006414312.1| hypothetical protein EUTSA_v10026269mg [Eutrema salsugineum]
 ref|XP_010440111.1| PREDICTED: 60S ribosomal protein L15-1 [Camelina sativa]
 ref|XP_010449726.1| PREDICTED: 60S ribosomal protein L15-1 [Camelina sativa]
 sp|O23515.1|RL151_ARATH RecName: Full=60S ribosomal protein L15-1 [Arabidopsis thaliana]
 gb|AAK44167.1|AF370352_1 putative ribosomal protein [Arabidopsis thaliana]
 emb|CAB10447.1| ribosomal protein [Arabidopsis thaliana]
 emb|CAB78714.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAL24229.1| AT4g16720/dl4385c [Arabidopsis thaliana]
 gb|AAL91619.1| AT4g16720/dl4385c [Arabidopsis thaliana]
 gb|AAM64387.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAM91731.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN28757.1| At4g16720/dl4385c [Arabidopsis thaliana]
 gb|EFH44330.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE83791.1| 60S ribosomal protein L15-1 [Arabidopsis thaliana]
 gb|ESQ28838.1| hypothetical protein EUTSA_v10019144mg [Eutrema salsugineum]
 gb|ESQ55765.1| hypothetical protein EUTSA_v10026269mg [Eutrema salsugineum]
 gb|KFK23089.1| hypothetical protein AALP_AAs51321U000100 [Arabis alpina]
Length=204

 Score =   258 bits (660),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  159



>ref|NP_193470.1| 60S ribosomal protein L15-2 [Arabidopsis thaliana]
 ref|XP_006282721.1| hypothetical protein CARUB_v10005754mg [Capsella rubella]
 sp|Q8VYF1.1|RL152_ARATH RecName: Full=60S ribosomal protein L15-2 [Arabidopsis thaliana]
 gb|AAL59940.1| putative 60S ribosomal protein L15-like protein [Arabidopsis 
thaliana]
 gb|AAM64649.1| 60S ribosomal protein L15 homolog [Arabidopsis thaliana]
 gb|AAM67498.1| putative 60S ribosomal protein L15-like protein [Arabidopsis 
thaliana]
 dbj|BAE98399.1| 60S ribosomal protein L15 homolog [Arabidopsis thaliana]
 gb|AEE83883.1| 60S ribosomal protein L15-2 [Arabidopsis thaliana]
 gb|EOA15619.1| hypothetical protein CARUB_v10005754mg [Capsella rubella]
Length=204

 Score =   258 bits (660),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  159



>ref|XP_006282719.1| hypothetical protein CARUB_v10005752mg [Capsella rubella]
 gb|EOA15617.1| hypothetical protein CARUB_v10005752mg [Capsella rubella]
Length=204

 Score =   258 bits (660),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  159



>ref|XP_002868106.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010434780.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 ref|XP_010440015.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 ref|XP_010449626.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 gb|EFH44365.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   258 bits (659),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  159



>ref|XP_010434676.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
Length=204

 Score =   258 bits (659),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  159



>ref|XP_010107162.1| 60S ribosomal protein L15 [Morus notabilis]
 gb|EXC13927.1| 60S ribosomal protein L15 [Morus notabilis]
Length=204

 Score =   258 bits (659),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSE+WRKKQSD+MRF+ RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYQYVSEIWRKKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFE+ILVD AH AIRNDPRINW+C PVHKHR
Sbjct  121  INEDSTYKYFEIILVDPAHNAIRNDPRINWICKPVHKHR  159



>gb|KFK32179.1| hypothetical protein AALP_AA6G207900 [Arabis alpina]
Length=204

 Score =   258 bits (659),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  159



>ref|XP_008798983.1| PREDICTED: 60S ribosomal protein L15-like [Phoenix dactylifera]
 ref|XP_008810110.1| PREDICTED: 60S ribosomal protein L15-like [Phoenix dactylifera]
Length=204

 Score =   258 bits (659),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH A+RNDPRINW+C  VHKHR
Sbjct  121  INEDSTYKYFEVILVDAAHNAVRNDPRINWICKGVHKHR  159



>ref|XP_006837338.1| hypothetical protein AMTR_s00111p00086580 [Amborella trichopoda]
 gb|ERN00192.1| hypothetical protein AMTR_s00111p00086580 [Amborella trichopoda]
Length=204

 Score =   258 bits (658),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSE+WRKKQSDVMRFL RVRCWEYRQLPSIVR TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSEMWRKKQSDVMRFLQRVRCWEYRQLPSIVRCTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+EVILVD AH AIRNDPRINW+CNPVHKHR
Sbjct  121  INQDSTYKYYEVILVDAAHNAIRNDPRINWICNPVHKHR  159



>ref|XP_009108318.1| PREDICTED: 60S ribosomal protein L15-1-like [Brassica rapa]
Length=204

 Score =   258 bits (658),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+ILVD AH AIRNDPRINW+CNPVHKHR
Sbjct  121  LNEDSTYKYYEIILVDPAHNAIRNDPRINWICNPVHKHR  159



>ref|XP_004152395.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004158132.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 gb|KGN50265.1| hypothetical protein Csa_5G162630 [Cucumis sativus]
Length=204

 Score =   258 bits (658),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+EVILVD AH A+RNDPRINW+CNPVHK R
Sbjct  121  INEDSTYKYYEVILVDVAHNAVRNDPRINWICNPVHKRR  159



>ref|XP_009136839.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
 gb|ABD65137.1| 60S ribosomal protein L15 [Brassica oleracea]
Length=204

 Score =   257 bits (657),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  159



>ref|XP_009145572.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
 ref|XP_009123031.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
Length=204

 Score =   257 bits (657),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  159



>emb|CAN68893.1| hypothetical protein VITISV_004609 [Vitis vinifera]
Length=204

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIV  TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVXATRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+EVILVD AH AIRNDPRINW+C PVHKHR
Sbjct  121  INEDSTYKYYEVILVDAAHNAIRNDPRINWICKPVHKHR  159



>ref|XP_010934657.1| PREDICTED: 60S ribosomal protein L15-1-like [Elaeis guineensis]
Length=204

 Score =   257 bits (656),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL R+RCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRIRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGI+YGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIIYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+EVILVD AH+AIRNDPRINW+C  VHKHR
Sbjct  121  VNEDSTYKYYEVILVDAAHSAIRNDPRINWICKGVHKHR  159



>emb|CDX90499.1| BnaA03g42820D [Brassica napus]
Length=275

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = +3

Query  48   TAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQg  227
            + MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG
Sbjct  70   SKMGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQG  129

Query  228  yvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  407
            +VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NS
Sbjct  130  FVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNS  189

Query  408  YWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            YW+NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  190  YWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  230



>emb|CDY60707.1| BnaC07g50070D [Brassica napus]
Length=274

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = +3

Query  48   TAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQg  227
            + MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG
Sbjct  69   SKMGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQG  128

Query  228  yvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  407
            +VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NS
Sbjct  129  FVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNS  188

Query  408  YWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            YW+NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  189  YWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  229



>emb|CDY53647.1| BnaA08g30370D [Brassica napus]
Length=237

 Score =   258 bits (659),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = +3

Query  48   TAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQg  227
            + MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG
Sbjct  32   SKMGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQG  91

Query  228  yvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  407
            +VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NS
Sbjct  92   FVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNS  151

Query  408  YWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            YW+NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  152  YWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  192



>ref|XP_008452210.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
 ref|XP_008452211.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
 ref|XP_008452213.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
Length=204

 Score =   256 bits (655),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+EVILVD AH AIRNDPRI W+C PVHKHR
Sbjct  121  INEDSTYKYYEVILVDVAHNAIRNDPRIKWICKPVHKHR  159



>gb|ACF88005.1| unknown [Zea mays]
 tpg|DAA62722.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   256 bits (655),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFE+ILVD AH AIRNDPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEIILVDVAHTAIRNDPRINWLCNPVHKHR  159



>emb|CDY54747.1| BnaAnng13420D [Brassica napus]
Length=239

 Score =   258 bits (658),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = +3

Query  48   TAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQg  227
            + MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG
Sbjct  34   SKMGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQG  93

Query  228  yvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  407
            +VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NS
Sbjct  94   FVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNS  153

Query  408  YWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            YW+NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  154  YWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  194



>ref|XP_009136806.1| PREDICTED: 60S ribosomal protein L15-1-like [Brassica rapa]
Length=204

 Score =   256 bits (654),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPD+ARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDRARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  159



>ref|XP_010104882.1| 60S ribosomal protein L15 [Morus notabilis]
 gb|EXC02118.1| 60S ribosomal protein L15 [Morus notabilis]
Length=241

 Score =   257 bits (657),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            +GAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPD+ARRLGYKAKQGYV
Sbjct  38   LGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDRARRLGYKAKQGYV  97

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  98   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  157

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
             NEDSTYKYFEVILVD AH AIRNDPRINWL  PVHKHR
Sbjct  158  TNEDSTYKYFEVILVDVAHNAIRNDPRINWLSKPVHKHR  196



>ref|XP_008796124.1| PREDICTED: 60S ribosomal protein L15-2 [Phoenix dactylifera]
Length=204

 Score =   256 bits (653),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLP+IVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPAIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH  IRNDPRINW+C  VHKHR
Sbjct  121  INEDSTYKYFEVILVDAAHNTIRNDPRINWICKGVHKHR  159



>ref|NP_001150716.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACF85905.1| unknown [Zea mays]
 gb|ACG40111.1| 60S ribosomal protein L15 [Zea mays]
 tpg|DAA62720.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   256 bits (653),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFE+ILVD AH AIRNDPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEIILVDVAHTAIRNDPRINWLCNPVHKHR  159



>ref|XP_009352987.1| PREDICTED: 60S ribosomal protein L15-like [Pyrus x bretschneideri]
Length=204

 Score =   256 bits (653),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MG Y Y SE+WRKKQSD+MRF+ RVRCWEYRQ PSIVRVTRPTRPDKAR LGYKAKQGYV
Sbjct  1    MGFYKYQSEIWRKKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARCLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHR  159



>emb|CAB10520.1| ribosomal protein [Arabidopsis thaliana]
 emb|CAB78742.1| ribosomal protein [Arabidopsis thaliana]
Length=216

 Score =   256 bits (654),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  36   FSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYK  215
             S      AY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYK
Sbjct  7    ISKTKTKSAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYK  66

Query  216  AKQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  395
            AKQG+VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR
Sbjct  67   AKQGFVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  126

Query  396  VLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            V+NSYW+NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  127  VVNSYWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  171



>ref|XP_008437056.1| PREDICTED: 60S ribosomal protein L15-2 isoform X1 [Cucumis melo]
Length=214

 Score =   256 bits (654),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  39   SSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKA  218
            SS     AY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKA
Sbjct  6    SSSFFFRAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKA  65

Query  219  KQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  398
            KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV
Sbjct  66   KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  125

Query  399  LNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            LNSYWINEDSTYKY+EVILVD AH AIRNDPRI W+CNPVHKHR
Sbjct  126  LNSYWINEDSTYKYYEVILVDVAHNAIRNDPRIKWICNPVHKHR  169



>ref|XP_002268465.1| PREDICTED: 60S ribosomal protein L15-1-like [Vitis vinifera]
Length=204

