BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF023C17

Length=447
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57279.1|  alpha-expansin                                         236   5e-75   Ipomoea nil [qian niu]
ref|NP_001234081.1|  expansin A4 precursor                              197   6e-60   Solanum lycopersicum
ref|XP_006341021.1|  PREDICTED: expansin-A3                             197   1e-59   Solanum tuberosum [potatoes]
ref|XP_009788740.1|  PREDICTED: expansin-A3-like                        196   2e-59   Nicotiana sylvestris
gb|AEQ55271.1|  expansin                                                196   2e-59   Breonia chinensis
ref|XP_009587747.1|  PREDICTED: expansin-A3-like                        194   8e-59   Nicotiana tomentosiformis
ref|XP_008387765.1|  PREDICTED: expansin-A4-like                        193   3e-58   
ref|XP_009772489.1|  PREDICTED: expansin-A3-like                        193   3e-58   Nicotiana sylvestris
emb|CDP06606.1|  unnamed protein product                                190   6e-57   Coffea canephora [robusta coffee]
gb|KJB76740.1|  hypothetical protein B456_012G104400                    190   7e-57   Gossypium raimondii
ref|XP_003537990.1|  PREDICTED: expansin-A4-like                        189   9e-57   
gb|AIE54285.1|  expansin                                                189   9e-57   Nicotiana tabacum [American tobacco]
ref|XP_009610453.1|  PREDICTED: expansin-A3-like                        189   1e-56   Nicotiana tomentosiformis
ref|XP_004505858.1|  PREDICTED: expansin-A6-like                        189   1e-56   Cicer arietinum [garbanzo]
gb|KHG12430.1|  Expansin-A4 -like protein                               189   1e-56   Gossypium arboreum [tree cotton]
ref|XP_007016396.1|  Expansin A4, ALPHA 1.6,EXPA4                       189   1e-56   Theobroma cacao [chocolate]
ref|XP_007027012.1|  Expansin A4, ALPHA 1.6,EXPA4                       189   2e-56   
dbj|BAC67193.1|  expansin                                               189   2e-56   Pyrus communis
ref|XP_004249634.1|  PREDICTED: expansin-A3                             189   2e-56   
gb|KDP35637.1|  hypothetical protein JCGZ_09075                         188   2e-56   Jatropha curcas
gb|KHN21950.1|  Expansin-A4                                             189   2e-56   Glycine soja [wild soybean]
gb|ACU17873.1|  unknown                                                 184   4e-56   Glycine max [soybeans]
ref|XP_007205748.1|  hypothetical protein PRUPE_ppa010226mg             187   4e-56   Prunus persica
ref|XP_011019858.1|  PREDICTED: expansin-A6                             187   6e-56   Populus euphratica
ref|XP_009341751.1|  PREDICTED: expansin-A4-like                        187   9e-56   Pyrus x bretschneideri [bai li]
emb|CAH18933.1|  expansin                                               187   1e-55   Pyrus communis
ref|XP_007140533.1|  hypothetical protein PHAVU_008G120700g             186   1e-55   Phaseolus vulgaris [French bean]
gb|ACU17612.1|  unknown                                                 183   2e-55   Glycine max [soybeans]
ref|XP_009787901.1|  PREDICTED: expansin-A3-like                        187   2e-55   Nicotiana sylvestris
ref|XP_002315218.1|  alpha-expansin 9 precursor family protein          186   2e-55   
gb|EYU41729.1|  hypothetical protein MIMGU_mgv1a012073mg                186   3e-55   Erythranthe guttata [common monkey flower]
ref|XP_003552923.2|  PREDICTED: expansin-A3-like                        186   3e-55   Glycine max [soybeans]
ref|XP_003538409.1|  PREDICTED: expansin-A6                             186   3e-55   Glycine max [soybeans]
ref|XP_006339024.1|  PREDICTED: expansin-A3-like                        185   3e-55   Solanum tuberosum [potatoes]
gb|KHG30766.1|  Expansin-A4 -like protein                               185   3e-55   Gossypium arboreum [tree cotton]
dbj|BAH36862.1|  alpha expansin                                         185   3e-55   Rosa hybrid cultivar
ref|XP_006349505.1|  PREDICTED: expansin-A3-like                        185   4e-55   Solanum tuberosum [potatoes]
gb|KJB16930.1|  hypothetical protein B456_002G257400                    185   4e-55   Gossypium raimondii
ref|XP_004300427.1|  PREDICTED: expansin-A6                             185   4e-55   Fragaria vesca subsp. vesca
ref|XP_003552173.1|  PREDICTED: expansin-A4                             185   5e-55   Glycine max [soybeans]
gb|KJB46592.1|  hypothetical protein B456_007G376300                    185   5e-55   Gossypium raimondii
ref|XP_007132063.1|  hypothetical protein PHAVU_011G063800g             184   6e-55   Phaseolus vulgaris [French bean]
gb|AFB77223.1|  expansin 1                                              184   6e-55   Betula platyphylla [Asian white birch]
gb|KHN17924.1|  Expansin-A3                                             186   7e-55   Glycine soja [wild soybean]
ref|XP_007133996.1|  hypothetical protein PHAVU_010G010200g             184   7e-55   Phaseolus vulgaris [French bean]
ref|XP_004492358.1|  PREDICTED: expansin-A6-like                        184   7e-55   Cicer arietinum [garbanzo]
gb|KHN07218.1|  Expansin-A4                                             184   7e-55   Glycine soja [wild soybean]
ref|XP_009607348.1|  PREDICTED: expansin-A3-like                        185   8e-55   Nicotiana tomentosiformis
ref|XP_003552064.1|  PREDICTED: expansin-A4                             184   8e-55   Glycine max [soybeans]
gb|KDP20458.1|  hypothetical protein JCGZ_05303                         184   9e-55   Jatropha curcas
ref|XP_002309061.1|  expansin family protein                            184   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_004249536.1|  PREDICTED: expansin-A6-like                        184   1e-54   Solanum lycopersicum
gb|KHG15821.1|  Expansin-A4 -like protein                               184   1e-54   Gossypium arboreum [tree cotton]
ref|XP_011094866.1|  PREDICTED: expansin-A6                             184   1e-54   Sesamum indicum [beniseed]
gb|KJB36710.1|  hypothetical protein B456_006G172400                    184   2e-54   Gossypium raimondii
ref|XP_009364387.1|  PREDICTED: expansin-A4                             183   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_004173681.1|  PREDICTED: expansin-A4-like                        178   2e-54   
ref|XP_008457477.1|  PREDICTED: expansin-A4-like                        183   2e-54   Cucumis melo [Oriental melon]
ref|NP_001236550.1|  expansin precursor                                 183   2e-54   
ref|XP_003519349.1|  PREDICTED: expansin-A4-like                        183   3e-54   Glycine max [soybeans]
ref|XP_003616412.1|  Expansin                                           183   3e-54   Medicago truncatula
gb|AFK34565.1|  unknown                                                 181   3e-54   Medicago truncatula
gb|AFK33369.1|  unknown                                                 180   3e-54   Lotus japonicus
ref|XP_008233635.1|  PREDICTED: expansin-A4-like                        183   3e-54   Prunus mume [ume]
ref|NP_001242978.1|  expansin-A4-like precursor                         183   3e-54   Glycine max [soybeans]
ref|XP_003597354.1|  Cell wall protein Exp5                             180   3e-54   
ref|XP_011027216.1|  PREDICTED: expansin-A4                             182   3e-54   Populus euphratica
gb|AFK40565.1|  unknown                                                 182   3e-54   Medicago truncatula
gb|AAT11859.2|  expansin 1                                              182   4e-54   Mangifera indica
gb|KEH39447.1|  expansin A10                                            182   4e-54   Medicago truncatula
gb|AAF32410.1|AF230277_1  alpha-expansin 2                              182   4e-54   Triphysaria versicolor
ref|XP_008464122.1|  PREDICTED: expansin-A4                             182   5e-54   Cucumis melo [Oriental melon]
gb|AAL31477.1|AF319472_1  alpha-expansin 6 precursor                    182   5e-54   Cucumis sativus [cucumbers]
ref|XP_004154408.1|  PREDICTED: expansin-A4-like                        182   6e-54   
ref|XP_006288496.1|  hypothetical protein CARUB_v10001761mg             182   6e-54   Capsella rubella
ref|XP_004302749.1|  PREDICTED: expansin-A6                             182   6e-54   Fragaria vesca subsp. vesca
gb|AAR82850.1|  expansin-2                                              182   6e-54   Petunia x hybrida [garden petunia]
ref|XP_010256907.1|  PREDICTED: expansin-A4                             182   7e-54   Nelumbo nucifera [Indian lotus]
ref|XP_003544219.1|  PREDICTED: expansin-A6-like                        182   7e-54   Glycine max [soybeans]
gb|AEN70914.1|  expansin                                                182   7e-54   Gossypium trilobum
gb|KEH22886.1|  expansin-A1-like protein                                182   7e-54   Medicago truncatula
gb|ACJ48968.2|  expansin                                                182   7e-54   Breonia chinensis
ref|NP_001284471.1|  expansin-A4 precursor                              182   8e-54   Cucumis melo [Oriental melon]
gb|ACO07292.1|  expansin 10                                             182   8e-54   Cucumis sativus [cucumbers]
ref|XP_004142066.1|  PREDICTED: expansin-A4-like                        182   8e-54   
ref|XP_002298353.1|  alpha-expansin 1 family protein                    182   9e-54   Populus trichocarpa [western balsam poplar]
gb|AEE69071.1|  expansin-4                                              181   9e-54   Petunia hybrid cultivar [hybrid petunia]
gb|AAR82849.1|  expansin-1                                              182   9e-54   Petunia x hybrida [garden petunia]
gb|AFK44569.1|  unknown                                                 181   1e-53   Medicago truncatula
ref|XP_009757427.1|  PREDICTED: expansin-A4-like                        181   1e-53   Nicotiana sylvestris
ref|XP_007150329.1|  hypothetical protein PHAVU_005G144500g             181   1e-53   Phaseolus vulgaris [French bean]
ref|XP_011035307.1|  PREDICTED: expansin-A6                             181   1e-53   Populus euphratica
emb|CAA59470.1|  orf                                                    181   1e-53   Pisum sativum [garden pea]
ref|XP_008802710.1|  PREDICTED: expansin-A4                             181   2e-53   Phoenix dactylifera
ref|XP_007009225.1|  Expansin A4, ALPHA 1.6,EXPA4                       181   2e-53   
gb|KEH30169.1|  expansin A10                                            181   2e-53   Medicago truncatula
ref|XP_008357089.1|  PREDICTED: expansin-A6                             181   2e-53   
ref|NP_001234881.1|  expansin9 precursor                                181   2e-53   Solanum lycopersicum
gb|AEQ55290.1|  expansin                                                181   2e-53   Breonia chinensis
ref|XP_007218834.1|  hypothetical protein PRUPE_ppa010198mg             181   2e-53   Prunus persica
gb|AAM22624.1|AF428177_1  expansin 10 precursor                         181   2e-53   Rumex palustris
gb|AEN70891.1|  expansin                                                181   2e-53   Gossypium thurberi
gb|AFZ78606.1|  expansin protein                                        181   2e-53   Populus tomentosa [Chinese white poplar]
ref|XP_010509297.1|  PREDICTED: expansin-A3-like                        177   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006410954.1|  hypothetical protein EUTSA_v10017095mg             181   2e-53   Eutrema salsugineum [saltwater cress]
gb|KJB20063.1|  hypothetical protein B456_003G131000                    178   2e-53   Gossypium raimondii
gb|AEN70895.1|  expansin                                                181   2e-53   Gossypium mustelinum
gb|AEN70901.1|  expansin                                                181   2e-53   Gossypium barbadense var. brasiliense
gb|ADY68817.1|  expansin                                                181   2e-53   Gossypium raimondii
gb|ADY68814.1|  expansin                                                181   2e-53   Gossypium barbadense [Egyptian cotton]
ref|XP_009343581.1|  PREDICTED: expansin-A4-like                        181   3e-53   Pyrus x bretschneideri [bai li]
gb|AEQ55275.1|  expansin                                                180   3e-53   Breonia chinensis
ref|XP_009768238.1|  PREDICTED: expansin-A6-like                        180   3e-53   Nicotiana sylvestris
ref|XP_010106493.1|  hypothetical protein L484_025251                   180   3e-53   Morus notabilis
ref|XP_010517036.1|  PREDICTED: expansin-A3                             180   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009761115.1|  PREDICTED: expansin-A6-like                        180   4e-53   Nicotiana sylvestris
ref|XP_008343537.1|  PREDICTED: expansin-A4-like                        180   4e-53   Malus domestica [apple tree]
ref|XP_007163413.1|  hypothetical protein PHAVU_001G232600g             180   4e-53   Phaseolus vulgaris [French bean]
ref|XP_002533097.1|  Alpha-expansin 4 precursor, putative               180   4e-53   Ricinus communis
gb|ADY68815.1|  expansin                                                180   4e-53   Gossypium barbadense [Egyptian cotton]
gb|AEN70907.1|  expansin                                                180   4e-53   Gossypium armourianum
gb|AHL25255.1|  expansin                                                180   4e-53   Boehmeria nivea [Chinese silk-plant]
ref|XP_009589397.1|  PREDICTED: expansin-A4-like                        180   4e-53   Nicotiana tomentosiformis
emb|CBI16120.3|  unnamed protein product                                180   4e-53   Vitis vinifera
gb|AEN70893.1|  expansin                                                180   4e-53   Gossypium schwendimanii
gb|AAR09168.1|  alpha-expansin 1                                        180   5e-53   Populus tremula x Populus tremuloides
ref|XP_004143121.1|  PREDICTED: expansin-A4-like                        179   5e-53   Cucumis sativus [cucumbers]
gb|AAM22625.1|AF428178_1  expansin 11 precursor                         179   6e-53   Rumex palustris
ref|XP_002283530.1|  PREDICTED: expansin-A4                             179   6e-53   Vitis vinifera
gb|AAM22626.1|AF428179_1  expansin 12 precursor                         179   6e-53   Rumex palustris
ref|XP_010505357.1|  PREDICTED: expansin-A3-like                        179   6e-53   Camelina sativa [gold-of-pleasure]
ref|NP_181300.1|  expansin-A3                                           179   7e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009597793.1|  PREDICTED: expansin-A6-like                        179   7e-53   Nicotiana tomentosiformis
ref|XP_007205739.1|  hypothetical protein PRUPE_ppa010180mg             177   7e-53   
ref|XP_010920576.1|  PREDICTED: expansin-A4-like                        179   8e-53   Elaeis guineensis
gb|KJB55836.1|  hypothetical protein B456_009G098800                    179   8e-53   Gossypium raimondii
ref|XP_003547326.1|  PREDICTED: expansin-A4-like                        179   1e-52   Glycine max [soybeans]
gb|KFK36651.1|  alpha-expansin 4                                        179   1e-52   Arabis alpina [alpine rockcress]
ref|XP_008240857.1|  PREDICTED: expansin-A6-like                        179   1e-52   Prunus mume [ume]
gb|ADY68818.1|  expansin                                                179   1e-52   Gossypium hirsutum [American cotton]
ref|XP_009353647.1|  PREDICTED: expansin-A6-like                        179   1e-52   Pyrus x bretschneideri [bai li]
gb|ACK36943.1|  expansin                                                179   1e-52   Annona cherimola [cherimoya]
ref|NP_001288899.1|  expansin-A6 precursor                              179   1e-52   Brassica rapa
ref|XP_009349313.1|  PREDICTED: expansin-A6-like                        179   1e-52   Pyrus x bretschneideri [bai li]
gb|AAM47000.1|AF512542_1  alpha-expansin precursor                      179   1e-52   Gossypium hirsutum [American cotton]
emb|CDY31742.1|  BnaA04g16780D                                          178   2e-52   Brassica napus [oilseed rape]
ref|XP_010685747.1|  PREDICTED: expansin-A4                             178   2e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011042710.1|  PREDICTED: expansin-A4-like                        178   2e-52   Populus euphratica
ref|XP_006409928.1|  hypothetical protein EUTSA_v10017116mg             178   2e-52   Eutrema salsugineum [saltwater cress]
gb|KJB73995.1|  hypothetical protein B456_011G266000                    178   2e-52   Gossypium raimondii
gb|AEU08407.1|  expansin 2                                              178   2e-52   Prunus salicina [Japanese plum]
ref|XP_007205740.1|  hypothetical protein PRUPE_ppa010180mg             178   2e-52   Prunus persica
ref|XP_009357738.1|  PREDICTED: expansin-A4-like                        178   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_010528418.1|  PREDICTED: expansin-A3                             178   2e-52   Tarenaya hassleriana [spider flower]
ref|XP_008223717.1|  PREDICTED: expansin-A4                             178   2e-52   Prunus mume [ume]
gb|AEN70900.1|  expansin                                                178   2e-52   Gossypium tomentosum
gb|AAL31480.1|AF319475_1  alpha-expansin 9 precursor                    177   2e-52   Cucumis sativus [cucumbers]
emb|CDP09064.1|  unnamed protein product                                178   3e-52   Coffea canephora [robusta coffee]
ref|XP_008461679.1|  PREDICTED: expansin-A4                             178   3e-52   Cucumis melo [Oriental melon]
ref|XP_003543517.1|  PREDICTED: expansin-A4                             177   3e-52   Glycine max [soybeans]
gb|ADC35365.1|  alpha-expansin 2                                        177   3e-52   Coffea arabica [arabica coffee]
ref|XP_004147685.1|  PREDICTED: expansin-A4-like                        177   3e-52   Cucumis sativus [cucumbers]
emb|CDX77222.1|  BnaC04g40170D                                          177   3e-52   
gb|AEQ55274.1|  expansin                                                177   3e-52   Breonia chinensis
gb|KHG20113.1|  Expansin-A4 -like protein                               177   3e-52   Gossypium arboreum [tree cotton]
ref|XP_010922313.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A4-...    177   4e-52   
ref|XP_009130690.1|  PREDICTED: expansin-A9-like                        177   5e-52   Brassica rapa
ref|XP_002881524.1|  ATEXPA3                                            177   6e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_010521846.1|  PREDICTED: expansin-A6                             177   6e-52   Tarenaya hassleriana [spider flower]
dbj|BAN09210.1|  alpha expansin                                         177   6e-52   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_010423881.1|  PREDICTED: expansin-A9-like                        177   7e-52   Camelina sativa [gold-of-pleasure]
emb|CDX80810.1|  BnaC03g00640D                                          177   7e-52   
ref|XP_002283358.1|  PREDICTED: expansin-A4                             177   7e-52   Vitis vinifera
ref|XP_006435550.1|  hypothetical protein CICLE_v10032484mg             176   9e-52   Citrus clementina [clementine]
ref|XP_010690765.1|  PREDICTED: expansin-A4                             176   9e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB08889.1|  hypothetical protein B456_001G111100                    176   1e-51   Gossypium raimondii
ref|XP_010452058.1|  PREDICTED: expansin-A9-like                        176   1e-51   Camelina sativa [gold-of-pleasure]
gb|KJB78839.1|  hypothetical protein B456_013G022200                    176   1e-51   Gossypium raimondii
gb|ABO32367.1|  expansin                                                176   1e-51   Litchi
ref|NP_001288852.1|  expansin-A3 precursor                              176   1e-51   Brassica rapa
gb|ABK93258.1|  unknown                                                 174   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_008371813.1|  PREDICTED: expansin-A4-like                        176   1e-51   Malus domestica [apple tree]
emb|CDX74942.1|  BnaA05g06880D                                          176   1e-51   
dbj|BAC67194.1|  expansin                                               176   1e-51   Pyrus communis
ref|XP_011089478.1|  PREDICTED: expansin-A6                             176   1e-51   Sesamum indicum [beniseed]
ref|XP_010264435.1|  PREDICTED: expansin-A4                             176   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010043542.1|  PREDICTED: expansin-A4-like                        176   2e-51   Eucalyptus grandis [rose gum]
ref|XP_010033123.1|  PREDICTED: expansin-A4                             176   2e-51   Eucalyptus grandis [rose gum]
ref|XP_008384848.1|  PREDICTED: expansin-A4                             176   2e-51   Malus domestica [apple tree]
ref|XP_006429095.1|  hypothetical protein CICLE_v10012518mg             176   2e-51   Citrus clementina [clementine]
ref|XP_006366490.1|  PREDICTED: expansin-A6                             176   2e-51   Solanum tuberosum [potatoes]
ref|XP_002313434.1|  alpha-expansin 1 family protein                    176   2e-51   Populus trichocarpa [western balsam poplar]
gb|KDP44940.1|  hypothetical protein JCGZ_01440                         176   2e-51   Jatropha curcas
emb|CDY47883.1|  BnaA07g14280D                                          176   2e-51   Brassica napus [oilseed rape]
ref|XP_007141864.1|  hypothetical protein PHAVU_008G232200g             175   3e-51   Phaseolus vulgaris [French bean]
ref|XP_004486999.1|  PREDICTED: expansin-A6-like                        175   3e-51   Cicer arietinum [garbanzo]
gb|KHG24991.1|  Expansin-A4 -like protein                               175   3e-51   Gossypium arboreum [tree cotton]
gb|ACN94264.1|  expansin                                                175   3e-51   Rehmannia glutinosa [Chinese foxglove]
ref|XP_010414459.1|  PREDICTED: expansin-A6-like                        175   3e-51   Camelina sativa [gold-of-pleasure]
ref|NP_001234761.1|  expansin18 precursor                               175   3e-51   
gb|EYU26594.1|  hypothetical protein MIMGU_mgv1a012061mg                175   4e-51   Erythranthe guttata [common monkey flower]
gb|KCW65541.1|  hypothetical protein EUGRSUZ_G02938                     175   4e-51   Eucalyptus grandis [rose gum]
ref|XP_011077214.1|  PREDICTED: expansin-A6-like                        175   4e-51   Sesamum indicum [beniseed]
gb|ABO30976.2|  alpha expansin protein 1                                175   4e-51   Calotropis procera
ref|XP_010534508.1|  PREDICTED: expansin-A4                             175   5e-51   Tarenaya hassleriana [spider flower]
ref|XP_006294816.1|  hypothetical protein CARUB_v10023867mg             175   5e-51   Capsella rubella
ref|NP_001150534.1|  alpha-expansin 6 precursor                         175   5e-51   
ref|NP_001233958.1|  expansin precursor                                 174   5e-51   Solanum lycopersicum
ref|XP_006480833.1|  PREDICTED: expansin-A4-like                        174   5e-51   Citrus sinensis [apfelsine]
ref|XP_008784594.1|  PREDICTED: expansin-A4-like                        174   6e-51   Phoenix dactylifera
gb|KHG29956.1|  Expansin-A4 -like protein                               174   6e-51   Gossypium arboreum [tree cotton]
emb|CDY07642.1|  BnaA03g18690D                                          174   6e-51   Brassica napus [oilseed rape]
gb|EYU18981.1|  hypothetical protein MIMGU_mgv1a012125mg                174   6e-51   Erythranthe guttata [common monkey flower]
ref|XP_009613959.1|  PREDICTED: expansin-A6-like                        174   7e-51   Nicotiana tomentosiformis
ref|XP_006350774.1|  PREDICTED: expansin-A6                             174   7e-51   Solanum tuberosum [potatoes]
ref|XP_010490643.1|  PREDICTED: expansin-A9                             174   8e-51   Camelina sativa [gold-of-pleasure]
ref|XP_004145295.1|  PREDICTED: expansin-A4-like                        174   8e-51   
ref|XP_006846223.1|  hypothetical protein AMTR_s00012p00230920          174   9e-51   Amborella trichopoda
ref|XP_006411198.1|  hypothetical protein EUTSA_v10017119mg             174   9e-51   Eutrema salsugineum [saltwater cress]
ref|XP_008777004.1|  PREDICTED: expansin-A4-like                        174   9e-51   Phoenix dactylifera
ref|XP_002881024.1|  ATEXPA6                                            174   1e-50   Arabidopsis lyrata subsp. lyrata
gb|AAK48848.1|AF350939_1  expansin                                      174   1e-50   Prunus cerasus [pie cherry]
ref|XP_010067412.1|  PREDICTED: expansin-A4                             175   1e-50   Eucalyptus grandis [rose gum]
gb|KHN30166.1|  Expansin-A4                                             175   1e-50   Glycine soja [wild soybean]
ref|XP_010558331.1|  PREDICTED: expansin-A9                             174   1e-50   Tarenaya hassleriana [spider flower]
ref|XP_009122794.1|  PREDICTED: expansin-A9                             173   1e-50   Brassica rapa
ref|XP_009409516.1|  PREDICTED: expansin-A6-like                        173   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY10456.1|  BnaCnng03570D                                          173   2e-50   Brassica napus [oilseed rape]
emb|CAA04385.1|  Expansin                                               173   2e-50   Brassica napus [oilseed rape]
emb|CDP00110.1|  unnamed protein product                                173   2e-50   Coffea canephora [robusta coffee]
ref|XP_010510558.1|  PREDICTED: expansin-A6                             173   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002266625.1|  PREDICTED: expansin-A6                             173   2e-50   Vitis vinifera
gb|KFK32246.1|  hypothetical protein AALP_AA6G217100                    173   2e-50   Arabis alpina [alpine rockcress]
ref|NP_001288961.1|  expansin-A4 precursor                              172   3e-50   Brassica rapa
ref|XP_009124371.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A6        172   3e-50   Brassica rapa
gb|AAM62987.1|  expansin AtEx6                                          172   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AFW67136.1|  hypothetical protein ZEAMMB73_591538                    169   3e-50   
ref|XP_009380637.1|  PREDICTED: expansin-A4                             172   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACO52788.1|  EXP6                                                    169   3e-50   Brachypodium distachyon [annual false brome]
ref|NP_180461.1|  expansin A6                                           172   4e-50   Arabidopsis thaliana [mouse-ear cress]
gb|ACO52804.1|  EXP6                                                    169   4e-50   Brachypodium distachyon [annual false brome]
ref|XP_002870966.1|  ATEXPA9                                            172   4e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_010532011.1|  PREDICTED: expansin-A4-like                        172   4e-50   Tarenaya hassleriana [spider flower]
ref|XP_010557251.1|  PREDICTED: expansin-A6-like                        172   4e-50   Tarenaya hassleriana [spider flower]
emb|CDY69611.1|  BnaCnng64440D                                          172   4e-50   Brassica napus [oilseed rape]
ref|XP_006398690.1|  hypothetical protein EUTSA_v10014430mg             172   4e-50   Eutrema salsugineum [saltwater cress]
emb|CDY07024.1|  BnaA04g22910D                                          172   4e-50   
ref|XP_009141827.1|  PREDICTED: expansin-A4-like                        172   4e-50   Brassica rapa
gb|ACO57092.1|  EXP6                                                    169   4e-50   Brachypodium phoenicoides
gb|AAP48989.1|  expansin                                                172   5e-50   Sambucus nigra
gb|ACO52791.1|  EXP6                                                    169   5e-50   Brachypodium distachyon [annual false brome]
gb|ACO52755.1|  EXP6                                                    169   5e-50   Brachypodium distachyon [annual false brome]
gb|ACO52796.1|  EXP6                                                    168   5e-50   Brachypodium distachyon [annual false brome]
ref|XP_006488339.1|  PREDICTED: expansin-A4-like                        172   6e-50   Citrus sinensis [apfelsine]
ref|XP_006424843.1|  hypothetical protein CICLE_v10029094mg             172   6e-50   Citrus clementina [clementine]
gb|ACF87150.1|  unknown                                                 172   7e-50   Zea mays [maize]
ref|XP_002878036.1|  ATEXPA16                                           171   8e-50   Arabidopsis lyrata subsp. lyrata
emb|CDY24952.1|  BnaC03g22200D                                          171   9e-50   Brassica napus [oilseed rape]
gb|EPS67093.1|  hypothetical protein M569_07682                         171   9e-50   Genlisea aurea
ref|XP_002463623.1|  hypothetical protein SORBIDRAFT_01g003120          171   1e-49   Sorghum bicolor [broomcorn]
gb|ACT67493.1|  expansin A1                                             171   1e-49   Raphanus sativus
ref|XP_011031225.1|  PREDICTED: expansin-A4-like                        171   1e-49   Populus euphratica
ref|XP_010111142.1|  hypothetical protein L484_010756                   171   1e-49   Morus notabilis
emb|CDY04847.1|  BnaAnng00290D                                          171   1e-49   
gb|ACO52763.1|  EXP6                                                    167   2e-49   Brachypodium distachyon [annual false brome]
gb|ACO52786.1|  EXP6                                                    167   2e-49   Brachypodium distachyon [annual false brome]
emb|CDY48101.1|  BnaC02g03580D                                          171   2e-49   Brassica napus [oilseed rape]
ref|NP_001288956.1|  expansin-A9-like precursor                         171   2e-49   Brassica rapa
gb|ABM66430.1|  expansin 3                                              170   2e-49   Musa acuminata AAA Group [Cavendish banana]
gb|ACO52759.1|  EXP6                                                    167   2e-49   Brachypodium distachyon [annual false brome]
emb|CAN73252.1|  hypothetical protein VITISV_027049                     170   3e-49   Vitis vinifera
ref|NP_195846.1|  expansin A9                                           170   3e-49   Arabidopsis thaliana [mouse-ear cress]
gb|ACA05164.1|  expansin 1                                              170   3e-49   Dimocarpus longan [longan]
ref|XP_004490888.1|  PREDICTED: expansin-A4-like                        170   3e-49   Cicer arietinum [garbanzo]
gb|AAV85475.1|  expansin                                                170   3e-49   Populus tomentosa [Chinese white poplar]
ref|XP_002312101.1|  alpha-expansin 9 precursor family protein          170   3e-49   Populus trichocarpa [western balsam poplar]
gb|ABK93541.1|  unknown                                                 169   4e-49   Populus trichocarpa [western balsam poplar]
ref|NP_001288942.1|  expansin-A16 precursor                             169   5e-49   Brassica rapa
ref|XP_004981242.1|  PREDICTED: expansin-A7-like                        169   6e-49   Setaria italica
ref|XP_006294844.1|  hypothetical protein CARUB_v10023895mg             169   6e-49   
ref|XP_010931278.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A7        169   6e-49   
gb|ACO52757.1|  EXP6                                                    166   7e-49   
emb|CDY20467.1|  BnaC04g05770D                                          169   9e-49   
ref|XP_006294843.1|  hypothetical protein CARUB_v10023894mg             168   1e-48   
ref|XP_009143296.1|  PREDICTED: expansin-A4-like                        168   1e-48   
ref|NP_181500.1|  expansin A4                                           168   1e-48   
ref|XP_008799850.1|  PREDICTED: expansin-A6-like                        168   1e-48   
ref|XP_009381075.1|  PREDICTED: expansin-A7-like                        168   2e-48   
gb|KJB46593.1|  hypothetical protein B456_007G376300                    169   2e-48   
ref|XP_009409019.1|  PREDICTED: expansin-A4-like                        167   2e-48   
ref|XP_006291698.1|  hypothetical protein CARUB_v10017862mg             167   3e-48   
ref|XP_010427324.1|  PREDICTED: expansin-A16-like                       167   3e-48   
gb|ABM54492.1|  expansin 2                                              167   3e-48   
gb|KHN33378.1|  Expansin-A4                                             167   3e-48   
ref|XP_003563572.1|  PREDICTED: expansin-A7                             167   4e-48   
dbj|BAE06067.1|  expansin                                               167   4e-48   
ref|XP_010937609.1|  PREDICTED: expansin-A4                             167   4e-48   
ref|XP_002881669.1|  ATEXPA4                                            167   5e-48   
emb|CDY41218.1|  BnaC08g26400D                                          167   6e-48   
ref|XP_010516124.1|  PREDICTED: expansin-A16                            167   6e-48   
gb|ACO52765.1|  EXP6                                                    162   7e-48   
emb|CDY40233.1|  BnaA09g35150D                                          166   7e-48   
gb|ABK24904.1|  unknown                                                 166   8e-48   
ref|NP_191109.1|  expansin A16                                          166   8e-48   
gb|AAM62937.1|  Alpha-expansin 4 precursor (At-EXP4) (AtEx4) (Ath...    166   1e-47   
ref|XP_011077647.1|  PREDICTED: expansin-A6-like                        166   2e-47   
ref|XP_010505648.1|  PREDICTED: expansin-A4                             166   2e-47   
gb|KFK24708.1|  hypothetical protein AALP_AA8G014300                    165   2e-47   
gb|KFK34799.1|  hypothetical protein AALP_AA5G194700                    165   2e-47   
ref|XP_010508990.1|  PREDICTED: expansin-A4-like                        165   2e-47   
ref|XP_010111457.1|  hypothetical protein L484_021280                   165   2e-47   
gb|AAN60246.1|  unknown                                                 163   3e-47   
ref|XP_010517323.1|  PREDICTED: expansin-A4-like                        165   3e-47   
ref|XP_010554612.1|  PREDICTED: expansin-A4                             165   3e-47   
gb|AAS48878.1|  expansin EXPA9                                          165   3e-47   
gb|EPS64820.1|  hypothetical protein M569_09956                         164   4e-47   
ref|XP_010504408.1|  PREDICTED: expansin-A16-like                       164   4e-47   
ref|XP_009388613.1|  PREDICTED: expansin-A7                             164   4e-47   
ref|XP_010677870.1|  PREDICTED: expansin-A4-like                        164   5e-47   
gb|ACO52767.1|  EXP6                                                    160   6e-47   
gb|ACO52773.1|  EXP6                                                    159   7e-47   
gb|ABN09939.1|  expansin A4                                             164   8e-47   
ref|XP_009398502.1|  PREDICTED: expansin-A7-like                        164   9e-47   
ref|NP_001051731.1|  Os03g0822000                                       163   1e-46   
ref|XP_006650810.1|  PREDICTED: expansin-A7-like                        163   1e-46   
ref|XP_009419260.1|  PREDICTED: expansin-A7-like                        162   2e-46   
ref|XP_009139160.1|  PREDICTED: expansin-A16-like                       162   2e-46   
ref|XP_006403453.1|  hypothetical protein EUTSA_v10010989mg             162   3e-46   
emb|CDX76090.1|  BnaA04g03540D                                          162   4e-46   
gb|ABN09942.1|  expansin A5                                             161   5e-46   
gb|KJB08890.1|  hypothetical protein B456_001G111100                    162   5e-46   
gb|AAL87021.1|  cell wall protein EXP2 precursor                        161   5e-46   
emb|CDY02943.1|  BnaC04g25430D                                          160   3e-45   
gb|AAQ08016.1|  expansin                                                159   3e-45   
gb|ABN09940.1|  expansin A5                                             159   4e-45   
gb|ACO52780.1|  EXP6                                                    155   4e-45   
gb|ACG46282.1|  alpha-expansin 6 precursor                              159   8e-45   
gb|KFK36856.1|  hypothetical protein AALP_AA4G180600                    158   1e-44   
gb|KFK34800.1|  hypothetical protein AALP_AA5G194900                    157   2e-44   
gb|ACO52764.1|  EXP6                                                    154   2e-44   
ref|XP_004307494.1|  PREDICTED: expansin-A4-like                        157   4e-44   
ref|XP_008458865.1|  PREDICTED: expansin-A4                             157   4e-44   
ref|XP_004171211.1|  PREDICTED: expansin-A16-like                       153   9e-43   
tpg|DAA52222.1|  TPA: hypothetical protein ZEAMMB73_487280              150   1e-42   
gb|ACF84785.1|  unknown                                                 151   5e-42   
ref|NP_001267685.1|  expansin-A16-like                                  150   6e-42   
gb|EPS68567.1|  hypothetical protein M569_06200                         150   8e-42   
gb|ACO52768.1|  EXP6                                                    147   9e-42   
gb|ABR57427.1|  alpha-expansin 4                                        145   2e-41   
gb|ABR57431.1|  alpha-expansin 4                                        145   2e-41   
gb|EYU19913.1|  hypothetical protein MIMGU_mgv1a012177mg                149   2e-41   
ref|XP_010931357.1|  PREDICTED: expansin-A4-like                        149   3e-41   
ref|NP_849869.1|  expansin A1                                           150   3e-41   
ref|NP_001117573.1|  expansin A1                                        150   3e-41   
gb|AAN60340.1|  unknown                                                 145   3e-41   
ref|NP_001185357.1|  expansin A1                                        149   3e-41   
ref|NP_177112.1|  expansin A1                                           149   3e-41   
ref|XP_002887242.1|  ATEXPA1                                            149   4e-41   
ref|XP_010921302.1|  PREDICTED: expansin-A10-like                       148   5e-41   
gb|AAL01624.1|  expansin                                                146   5e-41   
ref|XP_010257816.1|  PREDICTED: expansin-A1                             148   6e-41   
gb|AJR32958.1|  expansin                                                147   1e-40   
ref|XP_010415602.1|  PREDICTED: expansin-A1-like                        147   1e-40   
ref|XP_010470942.1|  PREDICTED: expansin-A1-like                        147   2e-40   
gb|ABR57424.1|  alpha-expansin 4                                        142   2e-40   
gb|ACZ57921.1|  expansin protein 1                                      147   2e-40   
gb|KDP20276.1|  hypothetical protein JCGZ_06862                         146   3e-40   
emb|CDY71146.1|  BnaCnng71550D                                          146   3e-40   
ref|XP_010108480.1|  hypothetical protein L484_010673                   146   3e-40   
ref|XP_010044491.1|  PREDICTED: expansin-A1-like                        146   3e-40   
ref|XP_010257730.1|  PREDICTED: expansin-A15-like                       146   4e-40   
ref|XP_010258310.1|  PREDICTED: expansin-A1 isoform X1                  146   5e-40   
gb|ACO52766.1|  EXP6                                                    142   6e-40   
ref|XP_008354429.1|  PREDICTED: expansin-A4-like                        146   6e-40   
gb|AFK34543.1|  unknown                                                 145   6e-40   
emb|CDY44069.1|  BnaA02g14330D                                          143   6e-40   
ref|XP_003607738.1|  Expansin                                           146   7e-40   
gb|AAL87023.1|  cell wall protein Exp4 precursor                        145   7e-40   
ref|XP_006291657.1|  hypothetical protein CARUB_v10017813mg             146   8e-40   
gb|AAO49058.1|  alpha-expansin                                          142   9e-40   
gb|KDP27163.1|  hypothetical protein JCGZ_19862                         145   9e-40   
gb|AAB38070.1|  expansin At-EXPA1                                       145   9e-40   
ref|XP_010258311.1|  PREDICTED: expansin-A1 isoform X2                  145   9e-40   
ref|NP_001289251.1|  expansin-A4-like precursor                         145   1e-39   
emb|CAH18934.1|  expansin                                               144   2e-39   
ref|XP_006435913.1|  hypothetical protein CICLE_v10032524mg             144   2e-39   
ref|XP_006302737.1|  hypothetical protein CARUB_v10020849mg             144   2e-39   
ref|NP_001275780.1|  expansin 2 precursor                               144   2e-39   
emb|CDY44070.1|  BnaA02g14340D                                          144   2e-39   
gb|ADN03964.1|  EXP1                                                    144   2e-39   
ref|XP_002963702.1|  hypothetical protein SELMODRAFT_230202             144   3e-39   
ref|XP_006429564.1|  hypothetical protein CICLE_v10013804mg             144   3e-39   
ref|XP_010511994.1|  PREDICTED: expansin-A1                             144   3e-39   
gb|KHG18125.1|  Expansin-A10 -like protein                              144   3e-39   
gb|KDO49685.1|  hypothetical protein CISIN_1g025193mg                   144   3e-39   
ref|XP_008221599.1|  PREDICTED: expansin-A1                             144   3e-39   
dbj|BAJ10397.1|  alpha-expansin                                         144   4e-39   
emb|CDP00351.1|  unnamed protein product                                145   4e-39   
ref|XP_004155305.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A1-...    143   4e-39   
ref|XP_010103644.1|  hypothetical protein L484_011237                   144   4e-39   
ref|XP_004135171.1|  PREDICTED: expansin-A1-like                        143   5e-39   
ref|XP_010651411.1|  PREDICTED: expansin-A10                            143   6e-39   
ref|XP_010910535.1|  PREDICTED: expansin-A1-like                        143   6e-39   
gb|ABR17119.1|  unknown                                                 143   6e-39   
ref|XP_009376282.1|  PREDICTED: expansin-A10-like isoform X2            143   6e-39   
ref|XP_002525458.1|  Alpha-expansin 15 precursor, putative              143   6e-39   
gb|KJB80218.1|  hypothetical protein B456_013G086900                    143   6e-39   
gb|KEH35550.1|  expansin A10                                            143   6e-39   
ref|XP_004294932.1|  PREDICTED: expansin-A1-like                        143   6e-39   
ref|XP_008446373.1|  PREDICTED: expansin-A1                             143   7e-39   
ref|XP_010502317.1|  PREDICTED: expansin-A15                            143   8e-39   
ref|XP_002514740.1|  Alpha-expansin 15 precursor, putative              142   8e-39   
ref|NP_001288866.1|  expansin-A1 precursor                              142   9e-39   
gb|EYU28773.1|  hypothetical protein MIMGU_mgv1a012521mg                142   9e-39   
gb|KCW65774.1|  hypothetical protein EUGRSUZ_G03134                     142   1e-38   
ref|XP_002974792.1|  hypothetical protein SELMODRAFT_102164             142   1e-38   
emb|CDY40938.1|  BnaC06g30760D                                          142   1e-38   
ref|XP_007046062.1|  Expansin A1, ALPHA 1.2,EXPA1                       146   1e-38   
ref|XP_008391992.1|  PREDICTED: expansin-A6-like                        139   1e-38   
ref|XP_003544930.1|  PREDICTED: expansin-A8                             142   1e-38   
gb|AAM08930.1|  expansin 1                                              142   1e-38   
gb|AFK38068.1|  unknown                                                 142   1e-38   
ref|XP_010276443.1|  PREDICTED: expansin-A15-like                       142   1e-38   
gb|KEH35551.1|  expansin A10                                            142   1e-38   
ref|XP_006440617.1|  hypothetical protein CICLE_v10021897mg             142   1e-38   
gb|ABO32366.1|  expansin                                                142   1e-38   
gb|AAG13983.1|AF297522_1  expansin 2                                    142   1e-38   
ref|XP_006391003.1|  hypothetical protein EUTSA_v10019043mg             142   1e-38   
ref|XP_006477470.1|  PREDICTED: expansin-A1-like                        143   1e-38   
ref|XP_007037392.1|  Expansin A1, ALPHA 1.2,EXPA1                       143   2e-38   
ref|XP_010425091.1|  PREDICTED: expansin-A15-like                       142   2e-38   
gb|AHL25252.1|  expansin                                                142   2e-38   
emb|CAC18802.1|  expansin                                               140   2e-38   
gb|AAL40354.1|AF448467_1  alpha-expansin                                142   2e-38   
emb|CBI15823.3|  unnamed protein product                                141   2e-38   
gb|AEQ28765.1|  expansin 3                                              142   2e-38   
gb|AEQ55281.1|  expansin                                                142   2e-38   
gb|AAL87024.1|  cell wall protein Exp5                                  139   2e-38   
ref|XP_009376281.1|  PREDICTED: expansin-A10-like isoform X1            143   2e-38   
gb|ABR57477.1|  alpha-expansin 6                                        139   2e-38   
ref|XP_003529476.1|  PREDICTED: expansin-A15-like                       141   2e-38   
ref|XP_008792215.1|  PREDICTED: expansin-A8-like                        142   2e-38   
ref|XP_010917068.1|  PREDICTED: expansin-A10-like                       141   2e-38   
ref|XP_007158645.1|  hypothetical protein PHAVU_002G170300g             143   2e-38   
gb|AFK24458.1|  expansin 5                                              142   2e-38   
ref|XP_002276565.3|  PREDICTED: expansin-A4                             141   3e-38   
gb|KJB50945.1|  hypothetical protein B456_008G194200                    141   3e-38   
emb|CDY24897.1|  BnaC03g22750D                                          141   3e-38   
ref|XP_002523388.1|  Alpha-expansin 1 precursor, putative               141   3e-38   
ref|NP_001240113.1|  expansin precursor                                 141   3e-38   
ref|XP_008242138.1|  PREDICTED: expansin-A8-like                        141   3e-38   
ref|XP_006829796.1|  hypothetical protein AMTR_s00119p00058870          141   3e-38   
gb|ABR57472.1|  alpha-expansin 6                                        138   3e-38   
ref|XP_007205762.1|  hypothetical protein PRUPE_ppa010314mg             141   3e-38   
gb|ACK43222.1|  expansin 2                                              141   3e-38   
ref|XP_007030212.1|  Alpha-expansin 1 precursor                         143   3e-38   
gb|AAL87020.1|  cell wall protein EXP6 precursor                        138   4e-38   
ref|XP_006445551.1|  hypothetical protein CICLE_v10017738mg             141   4e-38   
ref|XP_003523276.1|  PREDICTED: expansin-A8-like                        141   4e-38   
gb|ABR57476.1|  alpha-expansin 6                                        138   4e-38   
gb|ABF48653.1|  expansin precursor                                      141   4e-38   
gb|EAY89910.1|  hypothetical protein OsI_11459                          141   4e-38   
gb|AAG13982.1|AF297521_1  expansin 1                                    141   4e-38   
gb|AAC33529.1|  expansin                                                141   4e-38   
ref|XP_007209512.1|  hypothetical protein PRUPE_ppa010443mg             141   4e-38   
gb|KFK33492.1|  hypothetical protein AALP_AA5G020100                    141   4e-38   
gb|KJB30414.1|  hypothetical protein B456_005G142200                    140   4e-38   
gb|KDP41217.1|  hypothetical protein JCGZ_15624                         140   5e-38   
gb|KHN40987.1|  Expansin-A8                                             140   5e-38   
ref|XP_003519289.1|  PREDICTED: expansin-A8-like                        140   5e-38   
ref|XP_007142047.1|  hypothetical protein PHAVU_008G248000g             140   5e-38   
ref|XP_008239926.1|  PREDICTED: expansin-A1-like                        140   5e-38   
ref|XP_010921134.1|  PREDICTED: expansin-A2-like isoform X1             140   5e-38   
ref|XP_011013147.1|  PREDICTED: expansin-A1                             140   6e-38   
gb|ABR57471.1|  alpha-expansin 6                                        137   6e-38   
ref|XP_006443365.1|  hypothetical protein CICLE_v10021887mg             140   6e-38   
gb|ABR57473.1|  alpha-expansin 6                                        137   6e-38   
gb|KDO43109.1|  hypothetical protein CISIN_1g025809mg                   140   6e-38   
ref|XP_011089527.1|  PREDICTED: expansin-A4-like                        140   6e-38   
ref|XP_011075523.1|  PREDICTED: expansin-A10                            140   7e-38   
ref|XP_009360325.1|  PREDICTED: expansin-A1                             140   7e-38   
ref|XP_010670609.1|  PREDICTED: expansin-A4                             140   7e-38   
ref|XP_009374380.1|  PREDICTED: expansin-A4-like                        140   7e-38   
gb|AFQ21787.1|  EXP4 protein                                            140   7e-38   
ref|NP_178409.2|  expansin A15                                          140   7e-38   
dbj|BAC67192.1|  expansin                                               140   7e-38   
gb|AFK24457.1|  expansin 4                                              140   8e-38   
ref|XP_004297292.1|  PREDICTED: expansin-A1                             140   8e-38   
gb|ABA62612.1|  expansin                                                140   8e-38   
gb|AEQ55273.1|  expansin                                                140   8e-38   
ref|XP_010452431.1|  PREDICTED: expansin-A2                             140   8e-38   
gb|AGR44460.1|  expansin 8                                              139   8e-38   
gb|KHG01029.1|  Expansin-A15 -like protein                              140   9e-38   
ref|XP_009767600.1|  PREDICTED: expansin-A15-like                       140   9e-38   
ref|NP_001281040.1|  expansin-A4-like precursor                         140   9e-38   
ref|NP_001240136.1|  expansin-A1-like precursor                         140   9e-38   
emb|CDP12277.1|  unnamed protein product                                140   9e-38   
ref|XP_010108685.1|  hypothetical protein L484_015671                   140   9e-38   
gb|AAL87022.1|  cell wall protein EXP3 precursor                        140   1e-37   
ref|XP_003613849.1|  Expansin                                           140   1e-37   