 Score =   256 bits (653),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIV  TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVCATRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+EVILVD AH AIRNDPRINW+C PVHKHR
Sbjct  121  INEDSTYKYYEVILVDAAHNAIRNDPRINWICKPVHKHR  159



>pdb|3J61|N Chain N, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=200

 Score =   255 bits (652),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHR
Sbjct  121  VNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHR  159



>ref|NP_001050612.1| Os03g0598800 [Oryza sativa Japonica Group]
 ref|NP_001174316.1| Os05g0274700 [Oryza sativa Japonica Group]
 gb|AAN08216.1| ribosomal protein L15 [Oryza sativa Japonica Group]
 gb|AAO59978.1| ribosomal protein L15 [Oryza sativa Japonica Group]
 gb|ABF97468.1| 60S ribosomal protein L15, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12526.1| Os03g0598800 [Oryza sativa Japonica Group]
 gb|EAY90899.1| hypothetical protein OsI_12513 [Oryza sativa Indica Group]
 gb|EAZ27702.1| hypothetical protein OsJ_11650 [Oryza sativa Japonica Group]
 dbj|BAG87626.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00645.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93044.1| Os05g0274700 [Oryza sativa Japonica Group]
Length=204

 Score =   255 bits (652),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHR
Sbjct  121  VNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHR  159



>ref|XP_004491938.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X1 [Cicer 
arietinum]
Length=216

 Score =   256 bits (653),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +3

Query  39   SSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKA  218
            S     GAY YVSELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKA
Sbjct  8    SFSLVTGAYKYVSELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKA  67

Query  219  KQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  398
            KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV
Sbjct  68   KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  127

Query  399  LNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            LNSYW+NEDST+KYFEVILVD AH AIRNDPRINWL NPVHKHR
Sbjct  128  LNSYWVNEDSTFKYFEVILVDVAHTAIRNDPRINWLVNPVHKHR  171



>emb|CBI16601.3| unnamed protein product [Vitis vinifera]
Length=206

 Score =   255 bits (652),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +3

Query  60   AYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvy  239
            AY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV+Y
Sbjct  5    AYMYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIY  64

Query  240  rvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWIN  419
            RVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWIN
Sbjct  65   RVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWIN  124

Query  420  EDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            EDSTYKY+E+ILVD AH AIRNDPRINW+C PVHKHR
Sbjct  125  EDSTYKYYEIILVDAAHNAIRNDPRINWICKPVHKHR  161



>ref|XP_002460708.1| hypothetical protein SORBIDRAFT_02g033530 [Sorghum bicolor]
 gb|ACG25131.1| 60S ribosomal protein L15 [Zea mays]
 gb|EER97229.1| hypothetical protein SORBIDRAFT_02g033530 [Sorghum bicolor]
 tpg|DAA40842.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   255 bits (651),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFE+ILVD AH  IRNDPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEIILVDVAHTTIRNDPRINWLCNPVHKHR  159



>ref|XP_006650289.1| PREDICTED: 60S ribosomal protein L15-like [Oryza brachyantha]
Length=204

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+SELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYISELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHR
Sbjct  121  VNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHR  159



>emb|CDY40505.1| BnaC01g20070D [Brassica napus]
Length=318

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = +3

Query  48   TAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQg  227
            + MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG
Sbjct  113  SKMGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQG  172

Query  228  yvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  407
            +VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NS
Sbjct  173  FVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNS  232

Query  408  YWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            YW+NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  233  YWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  273



>ref|XP_006837287.1| hypothetical protein AMTR_s00111p00023340 [Amborella trichopoda]
 gb|ERN00141.1| hypothetical protein AMTR_s00111p00023340 [Amborella trichopoda]
Length=233

 Score =   256 bits (653),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = +3

Query  48   TAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQg  227
            T  GAY YVSE+WRKKQSDVMRFL RVRCWEYRQLPSIVR TRPTRPDKARRLGYKAKQG
Sbjct  28   TFYGAYKYVSEMWRKKQSDVMRFLQRVRCWEYRQLPSIVRCTRPTRPDKARRLGYKAKQG  87

Query  228  yvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  407
            YV+YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNS
Sbjct  88   YVIYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNS  147

Query  408  YWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            YWIN+DSTYKY+EVILVD AH AIRNDPRINW+CNPVHKHR
Sbjct  148  YWINQDSTYKYYEVILVDAAHNAIRNDPRINWICNPVHKHR  188



>emb|CDY50842.1| BnaC08g47880D, partial [Brassica napus]
Length=260

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+V
Sbjct  57   MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  116

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  117  VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  176

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  177  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  215



>ref|XP_009406701.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   254 bits (649),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+IL+D AH+AIRNDPRINW+C  VHKHR
Sbjct  121  VNEDSTYKYYEIILIDPAHSAIRNDPRINWICKGVHKHR  159



>ref|NP_001150386.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG38875.1| 60S ribosomal protein L15 [Zea mays]
Length=204

 Score =   254 bits (649),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFE+ILVD AH AIR DPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEIILVDVAHTAIRKDPRINWLCNPVHKHR  159



>ref|NP_001148378.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG31200.1| 60S ribosomal protein L15 [Zea mays]
Length=204

 Score =   254 bits (649),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWR+KQSDVMRF+ R+RCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRMRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFE+ILVD AH  IRNDPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEIILVDVAHTTIRNDPRINWLCNPVHKHR  159



>ref|XP_002879569.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55828.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   254 bits (649),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMR L RVRCW+YRQ PSIVR+TRPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRHLQRVRCWDYRQQPSIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLSGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+E+ILVD AH A+RNDPRINW+CNPVHKHR
Sbjct  121  INEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHR  159



>gb|ACF87670.1| unknown [Zea mays]
Length=204

 Score =   254 bits (648),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQL+FQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLRFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFE+ILVD AH  IRNDPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEIILVDVAHTTIRNDPRINWLCNPVHKHR  159



>ref|XP_006838929.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda]
 gb|ERN01498.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda]
Length=204

 Score =   254 bits (648),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSE+WRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSEMWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+E+ILVD AH AIRNDPRINW+  PVHKHR
Sbjct  121  INQDSTYKYYEIILVDAAHNAIRNDPRINWITKPVHKHR  159



>ref|NP_001148602.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACF83256.1| unknown [Zea mays]
 gb|ACG32179.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG38194.1| 60S ribosomal protein L15 [Zea mays]
 tpg|DAA59713.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   254 bits (648),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFE+ILVD AH AI+ DPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEIILVDVAHKAIKTDPRINWLCNPVHKHR  159



>ref|XP_002461521.1| hypothetical protein SORBIDRAFT_02g004020 [Sorghum bicolor]
 gb|EER98042.1| hypothetical protein SORBIDRAFT_02g004020 [Sorghum bicolor]
Length=204

 Score =   253 bits (647),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFE+ILVD AH AI+ DPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEIILVDVAHTAIKTDPRINWLCNPVHKHR  159



>ref|XP_009399011.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   253 bits (647),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+EVIL+D AH AIRNDPRINW+C  VHKHR
Sbjct  121  VNEDSTYKYYEVILIDPAHNAIRNDPRINWICKGVHKHR  159



>ref|XP_004299420.1| PREDICTED: 60S ribosomal protein L15-1 [Fragaria vesca subsp. 
vesca]
Length=204

 Score =   253 bits (647),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVM F+ RVRCW+YRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMGFVQRVRCWDYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVAKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH+ I+ DPRINW+ NPVHKHR
Sbjct  121  INEDSTYKYFEVILVDVAHSVIKKDPRINWIVNPVHKHR  159



>ref|XP_006655163.1| PREDICTED: 60S ribosomal protein L15-like [Oryza brachyantha]
Length=213

 Score =   254 bits (648),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +3

Query  51   AMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgy  230
             +GAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGY
Sbjct  9    GVGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGY  68

Query  231  vvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSY  410
            VVYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSY
Sbjct  69   VVYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSY  128

Query  411  WINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            W+NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHR
Sbjct  129  WVNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHR  168



>ref|XP_009418976.1| PREDICTED: 60S ribosomal protein L15-1 [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   253 bits (646),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVVNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+IL+D AH+AIRNDPRINW+C  VHKHR
Sbjct  121  VNEDSTYKYYEIILIDPAHSAIRNDPRINWICKGVHKHR  159



>ref|XP_009398340.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   253 bits (645),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+IL+D AH AIRNDPRINW+C  VHKHR
Sbjct  121  VNEDSTYKYYEIILIDPAHGAIRNDPRINWICKGVHKHR  159



>ref|XP_007202591.1| hypothetical protein PRUPE_ppa011597mg [Prunus persica]
 ref|XP_008244846.1| PREDICTED: 60S ribosomal protein L15-1-like [Prunus mume]
 gb|EMJ03790.1| hypothetical protein PRUPE_ppa011597mg [Prunus persica]
Length=204

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MG Y Y +ELWRKKQSDVMRF+ RVRCWEYRQ PSIVRVTRPTRPDKAR LGYKAKQGYV
Sbjct  1    MGFYKYPTELWRKKQSDVMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARLLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPV KGIVYGKPTNQGVTQLKFQRS RSVAEERAGRKL GLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSLRSVAEERAGRKLAGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHR
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHR  159



>ref|XP_004512167.1| PREDICTED: 60S ribosomal protein L15-1-like [Cicer arietinum]
Length=204

 Score =   252 bits (643),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMR L R RCWEYRQ  SIVRVTRPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRCLQRWRCWEYRQQSSIVRVTRPTRPDKARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+EVILVD AH AIRNDPR+NW+CNPVHKHR
Sbjct  121  MNEDSTYKYYEVILVDVAHTAIRNDPRVNWVCNPVHKHR  159



>gb|ADA67930.1| putative 60S ribosomal protein L15 [Wolffia arrhiza]
Length=204

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQ+P+IVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQMPAIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+EVILVD A  AIRNDPRINW+C  VHKHR
Sbjct  121  VNEDSTYKYYEVILVDGALNAIRNDPRINWICKGVHKHR  159



>ref|XP_003573847.1| PREDICTED: 60S ribosomal protein L15-2 [Brachypodium distachyon]
Length=204

 Score =   251 bits (642),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEVILVD AH A+RNDPRINWLCNPVHKHR
Sbjct  121  VNEDSTYKYFEVILVDVAHNAVRNDPRINWLCNPVHKHR  159



>ref|XP_004955579.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X2 [Setaria 
italica]
Length=204

 Score =   251 bits (642),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKP +QGVTQLKFQR+KRSVAEERAGRK+GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGVTQLKFQRNKRSVAEERAGRKIGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFE+ILVD AHAAIRNDPRINWLC  VHKHR
Sbjct  121  VNEDSTYKYFEIILVDVAHAAIRNDPRINWLCKDVHKHR  159



>ref|XP_009408522.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   251 bits (641),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPD+ARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDRARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+E+IL+D +H+AIRNDPRINW+C  VHKHR
Sbjct  121  VNEDSTYKYYEIILLDPSHSAIRNDPRINWICKGVHKHR  159



>dbj|BAJ95856.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   250 bits (639),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEVILVD AH+A+RNDPRINWLC PVHKHR
Sbjct  121  VNEDSTYKYFEVILVDVAHSAVRNDPRINWLCKPVHKHR  159



>ref|XP_008360544.1| PREDICTED: 60S ribosomal protein L15 [Malus domestica]
Length=204