>dbj|BAO57279.1| alpha-expansin [Ipomoea nil]
Length=257

 Score =   236 bits (601),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/116 (100%), Positives = 116/116 (100%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFAL
Sbjct  61   QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFAL  116



>ref|NP_001234081.1| expansin A4 precursor [Solanum lycopersicum]
 gb|AAD13632.1| expansin precursor [Solanum lycopersicum]
Length=263

 Score =   197 bits (502),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 107/120 (89%), Gaps = 3/120 (3%)
 Frame = +2

Query  95   KMAAVRVL--CIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  268
            KMAA  +L   I +LLC LTAV+ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGN
Sbjct  3    KMAANMMLYITITVLLCFLTAVNARIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGN  62

Query  269  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            LYSQGYGVNNAALST LFNNGLSCGACFE+KC ND + C PGNPSIFVTATNFCPPNFAL
Sbjct  63   LYSQGYGVNNAALSTVLFNNGLSCGACFELKCDNDGKWCLPGNPSIFVTATNFCPPNFAL  122



>ref|XP_006341021.1| PREDICTED: expansin-A3 [Solanum tuberosum]
Length=263

 Score =   197 bits (500),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 107/120 (89%), Gaps = 3/120 (3%)
 Frame = +2

Query  95   KMAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  268
            KMAA  +L I   +LLC LTAV+ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGN
Sbjct  3    KMAATMMLYITTTILLCFLTAVNARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGN  62

Query  269  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            LYSQGYGVNNAALST LFNNGLSCGACFE+KC ND + C PGNPSIFVTATNFCPPNFAL
Sbjct  63   LYSQGYGVNNAALSTVLFNNGLSCGACFELKCDNDGKWCLPGNPSIFVTATNFCPPNFAL  122



>ref|XP_009788740.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=259

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 106/118 (90%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIA-LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA  ++LCIA  LLC LTAV+A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAVTKILCIAATLLCFLTAVNAKIPGVYTGGPWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGVNNAALST LFNNGLSCGACFEIKC +D + C PGNPSIFVTATNFCPPNFAL
Sbjct  61   SQGYGVNNAALSTVLFNNGLSCGACFEIKCVDDGKWCLPGNPSIFVTATNFCPPNFAL  118



>gb|AEQ55271.1| expansin [Breonia chinensis]
 gb|AEQ55286.1| expansin [Breonia chinensis]
Length=258

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA V +LCIA LLC LT V+ARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAQVGLLCIATLLCFLTVVNARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN  ALSTALFNNGLSCGACFE+KC+N  + C PGNPSIF+TATNFCPPNFAL
Sbjct  61   QGYGVNTGALSTALFNNGLSCGACFELKCANAPKWCLPGNPSIFITATNFCPPNFAL  117



>ref|XP_009587747.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=259

 Score =   194 bits (494),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 104/118 (88%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            M   ++LCI   LLC LTAV+A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MVVTKILCITTTLLCFLTAVNAKIPGVYTGGPWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKC-SNDRSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGVNNAALST LFNNGLSCGACFEIKC  +D+ C PGNPSIFVTATNFCPPNFAL
Sbjct  61   SQGYGVNNAALSTVLFNNGLSCGACFEIKCVDDDKWCLPGNPSIFVTATNFCPPNFAL  118



>ref|XP_008387765.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=258

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 102/116 (88%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA +R+LCIA LL    A  ARIPGVY+GGAW+ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAFLRMLCIASLLSLFMAABARIPGVYTGGAWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFEIKC +D R C PGNPSIFVTATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSIFVTATNFCPPNFA  116



>ref|XP_009772489.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=257

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA +  LCIA LL  LTA +A++PGVY+GG WQ+AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAIIWTLCIASLLSLLTAANAKVPGVYTGGPWQSAHATFYGGEDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFAL  445
             GYGVNNAALSTALFNNGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+AL
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYAL  116



>emb|CDP06606.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   190 bits (482),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA +  LCIA LLC LT V+AR+PG YSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAQMCPLCIAALLCFLTVVNARLPGAYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFN+GLSCGACFE+KC++D + C PG+PSIF+TATNFCPPNFAL
Sbjct  61   QGYGVNTAALSTALFNDGLSCGACFELKCADDPKWCLPGSPSIFITATNFCPPNFAL  117



>gb|KJB76740.1| hypothetical protein B456_012G104400 [Gossypium raimondii]
Length=264

 Score =   190 bits (482),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 105/116 (91%), Gaps = 1/116 (1%)
 Frame = +2

Query  101  AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  280
            +++ +LC A L+C    V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  8    SSLTLLCFASLMCLFGMVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  67

Query  281  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            GYGVN AALSTALFNNGLSCGACFEIKC++D R C PGNPSIF+TATNFCPPN+AL
Sbjct  68   GYGVNTAALSTALFNNGLSCGACFEIKCTDDPRWCHPGNPSIFITATNFCPPNYAL  123



>ref|XP_003537990.1| PREDICTED: expansin-A4-like [Glycine max]
Length=259

 Score =   189 bits (481),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 1/112 (1%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            VLCIA ++    AV ARIPG+YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VLCIAFIITLTWAVEARIPGIYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  293  NNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            N AALSTALFN+GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFAL
Sbjct  67   NTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFAL  118



>gb|AIE54285.1| expansin [Nicotiana tabacum]
Length=257

 Score =   189 bits (480),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA +  LCIA LL  LT  +A++PGVY+ G W++AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAIIWTLCIASLLSFLTGANAKVPGVYTSGPWESAHATFYGGADASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFAL  445
             GYGVNNAALSTALFNNGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+AL
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYAL  116



>ref|XP_009610453.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=257

 Score =   189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA +  LCIA LL  LT  +A++PGVY+ G W++AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAIIWTLCIASLLSFLTGANAKVPGVYTSGPWESAHATFYGGADASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFAL  445
             GYGVNNAALSTALFNNGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+AL
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYAL  116



>ref|XP_004505858.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = +2

Query  110  RVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            ++L IA ++ S+  V ARIPG+YSGG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  4    KILYIAFIISSMWIVEARIPGLYSGGQWQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  63

Query  290  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            VN AALSTALFNNGLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFAL
Sbjct  64   VNTAALSTALFNNGLSCGACFEIKCANDREWCHSGSPSIFITATNFCPPNFAL  116



>gb|KHG12430.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 105/116 (91%), Gaps = 1/116 (1%)
 Frame = +2

Query  101  AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  280
            +++ +LC A L+C    V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  8    SSLTLLCFASLMCLFGMVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  67

Query  281  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            GYGVN AALSTA+FNNGLSCGACFEIKC++D R C PGNPSIF+TATNFCPPN+AL
Sbjct  68   GYGVNTAALSTAIFNNGLSCGACFEIKCTDDPRWCHPGNPSIFITATNFCPPNYAL  123



>ref|XP_007016396.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY34015.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=258

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA V V+C+ L + S+    A+IPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAVVSVVCVLLFISSMWMAEAKIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G PSIF+TATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANDPKWCHSGGPSIFITATNFCPPNYAL  117



>ref|XP_007027012.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY07514.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=263

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 104/116 (90%), Gaps = 1/116 (1%)
 Frame = +2

Query  101  AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  280
            +++ VLC A LL     V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  7    SSLTVLCFASLLSFSVVVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  66

Query  281  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            GYGVN AALSTALFNNGLSCGACFEIKC+ND R C PG+PSIFVTATNFCPPN+AL
Sbjct  67   GYGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHPGSPSIFVTATNFCPPNYAL  122



>dbj|BAC67193.1| expansin [Pyrus communis]
Length=258

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA++RVL IA +L    A +ARIPGVY+GG+W+ AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MASLRVLYIAFMLSLFMAANARIPGVYTGGSWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFEIKC +D R C PGNPSI VTATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFA  116



>ref|XP_004249634.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
Length=259

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 102/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA    LCIA LLC LT V+A+I GVY+GG W +AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAVNWALCIATLLCFLTVVNAKIAGVYTGGPWTSAHATFYGGADASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS--CSPGNPSIFVTATNFCPPNFAL  445
            QGYGVNNAALSTALFNNGLSCGACFEIKC++ +   C+PGNPSI VT TNFCPPN+AL
Sbjct  61   QGYGVNNAALSTALFNNGLSCGACFEIKCTDSKKEYCNPGNPSILVTGTNFCPPNYAL  118



>gb|KDP35637.1| hypothetical protein JCGZ_09075 [Jatropha curcas]
Length=258

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 104/117 (89%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA + VLCI  L      V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MANLDVLCIISLFSLFWVVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFEIKC++D + C+PG+PSIF+TATNFCPPNFAL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPKWCNPGSPSIFITATNFCPPNFAL  117



>gb|KHN21950.1| Expansin-A4 [Glycine soja]
Length=299

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 1/112 (1%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            VLCIA ++    AV ARIPG+YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VLCIAFIITLTWAVEARIPGIYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  293  NNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            N AALSTALFN+GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFAL
Sbjct  67   NTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFAL  118



>gb|ACU17873.1| unknown [Glycine max]
Length=160

 Score =   184 bits (468),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA+  + IA L+    A  ARIPGVY+GG WQ+ HATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAIVFIHIASLVSLFVATSARIPGVYTGGPWQSVHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PGNPSI +TATNFCPPNFAL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGNPSILITATNFCPPNFAL  117



>ref|XP_007205748.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
 gb|EMJ06947.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
Length=258

 Score =   187 bits (476),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA V +LCIA LL    A +ARIPGVY+GG W+ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAFVHMLCIASLLSLFMAANARIPGVYTGGPWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            +GYGVN AALSTALFNNGLSCGACFEIKC +D + C PGNPSIF+TATNFCPPN+AL
Sbjct  61   EGYGVNTAALSTALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYAL  117



>ref|XP_011019858.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=260

 Score =   187 bits (475),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 99/111 (89%), Gaps = 1/111 (1%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            +LCI  L+      HARIPGV++GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  8    LLCIVFLISVFVLAHARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  293  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            N AALSTALFNNGLSCGACFEIKC++D R C+PGNPSIFVTATNFCPPNFA
Sbjct  68   NTAALSTALFNNGLSCGACFEIKCADDPRWCNPGNPSIFVTATNFCPPNFA  118



>ref|XP_009341751.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=258

 Score =   187 bits (474),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA++RVL IA +L    A +ARIPGVY+GG W+ AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MASLRVLYIAFMLSLFMAANARIPGVYTGGPWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFE+KC +D R C PGNPSI VTATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCGDDPRWCHPGNPSILVTATNFCPPNFA  116



>emb|CAH18933.1| expansin [Pyrus communis]
Length=258

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA++RVL IA +L      +ARIPGVY+GG W+ AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MASLRVLYIAFMLSLFMEANARIPGVYTGGPWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFEIKC +D R C PGNPSI VTATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFA  116



>ref|XP_007140533.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
 gb|ESW12527.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
Length=258

 Score =   186 bits (473),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA+  L IA L     +  ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAIVFLYIASLASLFVSTSARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PGNPSI +TATNFCPPNFAL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGNPSILITATNFCPPNFAL  117



>gb|ACU17612.1| unknown [Glycine max]
Length=165

 Score =   183 bits (464),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA+  L IA L     A  ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAIVFLHIASLASLFVATSARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG+PSI +TATNFCPPNFAL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSILITATNFCPPNFAL  117



>ref|XP_009787901.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=293

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
             LCIA +LC LT+V+A+I G Y+GG W TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    TLCIASVLCFLTSVNAKISGNYAGGPWTTAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  293  NNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFAL  445
            NNAALST LFNNGLSCGACFE+KC++ + C+PGNPSI VTATNFCPPN+AL
Sbjct  67   NNAALSTVLFNNGLSCGACFELKCTDQKWCTPGNPSILVTATNFCPPNYAL  117



>ref|XP_002315218.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEF01389.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA    +C+A L+  LT V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAIRATICVASLVLFLTLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFEIKC ND + C  G+PSI +TATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYAL  117



>gb|EYU41729.1| hypothetical protein MIMGU_mgv1a012073mg [Erythranthe guttata]
Length=262

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 100/114 (88%), Gaps = 3/114 (3%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            +LC A +LC LT+  ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  8    LLCFATVLCFLTSAQARIPGVYAGGPWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  293  NNAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPNFAL  445
            N AALSTALFNNGLSCGACFEIKC    + + C+PG+PSI VTATNFCPPNFAL
Sbjct  68   NTAALSTALFNNGLSCGACFEIKCDAAQDSKWCNPGSPSILVTATNFCPPNFAL  121



>ref|XP_003552923.2| PREDICTED: expansin-A3-like [Glycine max]
Length=262

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 102/117 (87%), Gaps = 3/117 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA + ++ I  LL  LT  HA+IPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  7    MAMLNIISILSLL--LTQSHAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  64

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C+PGNPSI VTATNFCPPN+AL
Sbjct  65   QGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCNPGNPSILVTATNFCPPNYAL  121



>ref|XP_003538409.1| PREDICTED: expansin-A6 [Glycine max]
Length=258

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA + ++ I  LL  +    A+IPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAMLNIIAIVSLLLLMIPSQAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C PGNPSIFVTATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYAL  117



>ref|XP_006339024.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=257

 Score =   185 bits (470),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA   +LCIA LL  LT V +++ GVY+ G WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAITWMLCIASLLSFLTTVDSKVRGVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFAL  445
             GYGVNNAALST LFN+GLSCGACFEIKC++++ C+PGNPSIFVT TNFCPPN+AL
Sbjct  61   TGYGVNNAALSTVLFNSGLSCGACFEIKCTDEKWCNPGNPSIFVTGTNFCPPNYAL  116



>gb|KHG30766.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=262

 Score =   185 bits (470),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 105/121 (87%), Gaps = 5/121 (4%)
 Frame = +2

Query  98   MAAVRV----LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  265
            MAA ++    LC   LL   T+V+ARIPGV+S G+W+TAHATFYGG+DASGTMGGACGYG
Sbjct  1    MAAPKISLTLLCFTSLLPFFTSVNARIPGVFSTGSWETAHATFYGGSDASGTMGGACGYG  60

Query  266  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            NLYSQGYGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSIFVTATNFCPPNFA
Sbjct  61   NLYSQGYGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNFA  120

Query  443  L  445
            L
Sbjct  121  L  121



>dbj|BAH36862.1| alpha expansin [Rosa hybrid cultivar]
Length=258

 Score =   185 bits (470),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA++ +LCIA L   L   +ARIPG Y+GG WQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MASLHLLCIASLASLLILANARIPGPYTGGPWQDAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFEI+C +D R C+PG PSIFVTATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIRCGDDPRWCTPGKPSIFVTATNFCPPNFA  116



>ref|XP_006349505.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=259

 Score =   185 bits (470),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 103/118 (87%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA    LCIA LLC LT V+A+I GVY+GG+W +AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAVNWALCIASLLCFLTVVNAKIVGVYTGGSWTSAHATFYGGADASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS--CSPGNPSIFVTATNFCPPNFAL  445
            QGYGVNNAALSTALFN+GLSCG+CFEIKC++ +   C+PGNPSI VT TNFCPPN+AL
Sbjct  61   QGYGVNNAALSTALFNSGLSCGSCFEIKCTDSKKEYCNPGNPSILVTGTNFCPPNYAL  118



>gb|KJB16930.1| hypothetical protein B456_002G257400 [Gossypium raimondii]
Length=264

 Score =   185 bits (470),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 1/112 (1%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            +L +A L      V+ARIPGVY+GG+W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  12   MLHLASLFSIFVLVNARIPGVYTGGSWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  71

Query  293  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            N AALSTALFNNGLSCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFAL
Sbjct  72   NTAALSTALFNNGLSCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFAL  123



>ref|XP_004300427.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=259

 Score =   185 bits (470),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 103/117 (88%), Gaps = 2/117 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA   + CIA LL SLT++  ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAMASLACIAALLISLTSITEARIPGVYSGGAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            SQGYGV+ AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFA  117



>ref|XP_003552173.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   185 bits (469),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA+  L IA L     A  ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAIVFLHIASLASLFVATSARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG+PSI +TATNFCPPNFAL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSILITATNFCPPNFAL  117



>gb|KJB46592.1| hypothetical protein B456_007G376300 [Gossypium raimondii]
Length=262

 Score =   185 bits (469),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 103/115 (90%), Gaps = 1/115 (1%)
 Frame = +2

Query  104  AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  283
            ++ +LC   LL   T+V+A+IPGVYS G+W+TAHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  7    SLALLCFTSLLPFFTSVNAKIPGVYSTGSWETAHATFYGGSDASGTMGGACGYGNLYSQG  66

Query  284  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            YGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSIFVTATNFCPPNFAL
Sbjct  67   YGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNFAL  121



>ref|XP_007132063.1| hypothetical protein PHAVU_011G063800g [Phaseolus vulgaris]
 gb|ESW04057.1| hypothetical protein PHAVU_011G063800g [Phaseolus vulgaris]
Length=259

 Score =   184 bits (468),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 99/111 (89%), Gaps = 1/111 (1%)
 Frame = +2

Query  116  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  295
            LCIA ++     V ARIPG+YSGGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  8    LCIAFVISLTWMVEARIPGIYSGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  67

Query  296  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
             AALSTALFNNGLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPN+AL
Sbjct  68   TAALSTALFNNGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNYAL  118



>gb|AFB77223.1| expansin 1 [Betula platyphylla]
Length=258

 Score =   184 bits (468),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA+ V CI  L+  LT V A+IPGVYSGGAWQ+AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAALCVACIVSLMALLTLVDAKIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSI +TATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSILITATNFCPPNYAL  117



>gb|KHN17924.1| Expansin-A3 [Glycine soja]
Length=307

 Score =   186 bits (472),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA + ++ I  LL  +    A+IPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAMLNIIAIVSLLLLIIPSQAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C PGNPSIFVTATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYAL  117



>ref|XP_007133996.1| hypothetical protein PHAVU_010G010200g [Phaseolus vulgaris]
 gb|ESW05990.1| hypothetical protein PHAVU_010G010200g [Phaseolus vulgaris]
Length=258

 Score =   184 bits (468),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA +  LCIA  +    A +ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAEMLSLCIASFVTLFVATNARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG PSI +TATNFCPPN AL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGRPSIIITATNFCPPNLAL  117



>ref|XP_004492358.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=258

 Score =   184 bits (468),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA  +L IA L     A  ARIPG YSGG WQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAATVLLSIASLASLFVATTARIPGFYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCG+CFEIKC  D R C+PGNPSI +TATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFEIKCDQDPRWCNPGNPSILITATNFCPPNFA  116



>gb|KHN07218.1| Expansin-A4 [Glycine soja]
Length=246

 Score =   184 bits (467),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA +  LCIA L+    A  ARIPGV++GGAWQ AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAGMVPLCIASLVTLFVATSARIPGVFNGGAWQGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG+PSI +TATNFCPPNFAL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSIVITATNFCPPNFAL  117



>ref|XP_009607348.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=293

 Score =   185 bits (470),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
             L IA +LC LTAV+A+I G Y+GG W TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    TLYIASVLCFLTAVNAKISGNYAGGPWTTAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  293  NNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFAL  445
            NNAALST LFNNGLSCGACFE+KC++ + C+PGNPSI VTATNFCPPNFAL
Sbjct  67   NNAALSTVLFNNGLSCGACFELKCTDQKWCTPGNPSILVTATNFCPPNFAL  117



>ref|XP_003552064.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   184 bits (467),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA +  LCIA L+    A  ARIPGV++GGAWQ AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAGMVPLCIASLVTLFVATSARIPGVFNGGAWQGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG+PSI +TATNFCPPNFAL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSIVITATNFCPPNFAL  117



>gb|KDP20458.1| hypothetical protein JCGZ_05303 [Jatropha curcas]
Length=260

 Score =   184 bits (467),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 103/119 (87%), Gaps = 3/119 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV--HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            MA VR+L +A ++ SL  V   ARIPG Y GGAWQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAMVRMLSVASVVMSLMWVVAEARIPGNYMGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            YSQGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYAL  119



>ref|XP_002309061.1| expansin family protein [Populus trichocarpa]
 gb|ABK94860.1| unknown [Populus trichocarpa]
 gb|EEE92584.1| expansin family protein [Populus trichocarpa]
Length=260

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            +LCI  L       HARIPGV++GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  8    LLCIVFLTSVFVLAHARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  293  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            N AALSTALFNNGLSCGACFEIKC++D R C+PGNPSI VTATNFCPPNFA
Sbjct  68   NTAALSTALFNNGLSCGACFEIKCADDPRWCNPGNPSILVTATNFCPPNFA  118



>ref|XP_004249536.1| PREDICTED: expansin-A6-like [Solanum lycopersicum]
Length=257

 Score =   184 bits (466),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA   + CIA LL  LT V +++ GVY+ G WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAITWMFCIASLLSFLTIVESKVRGVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFAL  445
             GYGVNNAALST LFN+GLSCGACFEIKC++++ C+PGNPSIFVT TNFCPPN+AL
Sbjct  61   TGYGVNNAALSTVLFNSGLSCGACFEIKCTDEKWCNPGNPSIFVTGTNFCPPNYAL  116



>gb|KHG15821.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 1/115 (1%)
 Frame = +2

Query  104  AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  283
            ++ VLC A LL  L  V+ARIPGV++GGAW++AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  9    SLSVLCFASLLSFLAVVNARIPGVFTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  284  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            YGVN AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPN+AL
Sbjct  69   YGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYAL  123



>ref|XP_011094866.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=262

 Score =   184 bits (466),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 4/120 (3%)
 Frame = +2

Query  98   MAAVRVL-CIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            +AA+++L CI+ +LC LT   ARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  2    LAAMKLLLCISSILCFLTCSDARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLY  61

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCS---NDRSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGVN AALSTALFNNGLSCGACFEIKC    + + C+PG+PSI VTATNFCPPN+AL
Sbjct  62   SQGYGVNTAALSTALFNNGLSCGACFEIKCDAAQDPKWCNPGSPSILVTATNFCPPNYAL  121