 Score =   250 bits (639),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MG Y Y SE+WRKKQSD+MRF+ RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGFYKYQSEIWRKKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTY YFEVILVD AH AIRND RIN LCNPVHKHR
Sbjct  121  INEDSTYXYFEVILVDVAHNAIRNDARINXLCNPVHKHR  159



>ref|XP_004957717.1| PREDICTED: 60S ribosomal protein L15-1-like [Setaria italica]
Length=204

 Score =   249 bits (637),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRK+GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKIGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEVILVD AH AIRNDPRINWLC  VHKHR
Sbjct  121  VNEDSTYKYFEVILVDVAHTAIRNDPRINWLCKDVHKHR  159



>ref|XP_001764493.1| predicted protein [Physcomitrella patens]
 gb|EDQ70760.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   249 bits (637),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQLP IVRVTRP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFE+ILVD  HA IR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEIILVDPQHAVIRKDPRINWIVNPVHKHR  159



>ref|XP_003563105.1| PREDICTED: 60S ribosomal protein L15-2 [Brachypodium distachyon]
Length=204

 Score =   249 bits (636),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEVILVD AH A+RNDPRINWLC PVHKHR
Sbjct  121  VNEDSTYKYFEVILVDVAHNAVRNDPRINWLCKPVHKHR  159



>gb|EEE63068.1| hypothetical protein OsJ_17876 [Oryza sativa Japonica Group]
Length=377

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  36   FSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYK  215
            F      GAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYK
Sbjct  168  FLEPQVTGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYK  227

Query  216  AKQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  395
            AKQGYVVYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLR
Sbjct  228  AKQGYVVYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLR  287

Query  396  VLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            VLNSYW+NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHR
Sbjct  288  VLNSYWVNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHR  332



>sp|O65050.1|RL15A_PICMA RecName: Full=60S ribosomal protein L15-1 [Picea mariana]
 gb|AAC32112.1| probable 60S ribosomal protein L15 [Picea mariana]
 gb|ABK22257.1| unknown [Picea sitchensis]
Length=204

 Score =   249 bits (636),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELW+KKQSDVMRFL RVRCWE+RQLP IVRVTRP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWKKKQSDVMRFLQRVRCWEFRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQRS RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRSLRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+E+ILVD AH+AIR DPRINW+CN VHKHR
Sbjct  121  INQDSTYKYYEIILVDQAHSAIRKDPRINWICNAVHKHR  159



>sp|O65082.1|RL15B_PICMA RecName: Full=60S ribosomal protein L15-2 [Picea mariana]
 gb|AAC32144.1| probable 60S ribosomal protein L15 [Picea mariana]
 gb|ABK25889.1| unknown [Picea sitchensis]
Length=204

 Score =   249 bits (635),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELW+KKQSDVMRFL RVRCWEYRQLP IVR+T PTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWKKKQSDVMRFLQRVRCWEYRQLPGIVRITHPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQRS RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRSLRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+EV+LVD AH  IRNDPRINW+CN VHKHR
Sbjct  121  INQDSTYKYYEVVLVDQAHTVIRNDPRINWICNAVHKHR  159



>gb|EEC78893.1| hypothetical protein OsI_19264 [Oryza sativa Indica Group]
Length=377

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  36   FSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYK  215
            F      GAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYK
Sbjct  168  FLEPQVTGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYK  227

Query  216  AKQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  395
            AKQGYVVYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLR
Sbjct  228  AKQGYVVYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLR  287

Query  396  VLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            VLNSYW+NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHR
Sbjct  288  VLNSYWVNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHR  332



>ref|XP_001753036.1| predicted protein [Physcomitrella patens]
 ref|XP_001758957.1| predicted protein [Physcomitrella patens]
 ref|XP_001772614.1| predicted protein [Physcomitrella patens]
 gb|EDQ62656.1| predicted protein [Physcomitrella patens]
 gb|EDQ76463.1| predicted protein [Physcomitrella patens]
 gb|EDQ82077.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   248 bits (633),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQLP IVRVTRP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFE+ILVD  H  IR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEIILVDPQHTVIRKDPRINWIVNPVHKHR  159



>gb|AAK67641.1| ribosomal protein L15 [Homo sapiens]
Length=204

 Score =   248 bits (632),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NED TYKYFEVILVD AH+A+RNDPRINWLC PVHKHR
Sbjct  121  VNEDFTYKYFEVILVDVAHSAVRNDPRINWLCKPVHKHR  159



>ref|XP_001771165.1| predicted protein [Physcomitrella patens]
 gb|EDQ64014.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   248 bits (632),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQLP IVRVTRP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFE+IL+D  H  IR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEIILIDPQHTVIRKDPRINWIVNPVHKHR  159



>dbj|BAD22764.1| ribosomal protein [Bromus inermis]
Length=204

 Score =   247 bits (631),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY ++SE+WR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFLSEIWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEVILVD AH A+RNDPRINWLC PVHKHR
Sbjct  121  VNEDSTYKYFEVILVDVAHNAVRNDPRINWLCKPVHKHR  159



>ref|XP_010516773.1| PREDICTED: 60S ribosomal protein L15-2-like [Camelina sativa]
Length=212

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMR L RVRCW YRQ PSIVR+TRPTRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRHLQRVRCWNYRQQPSIVRLTRPTRPDEARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRS +EERAGRKLGGLR LNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSGSEERAGRKLGGLRDLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            INEDSTYKY+E+ILVD AH A+ NDPRINW+CNPVHKH+
Sbjct  121  INEDSTYKYYEIILVDLAHNAVSNDPRINWICNPVHKHQ  159



>ref|XP_002961462.1| hypothetical protein SELMODRAFT_270259 [Selaginella moellendorffii]
 gb|EFJ36722.1| hypothetical protein SELMODRAFT_270259 [Selaginella moellendorffii]
Length=204

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELWRKKQSDVMRFL+RVRCWEYRQLP IVR+ RPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVMRFLMRVRCWEYRQLPGIVRIQRPTRPDKARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLG LRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFE+IL+D  H AIR DPRINW+C PVHKHR
Sbjct  121  INQDSTYKYFEIILIDPMHTAIRKDPRINWICQPVHKHR  159



>ref|XP_002971348.1| hypothetical protein SELMODRAFT_270900 [Selaginella moellendorffii]
 gb|EFJ27946.1| hypothetical protein SELMODRAFT_270900 [Selaginella moellendorffii]
Length=204

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELWRKKQSDVMRFL+RVRCWEYRQLP IVR+ RPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVMRFLMRVRCWEYRQLPGIVRIQRPTRPDKARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLG LRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFE+IL+D  H AIR DPRINW+C PVHKHR
Sbjct  121  INQDSTYKYFEIILIDPMHTAIRKDPRINWICQPVHKHR  159



>ref|XP_001757563.1| predicted protein [Physcomitrella patens]
 gb|EDQ77620.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   245 bits (626),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQLP IVRVTRP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFE+ILVD  H  IR D RINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEIILVDPQHTVIRKDSRINWIVNPVHKHR  159



>ref|XP_002946380.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ52307.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=204

 Score =   243 bits (620),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YV ELWRKKQSDV+RFLLRVRCWEYRQLPSIVR+TRP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVEELWRKKQSDVLRFLLRVRCWEYRQLPSIVRLTRPSRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRG RKRPV KGIVYGKP NQG+TQLK  R+ RSVAEER GRK GGLRVLNSYW
Sbjct  61   VYRVRVRRGNRKRPVHKGIVYGKPVNQGITQLKAARNLRSVAEERVGRKCGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+DS YKYFEVILVD AH  IRND RINWLCNPVHKHR
Sbjct  121  VNQDSCYKYFEVILVDPAHTTIRNDARINWLCNPVHKHR  159



>ref|XP_001701780.1| ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP06755.1| ribosomal protein L15 [Chlamydomonas reinhardtii]
Length=204

 Score =   241 bits (614),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQ+PS VR+TRP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQMPSCVRLTRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRG RKRPV KGIVYGKP NQG+TQLK  R+ R+VAEERAGRK GGLRVLNSYW
Sbjct  61   VYRVRVRRGNRKRPVHKGIVYGKPVNQGITQLKPARNLRNVAEERAGRKCGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+DS YKYFEVI+VD AH AIRND RINWLCNPVHKHR
Sbjct  121  VNQDSCYKYFEVIMVDPAHNAIRNDARINWLCNPVHKHR  159



>gb|EMS52882.1| 60S ribosomal protein L15 [Triticum urartu]
Length=268

 Score =   241 bits (614),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 141/185 (76%), Gaps = 17/185 (9%)
 Frame = +3

Query  27   PKNFSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRL  206
            PK ++  +  GAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRL
Sbjct  39   PKEYTDVSTPGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRL  98

Query  207  GYKAKQgyvvyrvrvrrggrkrpvp-----------------kgIVYGKPTNQGVTQLKF  335
            G+KAKQ   +      +  R                      KGIVYGKP +QG+TQLKF
Sbjct  99   GFKAKQILFLCDSYTLKYVRIYAGYVVYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKF  158

Query  336  QRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNP  515
            QR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEVILVD AH+A+RNDPRINWLC P
Sbjct  159  QRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEVILVDVAHSAVRNDPRINWLCKP  218

Query  516  VHKHR  530
            VHKHR
Sbjct  219  VHKHR  223



>ref|XP_010539199.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=197

 Score =   238 bits (607),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  90   KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  269
            K+QSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQG VVYRVRVRRGGRK
Sbjct  6    KRQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGIVVYRVRVRRGGRK  65

Query  270  rpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  449
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRVLNSYWINEDSTYKY+EV
Sbjct  66   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRVLNSYWINEDSTYKYYEV  125

Query  450  ILVDTAHAAIRNDPRINWLCNPVHKHR  530
            ILVDTAH+A+RNDPR+NW+CNPVHKHR
Sbjct  126  ILVDTAHSAVRNDPRMNWICNPVHKHR  152



>ref|XP_006431497.1| hypothetical protein CICLE_v10002413mg [Citrus clementina]
 gb|ESR44737.1| hypothetical protein CICLE_v10002413mg [Citrus clementina]
Length=220

 Score =   238 bits (607),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDP  491
            INEDSTYKYFEVILVD AH AIRNDP
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDP  146



>gb|KDO49937.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=195

 Score =   237 bits (604),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 144/159 (91%), Gaps = 9/159 (6%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+      
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLK------  114

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
               DSTYKYFEVILVD AH AIRNDPRINW+C PVHKHR
Sbjct  115  ---DSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHR  150



>gb|AFK40278.1| unknown [Lotus japonicus]
Length=222

 Score =   237 bits (604),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   KQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkr  272
            KQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKR
Sbjct  8    KQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKR  67

Query  273  pvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  452
            PV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+I
Sbjct  68   PVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEII  127

Query  453  LVDTAHAAIRNDPRINWLCNPVHKHR  530
            LVD AH AIRNDPRINWLC PVH HR
Sbjct  128  LVDIAHTAIRNDPRINWLCKPVHNHR  153



>emb|CDP10996.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   236 bits (601),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkg  287
            MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  288  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  467
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDPA  120

Query  468  HAAIRNDPRINWLCNPVHKHR  530
            HAAIRNDPRINWLC PVHKHR
Sbjct  121  HAAIRNDPRINWLCQPVHKHR  141



>ref|XP_008234416.1| PREDICTED: 60S ribosomal protein L15-like [Prunus mume]
Length=204

 Score =   235 bits (599),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MG Y Y SEL RKKQSDVMR L R+R +EYR  PSIVRVT PT PDKA RLGYKAKQGYV
Sbjct  1    MGYYKYTSELGRKKQSDVMRALQRLRAFEYRHQPSIVRVTHPTCPDKAHRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRV+RGGRKRPV KGIVYGKPTNQGV+QLKFQRSKRSVAEERAGRKL GL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVAKGIVYGKPTNQGVSQLKFQRSKRSVAEERAGRKLAGLKVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHR
Sbjct  121  VNEDSTYKYFEVILVDAAHNAIRNDPRINWICNPVHKHR  159



>emb|CDP11952.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/141 (96%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkg  287
            MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  288  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  467
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDPA  120

Query  468  HAAIRNDPRINWLCNPVHKHR  530
            HAAIRNDPRI+W+C PVHKHR
Sbjct  121  HAAIRNDPRIHWICEPVHKHR  141



>ref|XP_005646118.1| ribosomal protein L15e [Coccomyxa subellipsoidea C-169]
 gb|EIE21574.1| ribosomal protein L15e [Coccomyxa subellipsoidea C-169]
Length=204

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELW++KQSDV+RFLLRVRCWEYRQLP IVR+T P+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELWKRKQSDVLRFLLRVRCWEYRQLPGIVRLTGPSRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRK+PV KGIVYGKP NQG+TQLK  R+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKKPVHKGIVYGKPVNQGITQLKPTRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+DSTYKYFE+ILVD AH  +R DPR+NW+ +PVHKHR
Sbjct  121  VNQDSTYKYFEIILVDIAHKVVREDPRVNWIVDPVHKHR  159



>ref|XP_004955578.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X1 [Setaria 
italica]
Length=238

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 152/193 (79%), Gaps = 34/193 (18%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKGIVYGKP +QGVTQLKFQR+KRSVAEERAGRK+GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGVTQLKFQRNKRSVAEERAGRKIGGLRVLNSYW  120

Query  414  INE----------------------------------DSTYKYFEVILVDTAHAAIRNDP  491
            +NE                                  DSTYKYFE+ILVD AHAAIRNDP
Sbjct  121  VNEVCWILWRNFLLEGSYCSCPIYFVLMPATVHLSTQDSTYKYFEIILVDVAHAAIRNDP  180

Query  492  RINWLCNPVHKHR  530
            RINWLC  VHKHR
Sbjct  181  RINWLCKDVHKHR  193



>ref|XP_011031911.1| PREDICTED: 60S ribosomal protein L15 isoform X3 [Populus euphratica]
Length=186

 Score =   230 bits (587),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 136/141 (96%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkg  287
            MRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  288  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  467
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDVA  120

Query  468  HAAIRNDPRINWLCNPVHKHR  530
            H AIRNDPRINWLCNPVHKHR
Sbjct  121  HNAIRNDPRINWLCNPVHKHR  141



>gb|KDO49939.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=186

 Score =   228 bits (582),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkg  287
            MRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  288  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  467
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILVDAA  120

Query  468  HAAIRNDPRINWLCNPVHKHR  530
            H AIRNDPRINW+C PVHKHR
Sbjct  121  HNAIRNDPRINWICKPVHKHR  141



>ref|XP_005845356.1| hypothetical protein CHLNCDRAFT_32281 [Chlorella variabilis]
 gb|EFN53254.1| hypothetical protein CHLNCDRAFT_32281 [Chlorella variabilis]
Length=204

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YV ELW+KKQSDV+RFLLRVRCWE+RQLP IVR+TRP+RPDKARR+G+KAKQGYV
Sbjct  1    MGAYKYVEELWKKKQSDVLRFLLRVRCWEFRQLPGIVRLTRPSRPDKARRMGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRK+PV KGIVYGKP +QGVTQLK  R+ +++AEER GRK GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKKPVSKGIVYGKPVHQGVTQLKPTRNLQNIAEERVGRKCGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+D+ YKYFEVILVD AH AIR D R+NW+CNPVHKHR
Sbjct  121  VNQDAVYKYFEVILVDPAHKAIRKDARVNWICNPVHKHR  159



>gb|KJB39740.1| hypothetical protein B456_007G028600 [Gossypium raimondii]
Length=186

 Score =   226 bits (575),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkg  287
            MRFL RVRCWEYRQ P+IVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPAIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  288  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  467
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEVILVDVA  120

Query  468  HAAIRNDPRINWLCNPVHKHR  530
            H AIRNDPRINW+CNPVHKHR
Sbjct  121  HNAIRNDPRINWICNPVHKHR  141



>emb|CBI25842.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   224 bits (571),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkg  287
            MRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  288  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  467
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEIILVDAA  120

Query  468  HAAIRNDPRINWLCNPVHKHR  530
            H  IRNDPRINW+C PVHKHR
Sbjct  121  HNTIRNDPRINWICKPVHKHR  141



>ref|XP_503229.1| 60S ribosomal protein L15 [Yarrowia lipolytica]
 emb|CAG81430.1| YALI0D24387p [Yarrowia lipolytica CLIB122]
Length=203

 Score =   224 bits (572),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ E+ RKKQSDV+RFLLRVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEEIHRKKQSDVLRFLLRVRCWEYRQKTGIHRASRPSRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRG RKRP  KG  YGKPTNQG+ QLK QRS R+VAEER GR+ G LRVLNSYW
Sbjct  61   IYRVRVRRGNRKRPSKKGATYGKPTNQGINQLKLQRSLRAVAEERVGRRAGNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+DSTYKYFEVILVD +H  IRNDPRINW+CNPVHKHR
Sbjct  121  VNQDSTYKYFEVILVDPSHVVIRNDPRINWICNPVHKHR  159



>ref|XP_005717822.1| 60S ribosomal protein L15, partial [Chondrus crispus]
 emb|CDF37953.1| 60S ribosomal protein L15, partial [Chondrus crispus]
Length=216

 Score =   225 bits (573),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +3

Query  36   FSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYK  215
             ++ + MGAY Y+ ELWR KQSDVMRF+LRVR WEYRQLPSI R +RPTRP+KARRLGYK
Sbjct  7    LTTNSNMGAYKYMEELWRHKQSDVMRFMLRVRAWEYRQLPSIHRASRPTRPEKARRLGYK  66

Query  216  AKQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  395
            +KQG+VVYRVRVRRGGRKRPV KGI YGKP +QG+T+LKF+R+KR+VAEERAGR+ G LR
Sbjct  67   SKQGFVVYRVRVRRGGRKRPVKKGIQYGKPKHQGITELKFKRNKRAVAEERAGRRCGNLR  126

Query  396  VLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            VLNSYW+NED+ YKYFE+ILVD +H AIRNDPR+NWL  PV KHR
Sbjct  127  VLNSYWVNEDAAYKYFEIILVDPSHNAIRNDPRLNWLARPVMKHR  171



>ref|XP_010919628.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Elaeis guineensis]
Length=186

 Score =   224 bits (570),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkg  287
            MRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  288  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  467
            IVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDAA  120

Query  468  HAAIRNDPRINWLCNPVHKHR  530
            H AIRNDPRINW+C  VHKHR
Sbjct  121  HNAIRNDPRINWICKGVHKHR  141



>emb|CDX76573.1| BnaA08g08270D [Brassica napus]
Length=186

 Score =   223 bits (567),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkg  287
            MRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  288  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  467
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  468  HAAIRNDPRINWLCNPVHKHR  530
            H AIRNDPRINW+CNPVHKHR
Sbjct  121  HNAIRNDPRINWICNPVHKHR  141



>ref|XP_004152396.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 ref|XP_004158133.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
Length=186

 Score =   222 bits (566),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkg  287
            MRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  288  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  467
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDVA  120

Query  468  HAAIRNDPRINWLCNPVHKHR  530
            H A+RNDPRINW+CNPVHK R
Sbjct  121  HNAVRNDPRINWICNPVHKRR  141



>emb|CDY59531.1| BnaCnng35130D [Brassica napus]
Length=186

 Score =   222 bits (565),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkg  287
            MRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  288  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  467
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  468  HAAIRNDPRINWLCNPVHKHR  530
            H A+RNDPRINW+CNPVHKHR
Sbjct  121  HNAVRNDPRINWICNPVHKHR  141



>emb|CDY09632.1| BnaC07g34290D [Brassica napus]
 emb|CDX90478.1| BnaA03g43030D [Brassica napus]
Length=186

 Score =   222 bits (565),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkg  287
            MRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  288  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  467
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  468  HAAIRNDPRINWLCNPVHKHR  530
            H A+RNDPRINW+CNPVHKHR
Sbjct  121  HNAVRNDPRINWICNPVHKHR  141



>ref|XP_011401241.1| 60S ribosomal protein L15 [Auxenochlorella protothecoides]
 gb|KFM28228.1| 60S ribosomal protein L15 [Auxenochlorella protothecoides]
Length=437

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELW+KKQSDV+RFLLRVRCWEYRQLPSIVR+T PTRPDKARR+GYKAKQGYV
Sbjct  1    MGAYKYIEELWKKKQSDVLRFLLRVRCWEYRQLPSIVRLTGPTRPDKARRMGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRK+PVPKGIVYGKP NQG+TQLK  R+  ++AEER GRK GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKKPVPKGIVYGKPVNQGITQLKPTRNLANLAEERVGRKCGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+D+ YKYFEVILVD  H AIRND RINW+ NPVHKHR
Sbjct  121  VNQDAVYKYFEVILVDPFHKAIRNDARINWIANPVHKHR  159



>emb|CEG01197.1| Ribosomal protein L15e, conserved site [Ostreococcus tauri]
Length=204

 Score =   222 bits (566),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YV ELW+KKQSDVMRFL R+R WEYRQLPSI RVTRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVEELWKKKQSDVMRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR RVRRGGRKRPVPKG VYGKP + G+T+LKF R+ RSVAEERA R+ G LRVLNSYW
Sbjct  61   IYRARVRRGGRKRPVPKGQVYGKPVHCGITKLKFARNLRSVAEERAARRCGALRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+DS YKY+EVI+VD  H  IRNDPRINW+CNP HKHR
Sbjct  121  LNQDSVYKYYEVIMVDPMHKCIRNDPRINWICNPTHKHR  159



>tpg|DAA62721.1| TPA: hypothetical protein ZEAMMB73_667917 [Zea mays]
Length=186

 Score =   222 bits (565),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkg  287
            MRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  288  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  467
            IVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILVD A
Sbjct  61   IVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILVDVA  120

Query  468  HAAIRNDPRINWLCNPVHKHR  530
            H AIRNDPRINWLCNPVHKHR
Sbjct  121  HTAIRNDPRINWLCNPVHKHR  141



>ref|XP_004348091.1| ribosomal protein L15 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93479.1| ribosomal protein L15 [Capsaspora owczarzaki ATCC 30864]
Length=204

 Score =   222 bits (566),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ EL++KKQSDV+RFL+R+RCW+YRQLP+I R +RPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYLEELYKKKQSDVLRFLVRLRCWQYRQLPAIHRASRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+R+RRGGRKRPV KGI+YGKP  QGVTQLK QRS R++AEER GR +GGLRVLNSYW
Sbjct  61   IYRIRLRRGGRKRPVFKGIIYGKPAAQGVTQLKNQRSHRAIAEERIGRAIGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            I +DST+KY+EVI+VDTAH AIR DPRINW+C  VHKHR
Sbjct  121  ICQDSTFKYYEVIMVDTAHKAIRRDPRINWICENVHKHR  159