>gb|KJB36710.1| hypothetical protein B456_006G172400 [Gossypium raimondii]
Length=264

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 101/115 (88%), Gaps = 1/115 (1%)
 Frame = +2

Query  104  AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  283
            ++ VLC A LL  L  V+ARIPGVY+GGAW++AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  9    SLSVLCFASLLSFLAVVNARIPGVYTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  284  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            YGVN AALSTALFNNGLSCG CFEIKC+ND R C  G+PSI +TATNFCPPN+AL
Sbjct  69   YGVNTAALSTALFNNGLSCGGCFEIKCANDPRWCHSGSPSIIITATNFCPPNYAL  123



>ref|XP_009364387.1| PREDICTED: expansin-A4 [Pyrus x bretschneideri]
Length=260

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 100/118 (85%), Gaps = 3/118 (3%)
 Frame = +2

Query  98   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            M  V V  CIA LL SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGVVSVSTCIATLLISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            YSQGYGVN  ALSTALFNNGLSCGACFEIKCSND R C  G+PSIF+TATNFCPPNFA
Sbjct  61   YSQGYGVNTGALSTALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNFA  118



>ref|XP_004173681.1| PREDICTED: expansin-A4-like, partial [Cucumis sativus]
Length=119

 Score =   178 bits (452),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 1/98 (1%)
 Frame = +2

Query  155  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  334
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  335  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFAL
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFAL  118



>ref|XP_008457477.1| PREDICTED: expansin-A4-like [Cucumis melo]
Length=259

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 99/112 (88%), Gaps = 1/112 (1%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            +LCIA L+ ++    ARIPGVYSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPATARIPGVYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  293  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNFAL
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFAL  118



>ref|NP_001236550.1| expansin precursor [Glycine max]
 gb|AAO15999.1|AF516880_1 expansin [Glycine max]
Length=258

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA+  + IA L+    A  ARIPGVY+GG WQ+AHATFYG +DASGTMGG CGYGNLYS
Sbjct  1    MAAIVFIHIASLVSLFVATSARIPGVYTGGPWQSAHATFYGASDASGTMGGRCGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PGNPSI +TATNFCPPNFAL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGNPSILITATNFCPPNFAL  117



>ref|XP_003519349.1| PREDICTED: expansin-A4-like [Glycine max]
Length=257

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 98/112 (88%), Gaps = 1/112 (1%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            +  + L+   LT+  ARIPG YSGGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  5    IAIVTLIAVVLTSTEARIPGAYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  64

Query  293  NNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            N AALSTALFNNGLSCGACFEIKC+ND S C  G+PSIFVTATNFCPPN+AL
Sbjct  65   NTAALSTALFNNGLSCGACFEIKCANDPSWCHAGSPSIFVTATNFCPPNYAL  116



>ref|XP_003616412.1| Expansin [Medicago truncatula]
 gb|AES99370.1| expansin A10 [Medicago truncatula]
Length=259

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 100/117 (85%), Gaps = 2/117 (2%)
 Frame = +2

Query  98   MAAVRVLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            M  + +  I + L   LT+  AR+PGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MTKLNITTIFSFLALLLTSTEARLPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            SQGYGVN AALSTALFNNGLSCG+CFE+KCSND S C PG+PSI VTATNFCPPNFA
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGSCFELKCSNDPSWCHPGSPSILVTATNFCPPNFA  117



>gb|AFK34565.1| unknown [Medicago truncatula]
Length=191

 Score =   181 bits (458),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 3/118 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNFA
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFA  118



>gb|AFK33369.1| unknown [Lotus japonicus]
Length=180

 Score =   180 bits (457),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 101/115 (88%), Gaps = 3/115 (3%)
 Frame = +2

Query  110  RVLCI--ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  283
            RVLC+  A L+  +  V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  7    RVLCLYMASLISLMWMVQARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQG  66

Query  284  YGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            YGVN AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+AL
Sbjct  67   YGVNTAALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYAL  121



>ref|XP_008233635.1| PREDICTED: expansin-A4-like [Prunus mume]
Length=259

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 103/118 (87%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA + +LCI +L+  + T V ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MATMTLLCIVSLIALASTIVEARIPGVYSGGAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGVN AALSTALFNNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPN+AL
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYAL  118



>ref|NP_001242978.1| expansin-A4-like precursor [Glycine max]
 gb|AEV43316.1| expansin A5a [Glycine max]
Length=259

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 98/112 (88%), Gaps = 1/112 (1%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            VLCI  ++     V ARIPGVYS GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VLCIFFIISLTCMVQARIPGVYSAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  293  NNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            N AALSTALFN+GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFAL
Sbjct  67   NTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFAL  118



>ref|XP_003597354.1| Cell wall protein Exp5 [Medicago truncatula]
Length=180

 Score =   180 bits (457),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 3/118 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNFA
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFA  118



>ref|XP_011027216.1| PREDICTED: expansin-A4 [Populus euphratica]
Length=258

 Score =   182 bits (463),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA     C+A L+  LT V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAIRATTCVASLVLFLTLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFN+GLSCGACFEIKC ND + C  G+PSI +TATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNSGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYAL  117



>gb|AFK40565.1| unknown [Medicago truncatula]
Length=231

 Score =   182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 3/118 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNFA
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFA  118



>gb|AAT11859.2| expansin 1 [Mangifera indica]
Length=260

 Score =   182 bits (463),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            M  + + CI  L C +  V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  3    MVGLSMACILSLRCLMWMVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  62

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  63   QGYGVNTAALSTALFNNGFSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYAL  119



>gb|KEH39447.1| expansin A10 [Medicago truncatula]
Length=260

 Score =   182 bits (463),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 3/118 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNFA
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFA  118



>gb|AAF32410.1|AF230277_1 alpha-expansin 2 [Triphysaria versicolor]
Length=262

 Score =   182 bits (463),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 97/113 (86%), Gaps = 3/113 (3%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            +LCIA  +C LT+  ARIPG+YSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  8    LLCIATFICFLTSAQARIPGIYSGGPWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  293  NNAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPNFA  442
            N AALSTALFNNGLSCGACFEI+C    + + C+PG PSI VTATNFCPPNFA
Sbjct  68   NTAALSTALFNNGLSCGACFEIRCDMAQDGKWCNPGTPSILVTATNFCPPNFA  120



>ref|XP_008464122.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=258

 Score =   182 bits (462),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA    LCIALLL     + ARIPGVYSGG WQ+AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MATPISLCIALLLSFSLLIDARIPGVYSGGPWQSAHATFYGGADASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFN G SCGACFEIKC+ND R C  G+PSI +TATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYAL  117



>gb|AAL31477.1|AF319472_1 alpha-expansin 6 precursor [Cucumis sativus]
Length=259

 Score =   182 bits (462),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 99/112 (88%), Gaps = 1/112 (1%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            +LCIA L+ ++    ARIPG+YSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  293  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNFAL
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFAL  118



>ref|XP_004154408.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004173564.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN65728.1| hypothetical protein Csa_1G522540 [Cucumis sativus]
Length=259

 Score =   182 bits (462),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 99/112 (88%), Gaps = 1/112 (1%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            +LCIA L+ ++    ARIPG+YSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  293  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNFAL
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFAL  118



>ref|XP_006288496.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
 gb|EOA21394.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
Length=258

 Score =   182 bits (462),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA  +  +A++L +   VHARIPGVY+GG W  AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAAKVITLMAVMLATAFTVHARIPGVYTGGPWVNAHATFYGGADASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNFA  116



>ref|XP_004302749.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=260

 Score =   182 bits (462),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +2

Query  107  VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  286
            +R+LCIA L   L   +ARIPG Y+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  6    LRLLCIASLASLLMVANARIPGPYTGGPWQEAHATFYGGSDASGTMGGACGYGNLYSQGY  65

Query  287  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            GVN AALSTALFNNGLSCGACFEIKC +D R C+ G PSIFVTATNFCPPNFA
Sbjct  66   GVNTAALSTALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFA  118



>gb|AAR82850.1| expansin-2 [Petunia x hybrida]
Length=262

 Score =   182 bits (462),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 5/120 (4%)
 Frame = +2

Query  98   MAAVRVLC--IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            MA++ V+   I  LL  ++ V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MASMGVMATYILALLFLISLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFA  442
            YSQGYGVN AALSTALFNNGLSCGACFE+KC+ND   + C PGNPSI +TATNFCPPN+A
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFELKCTNDPHWKWCLPGNPSILITATNFCPPNYA  120



>ref|XP_010256907.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   182 bits (462),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +2

Query  101  AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  280
            A V V+   LL+  LT V ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  4    ATVNVVSAVLLISFLTLVDARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  281  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            GYGVN AALSTALFN GLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+AL
Sbjct  64   GYGVNTAALSTALFNAGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYAL  119



>ref|XP_003544219.1| PREDICTED: expansin-A6-like [Glycine max]
Length=260

 Score =   182 bits (461),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = +2

Query  122  IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNA  301
            I  L+  L +  AR+PGVYSGGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN A
Sbjct  11   IVTLITLLASTEARVPGVYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTA  70

Query  302  ALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            ALSTALFNNGLSCGACFEIKC+ND S C  G+PSIFVTATNFCPPN+AL
Sbjct  71   ALSTALFNNGLSCGACFEIKCANDPSWCHAGSPSIFVTATNFCPPNYAL  119



>gb|AEN70914.1| expansin [Gossypium trilobum]
Length=259

 Score =   182 bits (461),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPNFAL
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNFAL  118



>gb|KEH22886.1| expansin-A1-like protein [Medicago truncatula]
Length=258

 Score =   182 bits (461),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA + +L IA L     A  ARIPGVYSGG W +AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAGILLLTIASLASLFAATTARIPGVYSGGPWTSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFE+KC  D R C+PGNPSI +TATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCDQDPRWCNPGNPSILITATNFCPPNFA  116



>gb|ACJ48968.2| expansin [Breonia chinensis]
 gb|ACT10284.2| expansin [Breonia chinensis]
Length=258

 Score =   182 bits (461),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA+ +  I  L   LT   ARIPGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAMCLTSIVALSLLLTLAEARIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFE+KC++D + C PG+PSIF+TATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCADDPQWCHPGSPSIFITATNFCPPNYAL  117



>ref|NP_001284471.1| expansin-A4 precursor [Cucumis melo]
 gb|ABI94060.1| ripening-related expansin [Cucumis melo]
Length=259

 Score =   182 bits (461),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 1/98 (1%)
 Frame = +2

Query  155  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  334
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  335  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFAL
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFAL  118



>gb|ACO07292.1| expansin 10 [Cucumis sativus]
Length=259

 Score =   182 bits (461),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 1/98 (1%)
 Frame = +2

Query  155  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  334
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  335  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFAL
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFAL  118



>ref|XP_004142066.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN54256.1| hypothetical protein Csa_4G296100 [Cucumis sativus]
Length=259

 Score =   182 bits (461),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 1/98 (1%)
 Frame = +2

Query  155  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  334
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  335  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFAL
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFAL  118



>ref|XP_002298353.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|ABK92494.1| unknown [Populus trichocarpa]
 gb|EEE83158.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   182 bits (461),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 103/121 (85%), Gaps = 5/121 (4%)
 Frame = +2

Query  98   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  265
            MA   ++CIA    +++ SL    ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYG
Sbjct  1    MAMSSLICIATSLLIIMSSLWMAEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYG  60

Query  266  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            NLYSQGYGV+ AALSTALFNNGL+CG+CFEIKC++D R C  G+PSIF+TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLTCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  443  L  445
            L
Sbjct  121  L  121



>gb|AEE69071.1| expansin-4 [Petunia hybrid cultivar]
Length=248

 Score =   181 bits (460),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 1/104 (1%)
 Frame = +2

Query  137  CSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  316
            C LTAV+A+IPGVY GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST 
Sbjct  4    CFLTAVYAKIPGVYIGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTV  63

Query  317  LFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            LFN+GLSCGACFE+KC+ND   C PGNPSIFVTATNFCPPN+AL
Sbjct  64   LFNSGLSCGACFELKCTNDEPWCLPGNPSIFVTATNFCPPNYAL  107



>gb|AAR82849.1| expansin-1 [Petunia x hybrida]
Length=260

 Score =   182 bits (461),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  113  VLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            V C+ +L+L  L  V ARIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VACVTSLVLLMLLTVEARIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  290  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            VNN ALSTALFNNGLSCGACFEIKC  D + C  G+PSIF+TATNFCPPN+AL
Sbjct  67   VNNGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNYAL  119



>gb|AFK44569.1| unknown [Medicago truncatula]
Length=258

 Score =   181 bits (460),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  110  RVLCIA-LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  286
            ++L IA +++ S+  V ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  4    KMLYIAFIIITSMYIVQARIPGVYSGGQWQDAHATFYGGSDASGTMGGACGYGNLYSQGY  63

Query  287  GVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            GVN AALSTALFNNGLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPNFA
Sbjct  64   GVNTAALSTALFNNGLSCGACFEIKCANDKEWCRSGSPSIFITATNFCPPNFA  116



>ref|XP_009757427.1| PREDICTED: expansin-A4-like [Nicotiana sylvestris]
Length=261

 Score =   181 bits (460),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 100/120 (83%), Gaps = 5/120 (4%)
 Frame = +2

Query  92   GKMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            G M  +  +   + L SL  V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  2    GSMGVITSIVGLIFLVSL--VEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNL  59

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFA  442
            YSQGYGVN AALSTALFNNGLSCGACFEIKC+ND   + C PG+PSI +TATNFCPPN+A
Sbjct  60   YSQGYGVNTAALSTALFNNGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNYA  119



>ref|XP_007150329.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
 gb|ESW22323.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
Length=256

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  113  VLCIALLLCSLT-AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            VL IAL   S+   V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  3    VLGIALCFASIMWMVDARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  62

Query  290  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            VN AALSTALFNNGLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+AL
Sbjct  63   VNTAALSTALFNNGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYAL  115



>ref|XP_011035307.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=262

 Score =   181 bits (460),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 103/121 (85%), Gaps = 5/121 (4%)
 Frame = +2

Query  98   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  265
            MA   ++CIA    +++ SL    ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYG
Sbjct  1    MAMSSLICIATSLLIIMSSLWMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYG  60

Query  266  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            NLYSQGYGV+ AALSTALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  443  L  445
            L
Sbjct  121  L  121



>emb|CAA59470.1| orf [Pisum sativum]
Length=258

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA+ +L IA L        ARIPGVY+GG W +AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAILLLTIASLTSLFAPTTARIPGVYTGGPWTSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFE+KC  D R C+PGNPSI +TATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCDQDPRWCNPGNPSILITATNFCPPNFA  116



>ref|XP_008802710.1| PREDICTED: expansin-A4 [Phoenix dactylifera]
Length=258

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA +R++ +A LL  L    ARIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAILRLVALASLLAFLVPAAARIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGV+ AALSTALFN+GLSCGACFEIKC+++ + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   QGYGVDTAALSTALFNDGLSCGACFEIKCADEPQWCHSGSPSIFITATNFCPPNYAL  117



>ref|XP_007009225.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY18035.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=259

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            V C+  L   L AV ARIPGVYSG  WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VACLVALNLILVAVEARIPGVYSGAEWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  293  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            N AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSIFVTATNFCPPN+AL
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANEPQWCHAGSPSIFVTATNFCPPNYAL  118



>gb|KEH30169.1| expansin A10 [Medicago truncatula]
Length=258

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  110  RVLCIA-LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  286
            ++L IA +++ S+  V ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  4    KMLYIAFIIITSMYIVQARIPGVYSGGQWQDAHATFYGGSDASGTMGGACGYGNLYSQGY  63

Query  287  GVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            GVN AALSTALFNNGLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPNFA
Sbjct  64   GVNTAALSTALFNNGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNFA  116



>ref|XP_008357089.1| PREDICTED: expansin-A6 [Malus domestica]
Length=260

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 99/118 (84%), Gaps = 3/118 (3%)
 Frame = +2

Query  98   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            M  V V  CIA LL SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MGVVSVSTCIATLLISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMXGACGYGNL  60

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            YSQGYGVN  ALSTALFNNGLSCGACFEIKCSND R C  G+PSIF+TATNFCPPNFA
Sbjct  61   YSQGYGVNTGALSTALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNFA  118



>ref|NP_001234881.1| expansin9 precursor [Solanum lycopersicum]
 emb|CAB46492.1| expansin9 [Solanum lycopersicum]
Length=257

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = +2

Query  122  IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNA  301
            + ++L  L  V  RIPGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNA
Sbjct  8    LIIILVILVGVEGRIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNA  67

Query  302  ALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            ALSTALFNNGLSCGACFEIKC N  + C PG+PSI +TATNFCPPN+AL
Sbjct  68   ALSTALFNNGLSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNYAL  116



>gb|AEQ55290.1| expansin [Breonia chinensis]
Length=259

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 104/119 (87%), Gaps = 4/119 (3%)
 Frame = +2

Query  98   MAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            MA V ++CIA  L L  L A  ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAVVGLVCIASVLALAGLVA-EARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNL  59

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            YSQGYGVN AALSTALFN+GL CGACFEIKC+N+ + C PG+PSIFVTATNFCPPN+AL
Sbjct  60   YSQGYGVNTAALSTALFNSGLRCGACFEIKCANEPQWCHPGSPSIFVTATNFCPPNYAL  118



>ref|XP_007218834.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
 gb|EMJ20033.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
Length=259

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 102/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA + +LCI +L+  + T V ARIPGVYSG AWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MATMALLCIVSLIALASTIVEARIPGVYSGEAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGVN AALSTALFNNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPN+AL
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYAL  118



>gb|AAM22624.1|AF428177_1 expansin 10 precursor [Rumex palustris]
Length=258

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA+  L   + + S  +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYS
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNG+SCGACFEIKC++D R C PGNPSI +TATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGMSCGACFEIKCADDPRWCHPGNPSILITATNFCPPNFA  116



>gb|AEN70891.1| expansin [Gossypium thurberi]
Length=259

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 102/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYAL  118



>gb|AFZ78606.1| expansin protein [Populus tomentosa]
Length=262

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 103/121 (85%), Gaps = 5/121 (4%)
 Frame = +2

Query  98   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  265
            MA   ++CIA    +++ SL    ARIPGVYSGGAW+ AHATFYGGADASGTMGGACGYG
Sbjct  1    MAMRSLICIATSLLIIVSSLWMAEARIPGVYSGGAWENAHATFYGGADASGTMGGACGYG  60

Query  266  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            NLYSQGYGV+ AALSTALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  443  L  445
            L
Sbjct  121  L  121



>ref|XP_010509297.1| PREDICTED: expansin-A3-like [Camelina sativa]
Length=164

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 92/101 (91%), Gaps = 1/101 (1%)
 Frame = +2

Query  143  LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  322
            LTA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  20   LTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  79

Query  323  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            NNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA
Sbjct  80   NNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFA  120



>ref|XP_006410954.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
 dbj|BAJ34443.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52407.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
Length=263

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = +2

Query  107  VRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  283
            +R L +A+ +   L A +A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  8    IRFLWLAVTISFLLAATNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQG  67

Query  284  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            YGVN AALSTALFNNG SCGACFEIKC++D R C PGNPSIFVTATNFCPPNFA
Sbjct  68   YGVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSIFVTATNFCPPNFA  121



>gb|KJB20063.1| hypothetical protein B456_003G131000 [Gossypium raimondii]
Length=190

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 102/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYAL  118



>gb|AEN70895.1| expansin [Gossypium mustelinum]
Length=259

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 102/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYAL  118



>gb|AEN70901.1| expansin [Gossypium barbadense var. brasiliense]
Length=259

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 102/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYAL  118



>gb|ADY68817.1| expansin [Gossypium raimondii]
Length=259

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 102/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYAL  118



>gb|ADY68814.1| expansin [Gossypium barbadense]
 gb|ADY68816.1| expansin [Gossypium herbaceum subsp. africanum]
 gb|AEN70897.1| expansin [Gossypium darwinii]
 gb|AEN70899.1| expansin [Gossypium tomentosum]
 gb|AEN70903.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70905.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70909.1| expansin [Gossypium davidsonii]
 gb|AEN70910.1| expansin [Gossypium klotzschianum]
 gb|KJB20062.1| hypothetical protein B456_003G131000 [Gossypium raimondii]
Length=259

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 102/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYAL  118



>ref|XP_009343581.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   181 bits (458),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 102/119 (86%), Gaps = 4/119 (3%)
 Frame = +2

Query  98   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  268
            MAA+  +LCIA L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIASLMALASTIVVEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGN  60

Query  269  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            LYSQGYGVN AALSTALFNNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPNFA
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCKSGSPSIFVTATNFCPPNFA  119



>gb|AEQ55275.1| expansin [Breonia chinensis]
Length=259

 Score =   180 bits (457),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 104/119 (87%), Gaps = 4/119 (3%)
 Frame = +2

Query  98   MAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            MA V ++CIA  L L  L A  ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAIVGLVCIASVLALAGLVA-EARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNL  59

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            YSQGYGVN AALSTALFN+GL CGACFEIKC+N+ + C PG+PSIFVTATNFCPPN+AL
Sbjct  60   YSQGYGVNTAALSTALFNSGLRCGACFEIKCANEPQWCHPGSPSIFVTATNFCPPNYAL  118



>ref|XP_009768238.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=257

 Score =   180 bits (457),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 1/105 (1%)
 Frame = +2

Query  134  LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  313
            L  + AV  RIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNN ALST
Sbjct  12   LILVAAVEGRIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNGALST  71

Query  314  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            ALFNNGLSCGACFEIKC  D +SC  G+PSIF+TATNFCPPNFAL
Sbjct  72   ALFNNGLSCGACFEIKCDKDPQSCHSGSPSIFITATNFCPPNFAL  116



>ref|XP_010106493.1| hypothetical protein L484_025251 [Morus notabilis]
 gb|EXC10669.1| hypothetical protein L484_025251 [Morus notabilis]
Length=258

 Score =   180 bits (457),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA + V  IA LL  +    ARIPGVY+GG+W+TAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAGLTVTWIASLLSLMWMAEARIPGVYTGGSWETAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGV+ AALSTALFNNGLSCGACFEIKC+ND + C  G+PSI +TATNFCPPN+AL
Sbjct  61   QGYGVSTAALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNYAL  117



>ref|XP_010517036.1| PREDICTED: expansin-A3 [Camelina sativa]
Length=262

 Score =   180 bits (457),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 100/119 (84%), Gaps = 4/119 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLCS---LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  268
            MA    +C+ L + +   LTA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGN
Sbjct  2    MATAFGICLWLAVTASFLLTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGN  61

Query  269  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            LYSQGYGVN AALSTALFNNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA
Sbjct  62   LYSQGYGVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFA  120



>ref|XP_009761115.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=260

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 99/119 (83%), Gaps = 3/119 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSL--TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            M  +   CI  L+ SL    V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MEMLNFFCIFSLIISLFLLTVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            YSQGYGVNNAALSTALFNNGLSCGACFEIKC N  + C  G+PSI +TATNFCPPN+AL
Sbjct  61   YSQGYGVNNAALSTALFNNGLSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNYAL  119



>ref|XP_008343537.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 102/119 (86%), Gaps = 4/119 (3%)
 Frame = +2

Query  98   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  268
            MAA+  +LCIA L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIASLMALASTIVVEARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  269  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            LYSQGYGVN AALSTALFNNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFA  119



>ref|XP_007163413.1| hypothetical protein PHAVU_001G232600g [Phaseolus vulgaris]
 gb|ESW35407.1| hypothetical protein PHAVU_001G232600g [Phaseolus vulgaris]
Length=258

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            M  + +  I  LL  LT   A+IPG +SGG WQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MPMLNIFAIVSLLPFLTPSQAKIPGAFSGGPWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNG SCGACF+IKC++D + C PGNPSIFVTATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFQIKCTHDPKWCLPGNPSIFVTATNFCPPNYAL  117



>ref|XP_002533097.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
 gb|EEF29289.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
Length=259

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 102/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  95   KMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            KM +V +  + LL+  + A  ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  2    KMGSV-ISGVILLVMLMGASEARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSI +TATNFCPPNFAL
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNFAL  118



>gb|ADY68815.1| expansin [Gossypium barbadense]
 gb|ADY68819.1| expansin [Gossypium hirsutum]
 gb|AEN70892.1| expansin [Gossypium laxum]
 gb|AEN70894.1| expansin [Gossypium turneri]
 gb|AEN70896.1| expansin [Gossypium mustelinum]
 gb|AEN70898.1| expansin [Gossypium darwinii]
 gb|AEN70902.1| expansin [Gossypium barbadense var. brasiliense]
 gb|AEN70904.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70906.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70908.1| expansin [Gossypium harknessii]
 gb|AEN70911.1| expansin [Gossypium aridum]
 gb|AEN70912.1| expansin [Gossypium gossypioides]
 gb|AEN70913.1| expansin [Gossypium lobatum]
Length=259

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 101/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYAL  118



>gb|AEN70907.1| expansin [Gossypium armourianum]
Length=259

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 101/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYAL  118



>gb|AHL25255.1| expansin [Boehmeria nivea]
Length=260

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 3/116 (3%)
 Frame = +2

Query  101  AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  280
            AA ++ C+  L+    A  ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  6    AAWKIACLVSLMT--LATEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  281  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            GYGVN AALSTALFN+GLSCGACFE+KC+ND +SC  G+PSI VTATNFCPPN+AL
Sbjct  64   GYGVNTAALSTALFNSGLSCGACFELKCANDPKSCHSGSPSIIVTATNFCPPNYAL  119



>ref|XP_009589397.1| PREDICTED: expansin-A4-like [Nicotiana tomentosiformis]
Length=261

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 103/119 (87%), Gaps = 4/119 (3%)
 Frame = +2

Query  98   MAAVRVLC-IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA++ V+  I  L+  ++ V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MASMGVITSIIGLIFLVSLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFA  442
            SQGYGVN AALSTALFNNGLSCGACFEIKC+ND   + C PG+PSI +TATNFCPPN+A
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNYA  119



>emb|CBI16120.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA   V+C A L+   + V A+IPG YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAVGVVVCFASLISLFSLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFE+KC+ND + C  G+PSI +TATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYAL  117



>gb|AEN70893.1| expansin [Gossypium schwendimanii]
Length=259

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 101/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSIWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYAL  118



>gb|AAR09168.1| alpha-expansin 1 [Populus tremula x Populus tremuloides]
Length=262

 Score =   180 bits (456),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 103/121 (85%), Gaps = 5/121 (4%)
 Frame = +2

Query  98   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  265
            MA   ++CIA    +++ SL    ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYG
Sbjct  1    MAMSSLICIATSLLIIVSSLWMAEARIPGVYSGGAWENAHATFYGGSDASGTMGGACGYG  60

Query  266  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            NLYSQGYGV+ AALSTALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  443  L  445
            L
Sbjct  121  L  121



>ref|XP_004143121.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004166197.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN47143.1| hypothetical protein Csa_6G190340 [Cucumis sativus]
Length=258

 Score =   179 bits (455),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 97/117 (83%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA    LCI LLL     + ARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MATPFSLCIPLLLSFSLLIEARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFN G SCGACFEIKC+ND R C  G+PSI +TATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYAL  117



>gb|AAM22625.1|AF428178_1 expansin 11 precursor [Rumex palustris]
Length=258

 Score =   179 bits (455),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA+  L   + + S  +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYS
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSI +TATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNFA  116



>ref|XP_002283530.1| PREDICTED: expansin-A4 [Vitis vinifera]
Length=258

 Score =   179 bits (455),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA   V+C A L+   + V A+IPG YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAVGVVVCFASLISLFSLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFE+KC+ND + C  G+PSI +TATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYAL  117



>gb|AAM22626.1|AF428179_1 expansin 12 precursor [Rumex palustris]
Length=258

 Score =   179 bits (455),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA+  L   + + S  +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYS
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSI +TATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNFA  116



>ref|XP_010505357.1| PREDICTED: expansin-A3-like [Camelina sativa]
Length=262

 Score =   179 bits (455),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 98/113 (87%), Gaps = 4/113 (4%)
 Frame = +2

Query  116  LCIALLLCS---LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  286
            +C+ L + +   LTA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  8    ICLWLAVTASFLLTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGY  67

Query  287  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            GVN AALSTALFNNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA
Sbjct  68   GVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFA  120



>ref|NP_181300.1| expansin-A3 [Arabidopsis thaliana]
 ref|XP_004253297.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
 sp|O80932.1|EXPA3_ARATH RecName: Full=Expansin-A3; Short=AtEXPA3; AltName: Full=Alpha-expansin-3; 
Short=At-EXP3; Short=AtEx3; AltName: Full=Ath-ExpAlpha-1.9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC23634.1| putative expansin [Arabidopsis thaliana]
 gb|AAL91271.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AAM67431.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AEC09429.1| expansin-A3 [Arabidopsis thaliana]
Length=262

 Score =   179 bits (455),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 92/101 (91%), Gaps = 1/101 (1%)
 Frame = +2

Query  143  LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  322
            LTA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  20   LTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  79

Query  323  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            NNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA
Sbjct  80   NNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFA  120



>ref|XP_009597793.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   179 bits (455),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 98/112 (88%), Gaps = 2/112 (2%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            + C+  L+  + AV +RIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  9    IACVFSLML-VVAVESRIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  293  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            NN ALSTALFNNGLSCGACFEIKC  D + C  G+PSIF+TATNFCPPNFAL
Sbjct  68   NNGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNFAL  119



>ref|XP_007205739.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
 gb|EMJ06938.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
Length=187

 Score =   177 bits (448),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 98/110 (89%), Gaps = 2/110 (2%)
 Frame = +2

Query  119  CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  295
            C+A LL SL  V  ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  296  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFA  118



>ref|XP_010920576.1| PREDICTED: expansin-A4-like [Elaeis guineensis]
Length=260

 Score =   179 bits (454),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +2

Query  131  LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  310
            LL  LT   ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALS
Sbjct  14   LLAFLTLADARIPGVYAGGQWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALS  73

Query  311  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            TALFN GLSCGACFEIKC++D R C PG+PSIF+TATNFCPPN+AL
Sbjct  74   TALFNEGLSCGACFEIKCADDPRWCHPGSPSIFITATNFCPPNYAL  119



>gb|KJB55836.1| hypothetical protein B456_009G098800 [Gossypium raimondii]
Length=259

 Score =   179 bits (454),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 100/118 (85%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            M     +CI + L+ S+    ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MGIAGAVCIIVGLISSMWMAEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGVN AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYAL  118



>ref|XP_003547326.1| PREDICTED: expansin-A4-like [Glycine max]
Length=256

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 99/112 (88%), Gaps = 4/112 (4%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            VLC   L+  +  V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VLC---LMSLMWMVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  63

Query  293  NNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            N AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+AL
Sbjct  64   NTAALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYAL  115



>gb|KFK36651.1| alpha-expansin 4 [Arabis alpina]
Length=261

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 1/101 (1%)
 Frame = +2

Query  143  LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  322
            LTA +A+IPGVY+GG WQ AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  19   LTASNAKIPGVYTGGPWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALF  78

Query  323  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            NNGLSCGACFE+KC++D R C PGNPSI VTATNFCPPNFA
Sbjct  79   NNGLSCGACFEMKCTDDPRWCVPGNPSILVTATNFCPPNFA  119



>ref|XP_008240857.1| PREDICTED: expansin-A6-like [Prunus mume]
Length=258

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA V +LCIA LL    A +ARI G  +GG W+ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAFVHMLCIASLLSLFMAANARIRGFDTGGPWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            +GYGVN AALSTALFNNGLSCGACFEIKC +D + C PGNPSIF+TATNFCPPN+AL
Sbjct  61   EGYGVNTAALSTALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYAL  117



>gb|ADY68818.1| expansin [Gossypium hirsutum]
Length=259

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 101/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
             QGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   GQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYAL  118



>ref|XP_009353647.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
 ref|XP_009349875.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 100/118 (85%), Gaps = 3/118 (3%)
 Frame = +2

Query  98   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            M  V V  CIA L+ SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGVVSVSTCIASLIISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            YSQGYGVN AALSTALFNNGLSCGACFE+KC++D S C  G PSIF+TATNFCPPNFA
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFELKCADDPSWCHAGGPSIFITATNFCPPNFA  118



>gb|ACK36943.1| expansin [Annona cherimola]
Length=259

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = +2

Query  107  VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  286
            +R    +L+LC L+ V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  6    IRTFVASLILC-LSLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGY  64

Query  287  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            GVN A LSTA FNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+AL
Sbjct  65   GVNTAVLSTAFFNNGLSCGACFEIKCADDPKWCHSGSPSILITATNFCPPNYAL  118



>ref|NP_001288899.1| expansin-A6 precursor [Brassica rapa]
 gb|AGM16348.1| alpha-expansin protein 6 [Brassica rapa]
Length=260

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = +2

Query  113  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCVLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  290  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFA  118



>ref|XP_009349313.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 100/118 (85%), Gaps = 3/118 (3%)
 Frame = +2

Query  98   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            M  V V  CIA L+ SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGVVSVSTCIASLIISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            YSQGYGVN AALSTALFNNGLSCGACFE+KC++D S C  G PSIF+TATNFCPPNFA
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFELKCADDPSWCHAGGPSIFITATNFCPPNFA  118



>gb|AAM47000.1|AF512542_1 alpha-expansin precursor [Gossypium hirsutum]
Length=264

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 100/115 (87%), Gaps = 1/115 (1%)
 Frame = +2

Query  104  AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  283
            ++ VLC A LL     V+ARIPGV++GGAW++AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  9    SLSVLCFASLLSFFGWVNARIPGVFTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  284  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            YGVN AALS ALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPN+AL
Sbjct  69   YGVNTAALSPALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYAL  123



>emb|CDY31742.1| BnaA04g16780D [Brassica napus]
Length=260

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = +2

Query  113  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCVLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  290  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFA  118



>ref|XP_010685747.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=261

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 99/119 (83%), Gaps = 1/119 (1%)
 Frame = +2

Query  92   GKMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            G  +   ++ +  L  + T V ARIPG Y GG+WQ+AHATFYGG+DASGTMGGACGYGNL
Sbjct  2    GMFSIFNIVSLMTLWVTSTLVDARIPGNYQGGSWQSAHATFYGGSDASGTMGGACGYGNL  61

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            YSQGYGVN AALSTALFN+GLSCGACFE+KC+ND R C PG+PSI +TATNFCPPNFAL
Sbjct  62   YSQGYGVNTAALSTALFNSGLSCGACFELKCANDPRWCHPGSPSILITATNFCPPNFAL  120



>ref|XP_011042710.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=262

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 101/121 (83%), Gaps = 5/121 (4%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV----HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  265
            MA  R+LC    L  + ++     ARIPGVYSGGAW+TAHATFYGGADASGTMGGACGYG
Sbjct  1    MATSRLLCFTTTLLIMMSLMWKGEARIPGVYSGGAWETAHATFYGGADASGTMGGACGYG  60

Query  266  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            NLYSQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYA  120