>ref|XP_001416062.1| Ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO94354.1| Ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=204

 Score =   222 bits (566),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YV ELW+KKQSDVMRFL R+R WEYRQLPSI RVTRPTRPDKARRLGYKAKQG+ 
Sbjct  1    MGAYKYVEELWKKKQSDVMRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFC  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR RVRRGGRKRPV KG VYGKP + G+T+LKF R+ RSVAEERA R+ G LRVLNSYW
Sbjct  61   IYRARVRRGGRKRPVAKGQVYGKPVHCGITKLKFARNLRSVAEERAARRCGALRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+DS YKY+EVI+VD  H  +RNDPRINW+CNP HKHR
Sbjct  121  LNQDSVYKYYEVIMVDPMHKCVRNDPRINWICNPTHKHR  159



>gb|AAT85124.1| putative 60s ribosomal protein L15 [Oryza sativa Japonica Group]
Length=186

 Score =   221 bits (564),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkg  287
            MRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  288  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  467
            IVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILVD A
Sbjct  61   IVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILVDVA  120

Query  468  HAAIRNDPRINWLCNPVHKHR  530
            H+AIRNDPRINWLC PVHKHR
Sbjct  121  HSAIRNDPRINWLCKPVHKHR  141



>emb|CBI38664.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkg  287
            MRFL RVRCWEYRQ PSIV  TRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVCATRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  288  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  467
            IVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYWINEDSTYKYYEVILVDAA  120

Query  468  HAAIRNDPRINWLCNPVHKHR  530
            H AIRNDPRINW+C PVHKHR
Sbjct  121  HNAIRNDPRINWICKPVHKHR  141



>ref|XP_005703122.1| 60S ribosomal protein L15e isoform 2 [Galdieria sulphuraria]
 ref|XP_005703123.1| 60S ribosomal protein L15e isoform 1 [Galdieria sulphuraria]
 gb|EME26602.1| 60S ribosomal protein L15e isoform 2 [Galdieria sulphuraria]
 gb|EME26603.1| 60S ribosomal protein L15e isoform 1 [Galdieria sulphuraria]
Length=204

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELWRKKQSDVMRFLLRVR WEYR LPS+ R +RPTRPDKAR LGYKAKQG+V
Sbjct  1    MGAYKYMQELWRKKQSDVMRFLLRVRAWEYRHLPSVHRASRPTRPDKARMLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKGI YGKP NQG+TQLKF+R+KRSVAEERAGR+ G LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIQYGKPKNQGITQLKFKRNKRSVAEERAGRRCGNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+D  YKYFEVILVD  H AIR DPRI+W+C P  KHR
Sbjct  121  INQDGIYKYFEVILVDPNHKAIRRDPRIHWICKPTMKHR  159



>gb|EMT29287.1| 60S ribosomal protein L15 [Aegilops tauschii]
Length=261

 Score =   222 bits (566),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  57   GAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvv  236
            GAY +VSELWR+KQSDVMRF+ RVRCWEYR  P+IVR+TRP RPD+ARRLG+KAKQGYVV
Sbjct  59   GAYKFVSELWRRKQSDVMRFVQRVRCWEYRLQPAIVRITRPPRPDRARRLGFKAKQGYVV  118

Query  237  yrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWI  416
            YR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+
Sbjct  119  YRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWV  178

Query  417  NEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            NEDSTYKYFEVILVD AH+A+RNDPRINWLC PVHKHR
Sbjct  179  NEDSTYKYFEVILVDVAHSAVRNDPRINWLCKPVHKHR  216



>ref|XP_003056552.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59928.1| predicted protein [Micromonas pusilla CCMP1545]
Length=204

 Score =   218 bits (556),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YV ELW+KKQSDV+RFL RVR WEYRQLPS+ RVTRPTRPDKARRLGYKAKQG+ 
Sbjct  1    MGAYKYVEELWKKKQSDVLRFLQRVRVWEYRQLPSVCRVTRPTRPDKARRLGYKAKQGFC  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYR RVRRGGRKRPV KGI YGKP +QGV +LKF R+ RSVAEER  R+ G LRVLNSYW
Sbjct  61   VYRARVRRGGRKRPVSKGIRYGKPVHQGVKKLKFARNLRSVAEERTARRCGALRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDS YKY+EVI+VD  H  IR DPRINW+C PVHKHR
Sbjct  121  LNEDSVYKYYEVIMVDPMHKVIRGDPRINWICAPVHKHR  159



>ref|XP_003382517.1| PREDICTED: 60S ribosomal protein L15-like [Amphimedon queenslandica]
Length=204

 Score =   218 bits (556),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YV ELWRKKQSD++RFLLRVRCW+YRQL  + R  RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVQELWRKKQSDLLRFLLRVRCWQYRQLNVLHRAPRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+RVRRGGRKR   KG  YGKPTNQGV +LKFQRS +SVAEER GR  GGLRVLNSYW
Sbjct  61   IYRIRVRRGGRKRKARKGATYGKPTNQGVNELKFQRSLQSVAEERVGRHCGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            + +DST+K++EVILVD AH  IR DPR NW+C PVHKHR
Sbjct  121  VGQDSTFKFYEVILVDPAHKVIRQDPRTNWICRPVHKHR  159



>gb|EPE06282.1| 60s ribosomal protein l15 [Ophiostoma piceae UAMH 11346]
Length=203

 Score =   218 bits (555),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL ++KQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKRKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRK+PV KG  YGKPTNQGV QLK+QRS +S AEER GR+ G LRVLNSYW
Sbjct  61   IYRVRVRRGGRKKPVRKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCGNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+DSTYKYFEVILVD  HAAIR DPRINW+ NPVHKHR
Sbjct  121  VNQDSTYKYFEVILVDPQHAAIRRDPRINWIVNPVHKHR  159



>gb|KDD73446.1| ribosomal L15, partial [Helicosporidium sp. ATCC 50920]
Length=200

 Score =   218 bits (554),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELW+KKQSDV+RFLLRVRCWE+RQLP IVR+T P+RPDKARR+GYKAKQGYV
Sbjct  1    MGAYKYIEELWKKKQSDVLRFLLRVRCWEFRQLPRIVRLTGPSRPDKARRMGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRK+PV KGIVYGKP NQG+TQLK +R+ ++++E R GR   GLRVLNSYW
Sbjct  61   IYRVRVRRGGRKKPVAKGIVYGKPVNQGITQLKPRRNLQAISEGRVGRACRGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+D+++KY+EVI+VD AH  IRNDP INW+CNPVHKHR
Sbjct  121  VNQDASHKYYEVIMVDPAHTVIRNDPHINWICNPVHKHR  159



>gb|KIY95038.1| 60S ribosomal protein L15-1 [Monoraphidium neglectum]
Length=198

 Score =   217 bits (553),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELWR+KQSDV+RFLLRVRCWE+RQLP IVR+ RP+RPDKARR+G+KAKQGYV
Sbjct  1    MGAYKYIEELWRRKQSDVLRFLLRVRCWEFRQLPGIVRLNRPSRPDKARRMGFKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPV KGIVYGKP NQG+TQLK  R+ R+VAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPVNQGITQLKASRNLRNVAEERAGRRLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWL  506
            +NEDS YKYFEVILVD  H AIRND RINW+
Sbjct  121  VNEDSAYKYFEVILVDPNHNAIRNDARINWI  151



>ref|XP_001624083.1| predicted protein [Nematostella vectensis]
 gb|EDO31983.1| predicted protein [Nematostella vectensis]
Length=204

 Score =   217 bits (553),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ EL++KKQSD++RFLLRVRCW+YRQL +I R TRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELYKKKQSDLLRFLLRVRCWQYRQLTAIHRATRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKP NQGV +LKFQRS RSVAEERAGR  GGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPVNQGVNELKFQRSLRSVAEERAGRYCGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            + +DS YKYFEVI+VD  H AIR D RINW+C P HKHR
Sbjct  121  VGQDSIYKYFEVIMVDPFHKAIRRDARINWICKPTHKHR  159



>gb|ERS96332.1| 60S ribosomal protein L15 [Sporothrix schenckii ATCC 58251]
Length=203

 Score =   216 bits (551),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL ++KQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKRKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRK+PV KG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKKPVRKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFEVILVD  HAAIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEVILVDPQHAAIRRDPRINWIVNPVHKHR  159



>gb|EFX04788.1| 60S ribosomal protein l15 [Grosmannia clavigera kw1407]
Length=203

 Score =   216 bits (550),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL ++KQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKRKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR RVRRGGRK+PV KG  +GKPTNQGV QLK+QRS +S AEER GR+ G LRVLNSYW
Sbjct  61   IYRARVRRGGRKKPVAKGATFGKPTNQGVNQLKYQRSLKSTAEERVGRRCGNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+DSTYKY+EVILVD  HAAIR DPRINW+ NPVHKHR
Sbjct  121  VNQDSTYKYYEVILVDPNHAAIRRDPRINWIVNPVHKHR  159



>gb|ESW97334.1| 60S ribosomal protein L15-B [Ogataea parapolymorpha DL-1]
Length=204

 Score =   216 bits (549),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ EL RKKQSDVMRFLLR+RCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLLRIRCWEYRQKTVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            ++R+RVRRGGRKRPVPKG  YGKPTNQGV QLK+Q++ RS AEER GRK   LRVLNSYW
Sbjct  61   IFRIRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQKALRSTAEERVGRKAANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +NEDSTYKY+EVI VD  H AIR DPR NW+CNPVHKHR
Sbjct  121  VNEDSTYKYYEVICVDPQHKAIRRDPRYNWICNPVHKHR  159



>gb|ACR24948.1| ribosomal protein L15 [Lepidochitona cinerea]
Length=204

 Score =   216 bits (549),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ EL+RKKQSDV+RFLLR+R W+YRQL S+ R +RPTRPDKARRLGY+AKQGYV
Sbjct  1    MGAYKYMQELYRKKQSDVLRFLLRIRSWQYRQLASVHRASRPTRPDKARRLGYRAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKP NQGV QLKFQRS +SVAEER GRK  GLRVL+SYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPVNQGVNQLKFQRSLQSVAEERVGRKCQGLRVLSSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            + +DSTYK+FE+++VD  H AIR DP+INWLCNPVHKHR
Sbjct  121  VAQDSTYKFFEIVMVDPFHKAIRRDPKINWLCNPVHKHR  159



>gb|KEQ99844.1| hypothetical protein AUEXF2481DRAFT_25720 [Aureobasidium subglaciale 
EXF-2481]
Length=253

 Score =   217 bits (553),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  30   KNFSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLG  209
            K  S+   MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLG
Sbjct  43   KQQSNTDKMGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLG  102

Query  210  YKAKQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGG  389
            YKAKQGYV+YRVRVRRGGRKRPVPKG  YGKPTNQGV QLKFQRS RSVAEER GR+   
Sbjct  103  YKAKQGYVIYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKFQRSLRSVAEERVGRRCAN  162

Query  390  LRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            LRVLNSYWIN+DSTYKYFE+ILVD  H AIR D RINW+ NPVHKHR
Sbjct  163  LRVLNSYWINQDSTYKYFEIILVDPQHKAIRKDARINWIVNPVHKHR  209