Query  443  L  445
            L
Sbjct  121  L  121



>ref|XP_006409928.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
 gb|ESQ51381.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
Length=260

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = +2

Query  113  VLCIALLLCSLTAVH-ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            VLC+  +L  LTA++ ARIPGVY+GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCVLTILADLTAIYEARIPGVYNGGGWESAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  290  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFA  118



>gb|KJB73995.1| hypothetical protein B456_011G266000 [Gossypium raimondii]
Length=258

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = +2

Query  122  IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNA  301
            +  L+   TAV ARIPGVYSGGAWQ+AHATFYGG DASGTMGGACG+GNLYSQGYGVN A
Sbjct  9    LVYLIIISTAVEARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGFGNLYSQGYGVNTA  68

Query  302  ALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            ALSTALFNNG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+AL
Sbjct  69   ALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYAL  117



>gb|AEU08407.1| expansin 2 [Prunus salicina]
Length=260

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 98/110 (89%), Gaps = 2/110 (2%)
 Frame = +2

Query  119  CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  295
            C+A LL SL  V  ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  296  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFA  118



>ref|XP_007205740.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
 dbj|BAC66787.1| expansin [Prunus persica]
 gb|EMJ06939.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
Length=260

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 98/110 (89%), Gaps = 2/110 (2%)
 Frame = +2

Query  119  CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  295
            C+A LL SL  V  ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  296  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFA  118



>ref|XP_009357738.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
 ref|XP_009357739.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 101/119 (85%), Gaps = 4/119 (3%)
 Frame = +2

Query  98   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  268
            MAA+  +LCI  L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  269  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            LYSQGYGVN AALSTALFNNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFA  119



>ref|XP_010528418.1| PREDICTED: expansin-A3 [Tarenaya hassleriana]
Length=264

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 97/111 (87%), Gaps = 2/111 (2%)
 Frame = +2

Query  116  LCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            L +A+    L A   ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  12   LSLAITASFLVASATARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  71

Query  293  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            N AALSTALFNNGLSCGACFEIKC+ D + C+PGNPSIFVTATNFCPPNFA
Sbjct  72   NTAALSTALFNNGLSCGACFEIKCTEDPKWCNPGNPSIFVTATNFCPPNFA  122



>ref|XP_008223717.1| PREDICTED: expansin-A4 [Prunus mume]
Length=260

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 98/110 (89%), Gaps = 2/110 (2%)
 Frame = +2

Query  119  CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  295
            C+A LL SL  V  ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  296  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFA  118



>gb|AEN70900.1| expansin [Gossypium tomentosum]
Length=259

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 100/118 (85%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHAT YGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATLYGGADASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYAL  118



>gb|AAL31480.1|AF319475_1 alpha-expansin 9 precursor [Cucumis sativus]
Length=245

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = +2

Query  152  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  331
            VHARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  20   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  79

Query  332  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            LSCGACFE+KC+ND + C  G+PSIF+TATNFCPPN+AL
Sbjct  80   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYAL  118



>emb|CDP09064.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 102/119 (86%), Gaps = 3/119 (3%)
 Frame = +2

Query  98   MAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            MA V ++CIA  L L  +    ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAVVGLVCIASVLALAFMLGAEARIPGVYTGGDWQSAHATFYGGSDASGTMGGACGYGNL  60

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            YSQGYGVN AALSTALF++GLSCGACFEIKC++D   C PG+PSIFVTATNFCPPN+AL
Sbjct  61   YSQGYGVNTAALSTALFSSGLSCGACFEIKCASDPGWCHPGSPSIFVTATNFCPPNYAL  119



>ref|XP_008461679.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=260

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = +2

Query  152  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  331
            VHARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  21   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  80

Query  332  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            LSCGACFE+KC+ND + C  G+PSIF+TATNFCPPN+AL
Sbjct  81   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYAL  119



>ref|XP_003543517.1| PREDICTED: expansin-A4 [Glycine max]
Length=257

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 98/110 (89%), Gaps = 4/110 (4%)
 Frame = +2

Query  128  LLLCSLT---AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNN  298
            +LLC ++    V ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN 
Sbjct  7    VLLCLMSLMWMVDARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNT  66

Query  299  AALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+AL
Sbjct  67   AALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYAL  116



>gb|ADC35365.1| alpha-expansin 2 [Coffea arabica]
Length=258

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA+ + CI  L   LT   ARIPGVY+G +W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAMGLTCIVALSLLLTLTEARIPGVYTGDSWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNG SCG+CFE+KC++D + C PG+PSI +TATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNYAL  117



>ref|XP_004147685.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004161909.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN50556.1| hypothetical protein Csa_5G182120 [Cucumis sativus]
Length=259

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = +2

Query  152  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  331
            VHARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  20   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  79

Query  332  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            LSCGACFE+KC+ND + C  G+PSIF+TATNFCPPN+AL
Sbjct  80   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYAL  118



>emb|CDX77222.1| BnaC04g40170D [Brassica napus]
Length=260

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = +2

Query  113  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCLLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  290  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFA  118



>gb|AEQ55274.1| expansin [Breonia chinensis]
 gb|AEQ55289.1| expansin [Breonia chinensis]
Length=256

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 101/117 (86%), Gaps = 3/117 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA V + CIA +L  +    ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAIVVLTCIASVLALVA--EARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYS  58

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN  ALSTALFN+GLSCGACFE+KC+ND   C PG+PSIF+TATNFCPPN+AL
Sbjct  59   QGYGVNTGALSTALFNSGLSCGACFELKCANDPGWCHPGSPSIFITATNFCPPNYAL  115



>gb|KHG20113.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=259

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 99/118 (84%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            M     +CI +  + S+    ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MGIAGAVCIIVGFISSMWMAEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGVN AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYAL  118



>ref|XP_010922313.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A4-like [Elaeis guineensis]
Length=258

 Score =   177 bits (449),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA +R++ +A LL  L    ARIPGVYS G WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAILRLVALASLLAFLVPAAARIPGVYSSGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGV  AALSTALFN+G+SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   QGYGVETAALSTALFNDGMSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNYAL  117



>ref|XP_009130690.1| PREDICTED: expansin-A9-like [Brassica rapa]
 emb|CDY55128.1| BnaA03g55050D [Brassica napus]
Length=261

 Score =   177 bits (449),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 98/116 (84%), Gaps = 3/116 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            M A+ ++ +A L  +LT V+A+IPGVY+GG W  AHATFYG ADASGTMGGACGYGNLYS
Sbjct  6    MTAMAIMVVAAL--TLTTVNAKIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYS  63

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFE+KC ND   C PGNPSI +TATNFCPPNFA
Sbjct  64   QGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFA  119



>ref|XP_002881524.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002881525.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57783.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57784.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   177 bits (449),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 91/101 (90%), Gaps = 1/101 (1%)
 Frame = +2

Query  143  LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  322
             TA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  20   FTASNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  79

Query  323  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            NNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA
Sbjct  80   NNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFA  120



>ref|XP_010521846.1| PREDICTED: expansin-A6 [Tarenaya hassleriana]
Length=259

 Score =   177 bits (448),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 100/118 (85%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA + ++ +  +L SLT +  ARIPGVY GGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAMISLVFVLTILVSLTLMSEARIPGVYGGGAWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGVN AALSTALFNNG  CGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   SQGYGVNTAALSTALFNNGFRCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYAL  118



>dbj|BAN09210.1| alpha expansin [Eustoma exaltatum subsp. russellianum]
Length=262

 Score =   177 bits (449),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 92/100 (92%), Gaps = 3/100 (3%)
 Frame = +2

Query  155  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  334
             ARIPGVYSGGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  22   EARIPGVYSGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  81

Query  335  SCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFAL  445
            SCGACFEIKC ND   R C PG+PSIF+TATNFCPPN+AL
Sbjct  82   SCGACFEIKCINDPNWRWCHPGSPSIFITATNFCPPNYAL  121



>ref|XP_010423881.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   177 bits (448),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA  +  +A+++ +   V+A+IPGVY+GG W  AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAAKVLTLMAVMVVTALTVNAKIPGVYNGGPWVNAHATFYGGADASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFA  116



>emb|CDX80810.1| BnaC03g00640D [Brassica napus]
Length=261

 Score =   177 bits (448),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 98/116 (84%), Gaps = 3/116 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            M A+ ++ +A L  +LT V+A+IPGVY+GG W  AHATFYG ADASGTMGGACGYGNLYS
Sbjct  6    MTAMAIMVVAAL--TLTTVNAKIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYS  63

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFE+KC ND   C PGNPSI +TATNFCPPNFA
Sbjct  64   QGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFA  119



>ref|XP_002283358.1| PREDICTED: expansin-A4 [Vitis vinifera]
 emb|CBI31662.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   177 bits (448),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 96/117 (82%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            M  V V+C   +   L    ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MGLVAVVCFVAMASVLKLGEARIPGVYTGGGWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFE+KC+ND   C  G+PSI +TATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPEWCHSGSPSILITATNFCPPNYAL  117



>ref|XP_006435550.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 ref|XP_006486470.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|ESR48790.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 gb|KDO69285.1| hypothetical protein CISIN_1g024916mg [Citrus sinensis]
Length=260

 Score =   176 bits (447),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  101  AAVRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
             AV ++CI   +  S  +V ARIPGVY G AWQ+AHATFYGG DASGTMGGACGYGNLYS
Sbjct  3    VAVGIICIVTFVTFSSLSVDARIPGVYGGEAWQSAHATFYGGNDASGTMGGACGYGNLYS  62

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIFVTATNFCPPNFA
Sbjct  63   QGYGVNTAALSTALFNNGLSCGACFEIKCANDPQWCHAGSPSIFVTATNFCPPNFA  118



>ref|XP_010690765.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=258

 Score =   176 bits (447),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 103/118 (87%), Gaps = 3/118 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSL-TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA++ +L I L L SL + +HAR PGVYS G WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MASI-ILPITLSLFSLFSLIHARYPGVYSRGGWQSAHATFYGGSDASGTMGGACGYGNLY  59

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGVN AALSTALFN+G SCGACFE+KC++D R C PG+PSIF+TATNFCPPN+AL
Sbjct  60   SQGYGVNTAALSTALFNSGQSCGACFELKCADDPRWCHPGSPSIFITATNFCPPNYAL  117



>gb|KJB08889.1| hypothetical protein B456_001G111100 [Gossypium raimondii]
Length=260

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +2

Query  113  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            V CI L L S   +  ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VACILLFLSSTMWMGEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  290  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            VN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  67   VNTAALSTALFNNGFSCGACFEIKCASDPQWCHSGSPSIFITATNFCPPNYAL  119



>ref|XP_010452058.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA  +  +A+++ +   V+A+IPGVY+GG W  AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAAKVLTLMAVMVATALTVNAKIPGVYNGGPWINAHATFYGGADASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFA  116



>gb|KJB78839.1| hypothetical protein B456_013G022200 [Gossypium raimondii]
Length=258

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 96/117 (82%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA     C+  LL  +  V ARIPGVYS GAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MANWVDTCLVSLLFIIVTVEARIPGVYSDGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNG SCGACFEIKC N  + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCVNQPQWCHSGSPSIFITATNFCPPNYAL  117



>gb|ABO32367.1| expansin [Litchi chinensis]
Length=256

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 99/116 (85%), Gaps = 3/116 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA   VLC  L L  LTA +A+IPGVY+GG W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAVFNVLCF-LSLLFLTA-NAKIPGVYTGGPWESAHATFYGGSDASGTMGGACGYGNLYS  58

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFE+KC  D R C PGNPSI VTATNFCPPNFA
Sbjct  59   QGYGVNTAALSTALFNNGLSCGACFELKCVADPRWCLPGNPSILVTATNFCPPNFA  114



>ref|NP_001288852.1| expansin-A3 precursor [Brassica rapa]
 gb|AGM16345.1| alpha-expansin protein 3 [Brassica rapa]
 emb|CDX91376.1| BnaC04g07740D [Brassica napus]
Length=263

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +2

Query  107  VRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  283
            +R + +A+     LT  +A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  8    IRFMWLAVTASLMLTVTNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQG  67

Query  284  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            YGVN AALSTALFNNG SCGACFE+KC++D R C PGNPSI VTATNFCPPNFA
Sbjct  68   YGVNTAALSTALFNNGFSCGACFELKCTDDPRWCVPGNPSILVTATNFCPPNFA  121



>gb|ABK93258.1| unknown [Populus trichocarpa]
Length=182

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 101/121 (83%), Gaps = 5/121 (4%)
 Frame = +2

Query  98   MAAVRVLC----IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  265
            MA   +LC    + +++  +    ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG
Sbjct  1    MAMGSLLCFTTSLLIMMSLMWKGEARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  60

Query  266  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            NLYSQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYA  120

Query  443  L  445
            L
Sbjct  121  L  121



>ref|XP_008371813.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 101/119 (85%), Gaps = 4/119 (3%)
 Frame = +2

Query  98   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  268
            MAA+  +LCI  L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  269  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            LYSQGYGVN AALSTALFN+GLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA
Sbjct  61   LYSQGYGVNTAALSTALFNSGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFA  119



>emb|CDX74942.1| BnaA05g06880D [Brassica napus]
Length=263

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +2

Query  107  VRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  283
            +R + +A+     LT  +A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  8    IRFMWLAVTASLMLTVTNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQG  67

Query  284  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            YGVN AALSTALFNNG SCGACFE+KC++D R C PGNPSI VTATNFCPPNFA
Sbjct  68   YGVNTAALSTALFNNGFSCGACFELKCTDDPRWCVPGNPSILVTATNFCPPNFA  121



>dbj|BAC67194.1| expansin [Pyrus communis]
Length=261

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 100/119 (84%), Gaps = 4/119 (3%)
 Frame = +2

Query  98   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  268
            MAA+  +LCI  L  L S   V ARIPGVY+G AWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGAAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  269  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            LYSQGYGVN AALSTALFNNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFA  119



>ref|XP_011089478.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=260

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +2

Query  113  VLCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            ++CIA L+  L     ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    IVCIASLISVLQPPAEARIPGVYTGGGWQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  290  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            VN AALSTALFNNG SCGACFEIKC+ ++  C  G+PSIFVTATNFCPPN+AL
Sbjct  67   VNTAALSTALFNNGFSCGACFEIKCAMEKQWCHAGSPSIFVTATNFCPPNYAL  119



>ref|XP_010264435.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +2

Query  152  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  331
            V ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  21   VDARIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  80

Query  332  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            LSCGACFEIKC+ND + C PG PSI +TATNFCPPNFAL
Sbjct  81   LSCGACFEIKCANDPQWCHPGGPSILITATNFCPPNFAL  119



>ref|XP_010043542.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 ref|XP_010043543.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 gb|KCW85556.1| hypothetical protein EUGRSUZ_B02355 [Eucalyptus grandis]
Length=260

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = +2

Query  113  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            V   +L+  SL  +  ARIPGVYSGG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VFAASLISFSLMWLADARIPGVYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  290  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            VN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIFVTATNFCPPNFA
Sbjct  67   VNTAALSTALFNNGLSCGACFEIKCANDPTWCHSGSPSIFVTATNFCPPNFA  118



>ref|XP_010033123.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
 gb|KCW52678.1| hypothetical protein EUGRSUZ_J02048 [Eucalyptus grandis]
Length=263

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 99/121 (82%), Gaps = 6/121 (5%)
 Frame = +2

Query  98   MAAVRVLCIALL-----LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGY  262
            MAA RV+ +AL      L +     ARIPG+Y+GG WQ+AHATFYGGADASGTMGGACGY
Sbjct  1    MAAARVMALALAFLGVALSATRMAEARIPGIYTGGPWQSAHATFYGGADASGTMGGACGY  60

Query  263  GNLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  439
            GNLYSQGYGVN AALSTALFNNG SCGACFEIKC+ND + C  G+ SIFVTATNFCPPN+
Sbjct  61   GNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSSSIFVTATNFCPPNY  120

Query  440  A  442
            A
Sbjct  121  A  121



>ref|XP_008384848.1| PREDICTED: expansin-A4 [Malus domestica]
Length=260

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 96/109 (88%), Gaps = 2/109 (2%)
 Frame = +2

Query  122  IALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNN  298
            IA L+ SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN 
Sbjct  10   IASLIISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNT  69

Query  299  AALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            AALSTALFNNGLSCGACFE+KC+ D S C  G+PSIF+TATNFCPPNFA
Sbjct  70   AALSTALFNNGLSCGACFELKCAEDPSWCHAGSPSIFITATNFCPPNFA  118



>ref|XP_006429095.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
 gb|ESR42335.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
Length=259

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 100/117 (85%), Gaps = 2/117 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA  R+LC   L  SL A  +A+IPGV++GG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MALFRMLCFFSLALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            SQGYGVN AALSTALFNNGLSCGACFE+KC  D + C+PGNP+I +TATNFCPPNFA
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFA  117



>ref|XP_006366490.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=257

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 96/111 (86%), Gaps = 1/111 (1%)
 Frame = +2

Query  116  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  295
             C+ ++L  +  V  RIPGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    FCLIIILVIIVGVEGRIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  296  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            NAALSTALFNNGLSCGACFEIKC N  + C PG+PSI +TATNFCPPN+AL
Sbjct  66   NAALSTALFNNGLSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNYAL  116



>ref|XP_002313434.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|EEE87389.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 101/121 (83%), Gaps = 5/121 (4%)
 Frame = +2

Query  98   MAAVRVLC----IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  265
            MA   +LC    + +++  +    ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG
Sbjct  1    MAMGSLLCFTTSLLIMMSLMWKGEARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  60

Query  266  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            NLYSQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYA  120