>ref|XP_008713401.1| 60S ribosomal protein L15 [Cyphellophora europaea CBS 101466]
 gb|ETN44328.1| 60S ribosomal protein L15 [Cyphellophora europaea CBS 101466]
Length=203

 Score =   215 bits (548),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDVMRFLLRVRCWE RQL  I R TRP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELHKKKQSDVMRFLLRVRCWELRQLNVIHRATRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRP PKG  YGKPTNQG+ QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPAPKGATYGKPTNQGINQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRKDPRINWIVNPVHKHR  159



>ref|XP_002162844.1| PREDICTED: 60S ribosomal protein L15-like [Hydra vulgaris]
Length=204

 Score =   215 bits (548),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ EL++KKQSD++RFL R+RCW+ R L +I R +RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELYKKKQSDLLRFLFRIRCWQLRHLNAIHRASRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPV KGI YGKP  +GV QLKFQRS RSVAEERAGR  GGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVAKGITYGKPKGEGVNQLKFQRSIRSVAEERAGRYCGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            I +DSTYKYFEVI+VD AH A+R DPRINW+C  VHKHR
Sbjct  121  IAQDSTYKYFEVIMVDPAHKAVRRDPRINWICKAVHKHR  159



>ref|XP_006822011.1| PREDICTED: 60S ribosomal protein L15-like isoform X1 [Saccoglossus 
kowalevskii]
 ref|XP_006822012.1| PREDICTED: 60S ribosomal protein L15-like isoform X2 [Saccoglossus 
kowalevskii]
Length=204

 Score =   215 bits (547),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ E+W+KKQSD MRFLLRVRCW+YRQL +I R  RPTRPDKARRLGY+AKQGYV
Sbjct  1    MGAYKYMQEVWKKKQSDAMRFLLRVRCWQYRQLTAIHRAPRPTRPDKARRLGYRAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+R+RRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S+AEERAGR+ GGLRVLNSYW
Sbjct  61   IYRIRLRRGGRKRPVPKGATYGKPTNQGVNQLKWQRSLQSLAEERAGRRCGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            + +DSTYK+FEVI+VD  H AIR +P   W+CNPVHKHR
Sbjct  121  VGQDSTYKFFEVIMVDPFHKAIRRNPDTQWICNPVHKHR  159



>emb|CEJ94099.1| Putative Ribosomal protein L15 [Torrubiella hemipterigena]
Length=203

 Score =   215 bits (547),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDVMRFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRK+P  KG  YGKPTNQG+ QLK+QRS R+ AEER GR+   LRVLNSYW
Sbjct  61   VYRVRVRRGGRKKPARKGATYGKPTNQGINQLKYQRSLRATAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRIDPRINWIVNPVHKHR  159



>gb|AAX48848.1| L15, partial [Suberites domuncula]
Length=190

 Score =   214 bits (546),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELWRKKQSD++RFLLRVRCW++RQL S+ R   PTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELWRKKQSDLLRFLLRVRCWQFRQLNSVHRAPYPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKR V KG   GKPTNQGV QLKFQRS RSVAEERAGR  GGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRKVHKGHQMGKPTNQGVNQLKFQRSLRSVAEERAGRYCGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            + EDS YK+FEVILVD  H AIR D RINW+C  VHKHR
Sbjct  121  VAEDSVYKFFEVILVDPMHKAIRRDARINWICKSVHKHR  159



>gb|KIE03942.1| Ribosomal protein L15e, partial [Metarhizium majus ARSEF 297]
Length=203

 Score =   214 bits (546),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDVMRFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+EVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRIDPRINWIVNPVHKHR  159



>ref|XP_006690758.1| ribosomal protein L15-like protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS23516.1| ribosomal protein L15-like protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=203

 Score =   214 bits (545),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  Y+ EL +KKQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYLEELSKKKQSDVVRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS R+ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRCSNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+DSTYKY+EVILVD  H AIR DPRINW+CNPVHKHR
Sbjct  121  VNQDSTYKYYEVILVDPNHKAIRRDPRINWICNPVHKHR  159



>ref|XP_003075284.1| RL15B_PICMA 60S ribosomal protein L15-2 (ISS) [Ostreococcus tauri]
Length=217

 Score =   215 bits (547),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   YVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvr  248
            YV ELW+KKQSDVMRFL R+R WEYRQLPSI RVTRPTRPDKARRLGYKAKQG+V+YR R
Sbjct  18   YVEELWKKKQSDVMRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFVIYRAR  77

Query  249  vrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDS  428
            VRRGGRKRPVPKG VYGKP + G+T+LKF R+ RSVAEERA R+ G LRVLNSYW+N+DS
Sbjct  78   VRRGGRKRPVPKGQVYGKPVHCGITKLKFARNLRSVAEERAARRCGALRVLNSYWLNQDS  137

Query  429  TYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
             YKY+EVI+VD  H  IRNDPRINW+CNP HKHR
Sbjct  138  VYKYYEVIMVDPMHKCIRNDPRINWICNPTHKHR  171



>gb|AAF67144.1|AF230646_1 large subunit ribosomal protein L15 [Syntrichia ruralis]
Length=203

 Score =   214 bits (545),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELWR+KQSDV+RFLLRVRCWE+RQLP IVRVT    PDKARRLGY+  +   
Sbjct  1    MGAYKYIEELWRRKQSDVLRFLLRVRCWEFRQLPGIVRVT-AQPPDKARRLGYRPSRVTW  59

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
                       +   P+ +   KP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  60   CTVCVCAVEAGRGRWPRVLCMEKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  119

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFE+ILVD  H  IR DPRINW+ NPVHKHR
Sbjct  120  INQDSTYKYFEIILVDPQHKVIRKDPRINWIVNPVHKHR  158



>ref|XP_003233932.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 118892]
 gb|EGD89563.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 118892]
 gb|EGD98634.1| 60S ribosomal protein L15 [Trichophyton tonsurans CBS 112818]
 gb|EGE06831.1| ribosomal protein L15 [Trichophyton equinum CBS 127.97]
 gb|EZF24323.1| 60S ribosomal protein L15 [Trichophyton rubrum MR850]
 gb|EZF35746.1| 60S ribosomal protein L15 [Trichophyton interdigitale H6]
 gb|EZF43284.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 100081]
 gb|EZF53926.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 288.86]
 gb|EZF64574.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 289.86]
 gb|EZF75156.1| 60S ribosomal protein L15 [Trichophyton soudanense CBS 452.61]
 gb|EZF85853.1| 60S ribosomal protein L15 [Trichophyton rubrum MR1448]
 gb|EZF96634.1| 60S ribosomal protein L15 [Trichophyton rubrum MR1459]
 gb|EZG07762.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 735.88]
 gb|EZG18074.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 202.88]
 gb|KDB26559.1| 60S ribosomal protein L15 [Trichophyton interdigitale MR816]
 gb|KDB35118.1| 60S ribosomal protein L15 [Trichophyton rubrum D6]
Length=203

 Score =   214 bits (545),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDVMRFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+RVRRGGRKR   KG  YGKPTNQGV QLK+QRS RS AEER G++   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRTARKGATYGKPTNQGVNQLKYQRSLRSTAEERVGKRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+E+ILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYYEIILVDPQHKAIRKDPRINWIVNPVHKHR  159



>ref|XP_003488628.1| PREDICTED: 60S ribosomal protein L15-like [Bombus impatiens]
Length=221

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +3

Query  36   FSSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYK  215
            FS G AMGAY Y+ EL+RKKQSDV+RFLLRVRCW+YRQL  + R  RP+RPDKARRLGYK
Sbjct  12   FSQGFAMGAYKYMQELYRKKQSDVLRFLLRVRCWQYRQLTKMHRAPRPSRPDKARRLGYK  71

Query  216  AKQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  395
            AK+G+V++R+RVRRGGRKRPVPKG  YGKP + GV QLK  R  +SVAEER GR+ GGLR
Sbjct  72   AKEGFVIFRIRVRRGGRKRPVPKGATYGKPKSHGVNQLKPTRKLQSVAEERVGRRCGGLR  131

Query  396  VLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            VLNSYW+ +DS+YKY+EVIL+D AH AIRNDP++NW+CN VHKHR
Sbjct  132  VLNSYWVAQDSSYKYYEVILIDPAHKAIRNDPKVNWICNAVHKHR  176



>gb|KIV95599.1| 60S ribosomal protein L15 [Exophiala mesophila]
Length=203

 Score =   214 bits (544),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRAANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRRDPRINWIVNPVHKHR  159



>gb|KEF63356.1| 60S ribosomal protein L15 [Exophiala aquamarina CBS 119918]
Length=203

 Score =   214 bits (544),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRASNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRRDPRINWIVNPVHKHR  159



>gb|KEQ59346.1| 60S ribosomal protein L15 [Aureobasidium melanogenum CBS 110374]
 gb|KEQ71724.1| 60S ribosomal protein L15 [Aureobasidium pullulans var. namibiae 
CBS 147.97]
 gb|KEQ81902.1| 60S ribosomal protein L15 [Aureobasidium pullulans EXF-150]
Length=203

 Score =   213 bits (543),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLKFQRS RSVAEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKFQRSLRSVAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFE+ILVD  H AIR D RINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEIILVDPQHKAIRKDARINWIVNPVHKHR  159



>gb|EMS24660.1| 60S ribosomal protein l15 [Rhodosporidium toruloides NP11]
 emb|CDR35885.1| RHTO0S01e09384g1_1 [Rhodosporidium toruloides]
Length=201

 Score =   213 bits (543),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y++EL ++KQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLTELQKRKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRG RKRPVPKG  YGKPTNQGV QLKFQRS RS AEER  R+ G LRVLNSYW
Sbjct  61   VYRVRVRRGNRKRPVPKGATYGKPTNQGVNQLKFQRSLRSTAEERVARRCGNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+D  YKY+EVILVD +H AIR D RINW+CNPVHK R
Sbjct  121  INQDGVYKYYEVILVDPSHKAIRRDARINWICNPVHKRR  159



>ref|XP_008725811.1| 60S ribosomal protein L15 [Cladophialophora carrionii CBS 160.54]
 gb|ETI26466.1| 60S ribosomal protein L15 [Cladophialophora carrionii CBS 160.54]
Length=203

 Score =   213 bits (543),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEVILVDPNHKAIRRDPRINWIVNPVHKHR  159



>ref|XP_007511637.1| 60S ribosomal protein L15 [Bathycoccus prasinos]
 emb|CCO17758.1| 60S ribosomal protein L15 [Bathycoccus prasinos]
Length=204

 Score =   213 bits (543),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YV ELW+KKQSDV+RFL R+R WEYRQLPSI RVTRPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVEELWKKKQSDVLRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR RVRRGGRKRPV KGIV GKP + G+T+LKF R+ +SVAEERA R+ G LRVLNSYW
Sbjct  61   IYRARVRRGGRKRPVRKGIVNGKPVHCGITKLKFARNLKSVAEERAARRCGALRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+DS YKY+EVI+VD  H AIR+DPRINW+C P HK R
Sbjct  121  LNQDSVYKYYEVIMVDPMHKAIRSDPRINWICAPTHKGR  159



>ref|XP_007812013.1| 60S ribosomal protein L15 [Metarhizium acridum CQMa 102]
 ref|XP_007818066.1| Ribosomal protein L15e [Metarhizium robertsii ARSEF 23]
 gb|EFY88332.1| 60S ribosomal protein L15 [Metarhizium acridum CQMa 102]
 gb|EFZ02295.1| Ribosomal protein L15e [Metarhizium robertsii ARSEF 23]
 gb|EXV05475.1| ribosomal protein L15 [Metarhizium robertsii]
 gb|KFG82830.1| 60S ribosomal protein L15 [Metarhizium anisopliae]
 gb|KID67254.1| Ribosomal protein L15e, partial [Metarhizium anisopliae ARSEF 
549]
 gb|KID88474.1| Ribosomal protein L15e [Metarhizium guizhouense ARSEF 977]
Length=203

 Score =   213 bits (542),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDVMRFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+EVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRIDPRINWIVNPVHKHR  159



>gb|EWM27504.1| Ribosomal protein L15e [Nannochloropsis gaditana]
Length=205

 Score =   213 bits (542),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY ++ ELWRKKQ+D++RFLLRVR WEYRQLP I R+ RPTR DKA RLGYKAKQG+V
Sbjct  1    MGAYKFLEELWRKKQADLLRFLLRVRAWEYRQLPKIYRMNRPTRTDKAHRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRV VRRGGRKRP PKGIVYGKP NQG+ QLK+ R+ +S AEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVAVRRGGRKRPNPKGIVYGKPKNQGINQLKWVRNLKSKAEERAGRKLGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+D+TYKY+EVILVD  H AIR D R+NW+ NP HKHR
Sbjct  121  VNQDATYKYYEVILVDPQHKAIRRDARVNWIVNPTHKHR  159



>gb|ACU45020.1| 60s ribosomal protein L15 [Pfiesteria piscicida]
Length=204

 Score =   213 bits (542),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELWR+KQSDV+RFLLR+RCWE R LP + R TRPTRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYLQELWRRKQSDVLRFLLRIRCWELRHLPRVHRATRPTRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR RVRRGGRK+ V KG   GKP +QGV  LKFQRSK SVAEER GR  G LRVLNSYW
Sbjct  61   IYRSRVRRGGRKKRVAKGNTDGKPKHQGVNHLKFQRSKASVAEERVGRVCGNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+DST+KY+EVI VD +H AIRNDPRINW+  PVHKHR
Sbjct  121  VNQDSTFKYYEVICVDPSHNAIRNDPRINWITKPVHKHR  159



>emb|CEI91883.1| Putative Ribosomal protein L15 [Rhizopus microsporus]
Length=204

 Score =   213 bits (541),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ EL RKKQSDV RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYLEELARKKQSDVSRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+RVRRGGRKRPVPKG  YGKP N+GV QLK+QRS RS AEER GRK   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPVNEGVNQLKYQRSLRSTAEERVGRKCRNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+D+TYKY+EVILVD +H AIRNDPRINW+ NPVHK R
Sbjct  121  INQDATYKYYEVILVDPSHKAIRNDPRINWIVNPVHKRR  159



>gb|KID77747.1| Ribosomal protein L15e, partial [Metarhizium brunneum ARSEF 3297]
Length=203

 Score =   213 bits (541),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDVMRFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+E+ILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYYEIILVDPQHKAIRIDPRINWIVNPVHKHR  159



>gb|KIN02516.1| hypothetical protein OIDMADRAFT_18358 [Oidiodendron maius Zn]
Length=203

 Score =   213 bits (541),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFE+ILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEIILVDPQHKAIRRDPRINWIVNPVHKHR  159



>ref|XP_009691154.1| 60S ribosomal protein L15 [Theileria orientalis strain Shintoku]
 dbj|BAM40853.1| 60S ribosomal protein L15 [Theileria orientalis strain Shintoku]
Length=204

 Score =   213 bits (541),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ ELWRKKQSDVMR LLRVR WEYRQLP++ RVT+PTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYRYLEELWRKKQSDVMRTLLRVRTWEYRQLPALHRVTKPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            ++RVRVRRG RK+ V  GIVYGKP +QG+ + K +R+ RSVAEER GR+ GGLRVLNSYW
Sbjct  61   IFRVRVRRGDRKKNVANGIVYGKPKHQGIRKQKSKRNLRSVAEERVGRRCGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            + +D  YK++EVILVD AH A+RN+PR+N+LC PVHKHR
Sbjct  121  VGQDEVYKFYEVILVDPAHNAVRNNPRLNYLCKPVHKHR  159



>ref|XP_007925894.1| hypothetical protein MYCFIDRAFT_58365 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME83067.1| hypothetical protein MYCFIDRAFT_58365 [Pseudocercospora fijiensis 
CIRAD86]
Length=203

 Score =   213 bits (541),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA+ Y+ EL +KKQSDVMRFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAHKYLEELQKKKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+E+ILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYYEIILVDPQHKAIRKDPRINWIVNPVHKHR  159



>ref|XP_007373844.1| hypothetical protein SPAPADRAFT_59682 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW34260.1| hypothetical protein SPAPADRAFT_59682 [Spathaspora passalidarum 
NRRL Y-27907]
Length=204

 Score =   212 bits (540),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            ++RVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+ G LRVLNSYW
Sbjct  61   IFRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRAGNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFEVILVD +H AIR D R NW+  PVHKHR
Sbjct  121  INQDSTYKYFEVILVDPSHKAIRRDARYNWITEPVHKHR  159



>ref|XP_009159952.1| 60S ribosomal protein L15 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY59491.1| 60S ribosomal protein L15 [Exophiala dermatitidis NIH/UT8656]
Length=203

 Score =   212 bits (540),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS R+ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRRDPRINWIVNPVHKHR  159



>gb|KHN95867.1| Ribosomal protein L15e [Metarhizium album ARSEF 1941]
Length=203

 Score =   212 bits (540),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDVMRFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN DSTYKY+EVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INRDSTYKYYEVILVDPQHKAIRIDPRINWIVNPVHKHR  159



>ref|XP_002545593.1| 60S ribosomal protein L15-B [Candida tropicalis MYA-3404]
 gb|EER35635.1| 60S ribosomal protein L15-B [Candida tropicalis MYA-3404]
Length=204

 Score =   212 bits (539),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRASNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+DSTYKYFEVILVD +H AIR D R NW+ NPVHKHR
Sbjct  121  VNQDSTYKYFEVILVDPSHKAIRRDARYNWIANPVHKHR  159



>gb|KIX01331.1| 60S ribosomal protein L15 [Rhinocladiella mackenziei CBS 650.93]
Length=203

 Score =   212 bits (539),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+EVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRRDPRINWIVNPVHKHR  159



>ref|XP_007762548.1| ribosomal protein L15e [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86683.1| ribosomal protein L15e [Coniophora puteana RWD-64-598 SS2]
Length=201

 Score =   212 bits (539),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YV+EL++KKQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVTELYKKKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRG RK+PVPKG  YGKP  QGV  LKFQR  RSVAEER GR+ G LRVLNSYW
Sbjct  61   IYRVRVRRGNRKKPVPKGATYGKPVRQGVNHLKFQRGLRSVAEERVGRRCGNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+D  YKY+EVILVD +H AIR DPRINW+ NPVHK R
Sbjct  121  INQDGVYKYYEVILVDPSHKAIRRDPRINWIVNPVHKRR  159



>gb|KFY50714.1| hypothetical protein V496_09238 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY98331.1| hypothetical protein V498_01520 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=219

 Score =   213 bits (541),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  39   SSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKA  218
            S+   MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKA
Sbjct  12   STARLMGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKA  71

Query  219  KQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  398
            KQGYV+YRVRVRRGGRK+PV KG  +GKPTNQGV QLK+QRS +S AEER GR+   LRV
Sbjct  72   KQGYVIYRVRVRRGGRKKPVSKGATFGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRV  131

Query  399  LNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            LNSYWIN+DSTYKYFEVILVD  H AIR DPRINW+  PVHKHR
Sbjct  132  LNSYWINQDSTYKYFEVILVDPQHKAIRRDPRINWIVAPVHKHR  175



>gb|EIE79210.1| 60S ribosomal protein L15 [Rhizopus delemar RA 99-880]
 gb|EIE81685.1| 60S ribosomal protein L15 [Rhizopus delemar RA 99-880]
 gb|EIE82356.1| 60S ribosomal protein L15 [Rhizopus delemar RA 99-880]
 gb|EIE85034.1| 60S ribosomal protein L15 [Rhizopus delemar RA 99-880]
Length=204

 Score =   212 bits (539),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ EL RKKQSDV RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYLEELARKKQSDVSRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+RVRRGGRKRPVPKG  YGKP N+GV+QLK+QRS RS AEER GRK   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPVNEGVSQLKYQRSLRSTAEERVGRKCRNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+D+TYKYFEVILVD +H AIRND RINW+ NPVHK R
Sbjct  121  INQDATYKYFEVILVDPSHKAIRNDARINWIVNPVHKRR  159



>ref|XP_007671745.1| hypothetical protein BAUCODRAFT_566278 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMD00561.1| hypothetical protein BAUCODRAFT_566278 [Baudoinia compniacensis 
UAMH 10762]
Length=203

 Score =   211 bits (538),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA+ Y+ EL +KKQSDVMRFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAHKYLEELAKKKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRK+PVPKG  +GKPTNQGV QLKFQRS +S AEER G++   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKKPVPKGATFGKPTNQGVNQLKFQRSLKSTAEERVGKRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+EVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYYEVILVDPEHKAIRRDPRINWIVNPVHKHR  159



>gb|EFZ14326.1| hypothetical protein SINV_15101 [Solenopsis invicta]
Length=207

 Score =   212 bits (539),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +3

Query  45   GTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQ  224
            G AMGAY Y+ EL+RKKQSDV+RFLLRVRCW+YRQL  + R  RP+RPDKARRLGYKAKQ
Sbjct  1    GFAMGAYKYMQELYRKKQSDVLRFLLRVRCWQYRQLTKMHRAPRPSRPDKARRLGYKAKQ  60

Query  225  gyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLN  404
            G+V++R+RVRRGGRKRPVPKG  YGKP + GV QLK  R  +SVAEER GR+ GGLRVLN
Sbjct  61   GFVIFRIRVRRGGRKRPVPKGATYGKPKSHGVNQLKPTRKLQSVAEERVGRRCGGLRVLN  120

Query  405  SYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            SYW+ +DS+YKY+EVIL+D AH AIRNDP++NW+CN VHKHR
Sbjct  121  SYWVAQDSSYKYYEVILIDPAHKAIRNDPKVNWICNAVHKHR  162



>gb|EQL00837.1| Ribosomal protein L15e [Ophiocordyceps sinensis CO18]
Length=203

 Score =   211 bits (538),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDVMRFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPV KG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVRKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+E+ILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYYEIILVDPQHKAIRIDPRINWIVNPVHKHR  159



>ref|XP_009226880.1| 60S ribosomal protein L15 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
 gb|EJT71483.1| 60S ribosomal protein L15 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
Length=203

 Score =   211 bits (538),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSD++RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDILRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+EVILVD  H AIR DPRI+W+ NPVHKHR
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRRDPRISWIVNPVHKHR  159



>gb|KIW41910.1| 60S ribosomal protein L15 [Exophiala oligosperma]
Length=264

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 143/177 (81%), Gaps = 2/177 (1%)
 Frame = +3

Query  6    SEF*FPEPKNF--SSGTAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRP  179
            + F  P+ ++   +    MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP
Sbjct  44   TTFLLPQHQSLRQAQTVKMGALKYVEELHKKKQSDVLRFLLRVRCWELRQLKVIHRASRP  103

Query  180  TRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVA  359
            +RPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S A
Sbjct  104  SRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTA  163

Query  360  EERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            EER GR+   LRVLNSYWIN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  164  EERVGRRCANLRVLNSYWINQDSTYKYFEVILVDPQHKAIRRDPRINWIVNPVHKHR  220



>ref|XP_008558014.1| PREDICTED: 60S ribosomal protein L15 [Microplitis demolitor]
Length=204

 Score =   211 bits (538),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY+Y+SEL+RKKQ DVMRF+LRVRCW+YRQL  + R  RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYSYMSELYRKKQGDVMRFVLRVRCWQYRQLTKLHRAPRPSRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+RVRRGGRKRPVPKG  +GKP + GV +LK  R  +SVAEER GR+ GGLRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATFGKPKSHGVNELKPTRKLQSVAEERVGRRCGGLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            + +DS+YKY+EVILVD AH AIRNDP++NWLCNPVHKHR
Sbjct  121  VAQDSSYKYYEVILVDPAHKAIRNDPKVNWLCNPVHKHR  159



>gb|KIX93106.1| 60S ribosomal protein L15 [Fonsecaea multimorphosa CBS 102226]
Length=203

 Score =   211 bits (538),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+RVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+E+ILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYYEIILVDPNHKAIRRDPRINWIVNPVHKHR  159



>ref|XP_007759046.1| 60S ribosomal protein L15 [Cladophialophora yegresii CBS 114405]
 gb|EXJ56512.1| 60S ribosomal protein L15 [Cladophialophora yegresii CBS 114405]
Length=203

 Score =   211 bits (537),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFEVILVD  H AIR DPRI+W+ NPVHKHR
Sbjct  121  INQDSTYKYFEVILVDPNHKAIRRDPRISWIVNPVHKHR  159



>emb|CDH60822.1| 60s ribosomal protein l15 [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS02934.1| Putative Ribosomal protein L15 [Absidia idahoensis var. thermophila]
Length=204

 Score =   211 bits (538),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ EL+RKKQSDV RFLLRVRCWEYRQL  + R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYLEELYRKKQSDVFRFLLRVRCWEYRQLNVVHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+RVRRGGRKRPVPKG  YGKP N+GV+QLK+QRS RS AEER GRK   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPVNEGVSQLKYQRSLRSTAEERVGRKCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+D+TYKYFEVILVD +H AIR D RINW+ NPVHK R
Sbjct  121  INQDATYKYFEVILVDPSHKAIRRDARINWIVNPVHKRR  159



>ref|XP_957199.1| 60S ribosomal protein L15 [Neurospora crassa OR74A]
 ref|XP_009852151.1| hypothetical protein NEUTE1DRAFT_117386 [Neurospora tetrasperma 
FGSC 2508]
 sp|Q8X034.1|RL15_NEUCR RecName: Full=60S ribosomal protein L15 [Neurospora crassa OR74A]
 emb|CAD21192.1| probable ribosomal protein L15.e.B, cytosolic [Neurospora crassa]
 gb|EAA27963.1| 60S ribosomal protein L15 [Neurospora crassa OR74A]
 gb|EGO56565.1| hypothetical protein NEUTE1DRAFT_117386 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ70567.1| putative ribosomal protein L15.e.B, cytosolic [Neurospora tetrasperma 
FGSC 2509]
 gb|KHE83595.1| hypothetical protein GE21DRAFT_3246 [Neurospora crassa]
Length=203

 Score =   211 bits (537),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  Y+ EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYLEELQKKKQSDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR RVRRGGRK+PVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRARVRRGGRKKPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFEVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRRDPRINWIVNPVHKHR  159



>gb|KIW07591.1| 60S ribosomal protein L15 [Verruconis gallopava]
Length=203

 Score =   211 bits (537),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  Y+ EL ++KQSDVMRFLLRVRCWEYRQ   I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYIEELQKRKQSDVMRFLLRVRCWEYRQRHVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+RVRRGGRKRP PKG  YGKPTNQG+ QLK+QRS R+ AEER GR+   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPAPKGATYGKPTNQGINQLKYQRSLRATAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+EVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRRDPRINWIVNPVHKHR  159



>ref|XP_001265199.1| 60S ribosomal protein L15 [Neosartorya fischeri NRRL 181]
 gb|EAW23302.1| 60S ribosomal protein L15 [Neosartorya fischeri NRRL 181]
Length=203

 Score =   211 bits (537),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV E+ +KKQSDV+RFLLRVRCWE RQL +I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEEIQKKKQSDVIRFLLRVRCWELRQLNAIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            VYRVRVRRGGRKRPVPKG  YGKPTN GV QLK+QR+ R+ AEER GR+   LRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGATYGKPTNMGVNQLKYQRALRATAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFEVILVD  H AIR DPRINW+CN VHKHR
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRRDPRINWICNAVHKHR  159



>gb|KIK92970.1| hypothetical protein PAXRUDRAFT_829457 [Paxillus rubicundulus 
Ve08.2h10]
Length=201

 Score =   211 bits (536),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+SEL++KKQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGY 
Sbjct  1    MGAYKYISELYKKKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYA  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRG RK+PVPKG  YGKP  QGV  LKFQRS RSVAEER GR+ G LRVLNSYW
Sbjct  61   IYRVRVRRGNRKKPVPKGATYGKPVRQGVNHLKFQRSLRSVAEERVGRRCGNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+D  YKY+EVILVD  H AIR DPRINW+  PVHK R
Sbjct  121  INQDGVYKYYEVILVDPNHKAIRRDPRINWIAKPVHKRR  159



>ref|XP_006965992.1| 60s ribosomal protein L152/L15B [Trichoderma reesei QM6a]
 gb|EGR47918.1| 60s ribosomal protein L152/L15B [Trichoderma reesei QM6a]
 gb|ETS02075.1| 60S ribosomal protein l15 [Trichoderma reesei RUT C-30]
Length=203

 Score =   211 bits (536),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSD++RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDLVRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRP PKG  YGKPTNQG+ QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPAPKGATYGKPTNQGINQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+EVILVD +H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYYEVILVDPSHKAIRIDPRINWIVNPVHKHR  159



>gb|KIW20891.1| 60S ribosomal protein L15 [Exophiala spinifera]
Length=203

 Score =   211 bits (536),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELHKKKQSDVLRFLLRVRCWELRQLKVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+DSTYKY+EVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  VNQDSTYKYYEVILVDPQHKAIRKDPRINWIVNPVHKHR  159



>emb|CCA75151.1| probable RPL15A 60S large subunit ribosomal protein L15.e [Piriformospora 
indica DSM 11827]
Length=201

 Score =   211 bits (536),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY YV EL++KKQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGY+
Sbjct  1    MGAYKYVGELYKKKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYL  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+RVRRG RK+PVPKG  YGKP  QGV  LKFQR  RSVAEER GR+ G LRVLNSYW
Sbjct  61   IYRIRVRRGNRKKPVPKGATYGKPVRQGVNHLKFQRGLRSVAEERVGRRCGNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+D  YKY+EVILVD  H AIR D RINW+CNPVHK R
Sbjct  121  INQDGVYKYYEVILVDPNHKAIRRDARINWICNPVHKRR  159



>ref|XP_455872.1| 60S ribosomal protein L15 [Kluyveromyces lactis NRRL Y-1140]
 emb|CAG98580.1| KLLA0F17633p [Kluyveromyces lactis]
Length=204

 Score =   211 bits (536),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ EL RKKQSDV+RFL RVR WEYRQ   I R +RPTRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRASRPTRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRG RKRPV KG  YGKPTNQGV QLK+QRS R+ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGNRKRPVSKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRAANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFEVILVD +H AIR D + NW+CNPVHKHR
Sbjct  121  INQDSTYKYFEVILVDPSHKAIRRDAKYNWICNPVHKHR  159



>emb|CEG70134.1| Putative Ribosomal protein L15 [Rhizopus microsporus]
 emb|CEG67016.1| Putative Ribosomal protein L15 [Rhizopus microsporus]
 emb|CEG66017.1| Putative Ribosomal protein L15 [Rhizopus microsporus]
 emb|CEJ04316.1| Putative Ribosomal protein L15 [Rhizopus microsporus]
 emb|CEJ01175.1| Putative Ribosomal protein L15 [Rhizopus microsporus]
 emb|CEI96935.1| Putative Ribosomal protein L15 [Rhizopus microsporus]
Length=204

 Score =   211 bits (536),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ EL RKKQSDV RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYLEELARKKQSDVSRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+RVRRGGRKRPVPKG  YGKP N+GV QLK+QRS RS AEER GRK   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPVNEGVNQLKYQRSLRSTAEERVGRKCRNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+D+TYKY+EVILVD +H AIRNDPRI+W+ NPVHK R
Sbjct  121  INQDATYKYYEVILVDPSHKAIRNDPRISWIVNPVHKRR  159



>gb|KGQ83010.1| 60S ribosomal protein L15-A [Candida albicans P37005]
 gb|KGT63650.1| 60S ribosomal protein L15-A [Candida albicans 12C]
 gb|KGU02265.1| 60S ribosomal protein L15-A [Candida albicans L26]
 gb|KGU02520.1| 60S ribosomal protein L15-A [Candida albicans 19F]
Length=204

 Score =   211 bits (536),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR+RVRRGGRKRPV KG  YGKPTNQGV QLK+Q+S RS AEER GR+   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVLKGATYGKPTNQGVNQLKYQKSLRSTAEERVGRRASNLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            +N+DSTYKYFEVILVD +H AIR D R NW+ NPVHKHR
Sbjct  121  VNQDSTYKYFEVILVDPSHKAIRRDARYNWIVNPVHKHR  159



>ref|XP_007804051.1| 60S ribosomal protein L15 [Endocarpon pusillum Z07020]
 gb|ERF70289.1| 60S ribosomal protein L15 [Endocarpon pusillum Z07020]
Length=203

 Score =   211 bits (536),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+E+ILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYYEIILVDPQHKAIRRDPRINWIVNPVHKHR  159



>gb|EPQ66314.1| Protein component of the large (60S) ribosomal subunit [Blumeria 
graminis f. sp. tritici 96224]
 emb|CCU77282.1| 60S ribosomal protein L15 [Blumeria graminis f. sp. hordei DH14]
Length=203

 Score =   210 bits (535),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  + R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVVHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKY+EVILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRRDPRINWIVNPVHKHR  159



>gb|ESZ93952.1| 60S ribosomal protein L15 [Sclerotinia borealis F-4157]
Length=203

 Score =   210 bits (535),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +3

Query  54   MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyv  233
            MGA  Y+ E+ +KKQSDV+RFLLRVRCWE RQL  + R +RP+RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYLEEIQKKKQSDVLRFLLRVRCWELRQLNVVHRASRPSRPDKARRLGYKAKQGYV  60

Query  234  vyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  413
            +YR RVRRGGRKRP PKG  YGKPTNQG+ QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRARVRRGGRKRPAPKGATYGKPTNQGINQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  414  INEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHR  530
            IN+DSTYKYFE+ILVD  H AIR DPRINW+ NPVHKHR
Sbjct  121  INQDSTYKYFEIILVDPQHKAIRRDPRINWIVNPVHKHR  159



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200