Query  443  L  445
            L
Sbjct  121  L  121



>gb|KDP44940.1| hypothetical protein JCGZ_01440 [Jatropha curcas]
Length=258

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            M     + I  LL  L    ARIPGVYSGG+W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MGLKGTISIFCLLLVLKLADARIPGVYSGGSWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYAL  117



>emb|CDY47883.1| BnaA07g14280D [Brassica napus]
Length=260

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = +2

Query  113  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            VLCI  +L   T +   RIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCILTILADFTTITEGRIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  290  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA
Sbjct  67   VNTAALSTALFNNGYSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFA  118



>ref|XP_007141864.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
 gb|ESW13858.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
Length=260

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = +2

Query  122  IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNA  301
            ++L+   L +  ARIPGVY GGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN A
Sbjct  11   VSLVTVLLASAEARIPGVYGGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTA  70

Query  302  ALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            ALSTALFN+GLSCGACFEIKC++D S C  G+PSI VTATNFCPPN+AL
Sbjct  71   ALSTALFNSGLSCGACFEIKCADDPSWCHAGSPSILVTATNFCPPNYAL  119



>ref|XP_004486999.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  113  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            ++ I  L+ SLT +  +RIPG Y+GGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  4    IVYIVSLIMSLTWLAESRIPGNYNGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  63

Query  290  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            VN AALSTALFN GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+AL
Sbjct  64   VNTAALSTALFNKGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYAL  116



>gb|KHG24991.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=260

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +2

Query  113  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            V CI L + S   +  ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VACIFLFISSTMWMGEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  290  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            VN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  67   VNTAALSTALFNNGFSCGACFEIKCASDPQWCHSGSPSIFITATNFCPPNYAL  119



>gb|ACN94264.1| expansin [Rehmannia glutinosa]
 gb|ACN94265.1| expansin [Rehmannia glutinosa]
Length=260

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 100/119 (84%), Gaps = 3/119 (3%)
 Frame = +2

Query  98   MAAVRVL-CIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            MA + V+ CIA L+  L   + ARIPG Y GGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MALLAVIACIASLISVLPPPIEARIPGNYGGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            YSQGYGVN AALSTALFNNG SCGACFEIKC+ND+  C  G+PSIFVTATNFCPPN+AL
Sbjct  61   YSQGYGVNTAALSTALFNNGFSCGACFEIKCANDKQWCHAGSPSIFVTATNFCPPNYAL  119



>ref|XP_010414459.1| PREDICTED: expansin-A6-like [Camelina sativa]
Length=257

 Score =   175 bits (443),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +2

Query  116  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  295
            L + +L   L  + ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    LVLFVLTILLATIEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  296  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
             AALSTALFNNG SCGACFE+KC++D R C  G+PSIFVTATNFCPPNFA
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFVTATNFCPPNFA  115



>ref|NP_001234761.1| expansin18 precursor [Solanum lycopersicum]
 emb|CAA06271.2| expansin18 [Solanum lycopersicum]
Length=260

 Score =   175 bits (443),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 98/113 (87%), Gaps = 4/113 (4%)
 Frame = +2

Query  116  LCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
             C+A L  L  LTA  ARIPGV++ GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  8    FCVASLFSLILLTA-EARIPGVFTAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  290  VNNAALSTALFNNGLSCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFAL  445
            VNN ALSTALFNNGLSCGACFEIKC N  + C PG+PSIF+TATNFCPPNFAL
Sbjct  67   VNNGALSTALFNNGLSCGACFEIKCDNYPQWCHPGSPSIFITATNFCPPNFAL  119



>gb|EYU26594.1| hypothetical protein MIMGU_mgv1a012061mg [Erythranthe guttata]
Length=262

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 98/118 (83%), Gaps = 3/118 (3%)
 Frame = +2

Query  101  AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  280
            AA  +L I  +LC +T   A+I GVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  4    AATLLLYIGSILCFITTARAKIFGVYAGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  281  GYGVNNAALSTALFNNGLSCGACFEIKCS---NDRSCSPGNPSIFVTATNFCPPNFAL  445
            GYGVN AALSTALFNNGLSCGACFEIKC    + +SC+PG+PSI +TATNFCPPN AL
Sbjct  64   GYGVNTAALSTALFNNGLSCGACFEIKCDAAQDSKSCNPGSPSILITATNFCPPNNAL  121



>gb|KCW65541.1| hypothetical protein EUGRSUZ_G02938 [Eucalyptus grandis]
Length=259

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 100/118 (85%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAV-RVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA+V RV+ +  L+   T   ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MASVSRVVGLVSLILFSTLAEARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGVN AALSTALFNNG SCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+AL
Sbjct  61   SQGYGVNTAALSTALFNNGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNYAL  118



>ref|XP_011077214.1| PREDICTED: expansin-A6-like [Sesamum indicum]
Length=259

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 101/118 (86%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA +   CIA LL  L + V  RIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MATMGFSCIAALLLLLLSYVECRIPGVYTGGAWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGVN AALSTALFNNG SCGACFEIKC ++ + C PG+PSIF+TATNFCPPN+AL
Sbjct  61   SQGYGVNTAALSTALFNNGFSCGACFEIKCRDEPQWCHPGSPSIFITATNFCPPNYAL  118



>gb|ABO30976.2| alpha expansin protein 1 [Calotropis procera]
Length=260

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 99/119 (83%), Gaps = 3/119 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA V + CI  +L  L   + ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAMVNLACIVSILSLLVVGIQARIPGVYSGGTWQRAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQG-YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            S   YGVN AALSTALFNNGLSCGACFEIKC+N+ + C PG+PSIF+TATNFCPPNFAL
Sbjct  61   SPNEYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHPGSPSIFITATNFCPPNFAL  119



>ref|XP_010534508.1| PREDICTED: expansin-A4 [Tarenaya hassleriana]
Length=261

 Score =   175 bits (443),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +2

Query  107  VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  286
            + V  + L +  L+   ARIPG+YSG AWQ+AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  7    ILVTALPLFVLFLSFADARIPGIYSGSAWQSAHATFYGGSDASGTMGGACGYGNLYSQGY  66

Query  287  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            GVN AALSTALFNNG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA
Sbjct  67   GVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNFA  119



>ref|XP_006294816.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
 gb|EOA27714.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
Length=262

 Score =   175 bits (443),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 96/113 (85%), Gaps = 4/113 (4%)
 Frame = +2

Query  116  LCIALLLCS---LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  286
            +C+ L + +   LTA  A+I GVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  8    ICLWLAVTASFLLTASDAKIAGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGY  67

Query  287  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            GVN AALSTALFNNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA
Sbjct  68   GVNTAALSTALFNNGYSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFA  120



>ref|NP_001150534.1| alpha-expansin 6 precursor [Zea mays]
 gb|ACG39445.1| alpha-expansin 6 precursor [Zea mays]
Length=263

 Score =   175 bits (443),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 95/115 (83%), Gaps = 8/115 (7%)
 Frame = +2

Query  125  ALLLCSLTAVH-----ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            ALLL   TA+      ARIPGVY GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    ALLLVVATAMMFSPAAARIPGVYGGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  290  VNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFAL  445
            VNNAALSTALFN GLSCGACFEIKC +    R C PG+PSI VTATNFCPPN+AL
Sbjct  67   VNNAALSTALFNQGLSCGACFEIKCEDQPGWRWCRPGSPSILVTATNFCPPNYAL  121



>ref|NP_001233958.1| expansin precursor [Solanum lycopersicum]
 gb|AAC63088.1| expansin [Solanum lycopersicum]
 gb|AAQ12264.1| expansin 1 protein [Solanum lycopersicum]
Length=261

 Score =   174 bits (442),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 95/114 (83%), Gaps = 3/114 (3%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            +L +  +      V  RIPGVYSGG+W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    ILVLLFVDSCFNIVEGRIPGVYSGGSWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  293  NNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFAL  445
            N AALSTALFNNGLSCGACFE+KC+N    + C PGNPSI +TATNFCPPN+AL
Sbjct  67   NTAALSTALFNNGLSCGACFELKCTNTPNWKWCLPGNPSILITATNFCPPNYAL  120



>ref|XP_006480833.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO51152.1| hypothetical protein CISIN_1g025025mg [Citrus sinensis]
Length=259

 Score =   174 bits (442),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 100/117 (85%), Gaps = 2/117 (2%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA  R+LC   +  SL A  +A+IPGV++GG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MALFRMLCFFSVALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            SQGYGVN AALSTALFNNGLSCGACFE+KC  D + C+PGNP+I +TATNFCPPNFA
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFA  117



>ref|XP_008784594.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=260

 Score =   174 bits (442),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  131  LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  310
            LL  LT   ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALS
Sbjct  14   LLAFLTLADARIPGVYAGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALS  73

Query  311  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            TALFN+GLSCGACFEIKC  + R C PG+PSI +TATNFCPPN+AL
Sbjct  74   TALFNDGLSCGACFEIKCGEEPRWCHPGSPSILITATNFCPPNYAL  119



>gb|KHG29956.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=258

 Score =   174 bits (442),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 96/117 (82%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA      +  L+   TAV ARIPG YSGG WQ+AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAIKGFTYLVYLIIISTAVEARIPGFYSGGEWQSAHATFYGGNDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGV+ AALSTALFNNG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   QGYGVSTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYAL  117



>emb|CDY07642.1| BnaA03g18690D [Brassica napus]
Length=258

 Score =   174 bits (442),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA  ++  +       T   A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAITKLAVLFTTFVLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYG N AALSTALFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA
Sbjct  61   QGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFA  116



>gb|EYU18981.1| hypothetical protein MIMGU_mgv1a012125mg [Erythranthe guttata]
Length=260

 Score =   174 bits (442),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 100/119 (84%), Gaps = 3/119 (3%)
 Frame = +2

Query  98   MAAVRVL-CIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            MA + V+ CIA ++  L   + ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MALLAVIACIATIVSVLPPPIEARIPGVYSGGGWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            YSQGYGVN AALSTALFNNG SCGACFEIKC+N++  C  G+PSI VTATNFCPPN+AL
Sbjct  61   YSQGYGVNTAALSTALFNNGFSCGACFEIKCANEKQWCHAGSPSILVTATNFCPPNYAL  119



>ref|XP_009613959.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   174 bits (441),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = +2

Query  152  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  331
            V ARIPGVY+GG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG
Sbjct  21   VEARIPGVYTGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  80

Query  332  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            LSCGACFEIKC N  + C  G+PSI +TATNFCPPN+AL
Sbjct  81   LSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNYAL  119



>ref|XP_006350774.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=260

 Score =   174 bits (441),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 98/112 (88%), Gaps = 4/112 (4%)
 Frame = +2

Query  119  CIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            C+A L  L  LTA  ARIPGV++ GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  9    CVASLFSLILLTA-EARIPGVFTAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  293  NNAALSTALFNNGLSCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFAL  445
            NN ALSTALFNNGLSCGACFEIKC N  + C PG+PSIF+TATNFCPPNFAL
Sbjct  68   NNGALSTALFNNGLSCGACFEIKCDNYPQWCHPGSPSIFITATNFCPPNFAL  119



>ref|XP_010490643.1| PREDICTED: expansin-A9 [Camelina sativa]
Length=258

 Score =   174 bits (441),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA  +  +A+++ +   V+A+IPGVY+GG W  AHATFYG ADASGTMGGACGYGNLYS
Sbjct  1    MAAKVLTLMAVMVVTAFTVNAKIPGVYNGGPWTNAHATFYGEADASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFA  116



>ref|XP_004145295.1| PREDICTED: expansin-A4-like [Cucumis sativus]
Length=258

 Score =   174 bits (441),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            +LCIA L+ ++    ARIPG+YSGG W++AHATFYGG+DASGTMG  CGYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTMG-RCGYGNLYSQGYGV  65

Query  293  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNFAL
Sbjct  66   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFAL  117



>ref|XP_006846223.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
 gb|ERN07898.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
Length=258

 Score =   174 bits (440),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            M+   VL +ALL   +    ARIPGVYSG  W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MSPKWVLALALLASIMVPAFARIPGVYSGSDWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            QGYGV  AALSTALFN+GLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+AL
Sbjct  61   QGYGVETAALSTALFNSGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYAL  117



>ref|XP_006411198.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
 gb|ESQ52651.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
Length=258

 Score =   174 bits (440),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 96/116 (83%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA V+++ +      L    A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAIVKLVILFTTFLFLNIADAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYG N AALSTALFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPN A
Sbjct  61   QGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLA  116



>ref|XP_008777004.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=258

 Score =   174 bits (440),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA +R++ +A +L  L+   ARI GVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAILRLVALASVLAFLSPAAARILGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            QGYGV  AALSTALFN G SCGACFEIKC++D S C  G+PSIF+TATNFCPPN+AL
Sbjct  61   QGYGVETAALSTALFNEGQSCGACFEIKCADDPSWCHRGSPSIFITATNFCPPNYAL  117



>ref|XP_002881024.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57283.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +2

Query  116  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  295
            L +++L   L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    LVLSVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  296  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
             AALSTALFNNG SCGACFE+KC++D R C  G+PSIF+TATNFCPPNFA
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFITATNFCPPNFA  115



>gb|AAK48848.1|AF350939_1 expansin [Prunus cerasus]
Length=260

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +2

Query  119  CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  295
            C+A LL S+  V  ARIPGVY+G AW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+
Sbjct  9    CLASLLISVMWVAEARIPGVYTGDAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  296  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFA  118



>ref|XP_010067412.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
Length=307

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 100/118 (85%), Gaps = 2/118 (2%)
 Frame = +2

Query  98   MAAV-RVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            MA+V RV+ +  L+   T   ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  49   MASVSRVVGLVSLILFSTLAEARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLY  108

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            SQGYGVN AALSTALFNNG SCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+AL
Sbjct  109  SQGYGVNTAALSTALFNNGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNYAL  166



>gb|KHN30166.1| Expansin-A4 [Glycine soja]
Length=292

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 4/110 (4%)
 Frame = +2

Query  128  LLLCSLT---AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNN  298
            +LLC ++    V ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN 
Sbjct  7    VLLCLMSLMWMVDARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNT  66

Query  299  AALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCP N+AL
Sbjct  67   AALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPSNYAL  116



>ref|XP_010558331.1| PREDICTED: expansin-A9 [Tarenaya hassleriana]
Length=268

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 95/117 (81%), Gaps = 3/117 (3%)
 Frame = +2

Query  95   KMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  274
            K+ AV     A  L +   V A+IPGVYSGG W  AHATFYGGADASGTMGGACGYGNLY
Sbjct  11   KLVAVVPAVTASFLAA--EVDAKIPGVYSGGPWIDAHATFYGGADASGTMGGACGYGNLY  68

Query  275  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            SQGYGVN AALSTALFNNGLSCGACFE+KC +D R C PGNPSI +TATNFCPPNFA
Sbjct  69   SQGYGVNTAALSTALFNNGLSCGACFELKCIDDPRWCLPGNPSILITATNFCPPNFA  125



>ref|XP_009122794.1| PREDICTED: expansin-A9 [Brassica rapa]
 emb|CDY40344.1| BnaA10g27240D [Brassica napus]
Length=258

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 94/116 (81%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA  +  + +     T V+ARIPGVY+GG W  AHATFYG ADASGTMGGACGYGNLYS
Sbjct  1    MAAKIMTLMVVAALVATTVNARIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFE+KC ND   C PGNPSI +TATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFA  116



>ref|XP_009409516.1| PREDICTED: expansin-A6-like [Musa acuminata subsp. malaccensis]
Length=261

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = +2

Query  116  LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            + +AL+L S   +  ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  9    VTVALVLASSALLADARIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGV  68

Query  293  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
              AALSTAL+N+GL CGACFEIKC++D R C  GNPSIF+TATNFCPPN+AL
Sbjct  69   ETAALSTALYNDGLRCGACFEIKCADDPRWCKGGNPSIFITATNFCPPNYAL  120



>emb|CDY10456.1| BnaCnng03570D [Brassica napus]
Length=258

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 94/116 (81%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA  +  + +     T V+ARIPGVY+GG W  AHATFYG ADASGTMGGACGYGNLYS
Sbjct  1    MAAKIMTLMVVAALVATTVNARIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            QGYGVN AALSTALFNNGLSCGACFE+KC ND   C PGNPSI +TATNFCPPNFA
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFA  116



>emb|CAA04385.1| Expansin [Brassica napus]
Length=260

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = +2

Query  113  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMG ACGYGNLY++GYG
Sbjct  7    VLCLLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGSACGYGNLYTKGYG  66

Query  290  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFA  118



>emb|CDP00110.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            + CI  L   LT   ARIPGVY+G +W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  3    LTCIIALSLLLTPTEARIPGVYTGDSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  62

Query  293  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            N AALSTALFNNG SCG+CFE+KC++D + C PG+PSI +TATNFCPPN+AL
Sbjct  63   NTAALSTALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNYAL  114



>ref|XP_010510558.1| PREDICTED: expansin-A6 [Camelina sativa]
 ref|XP_010470018.1| PREDICTED: expansin-A6 [Camelina sativa]
Length=256

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 93/108 (86%), Gaps = 1/108 (1%)
 Frame = +2

Query  122  IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNA  301
            +  +L  L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN A
Sbjct  7    VLFVLTILATSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTA  66

Query  302  ALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            ALSTALFNNG SCGACFE+KC++D R C  G+PSIFVTATNFCPPNFA
Sbjct  67   ALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFVTATNFCPPNFA  114



>ref|XP_002266625.1| PREDICTED: expansin-A6 [Vitis vinifera]
 emb|CAN65872.1| hypothetical protein VITISV_000251 [Vitis vinifera]
 emb|CBI30547.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +2

Query  152  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  331
            VHARIPGVY+ G W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+G
Sbjct  19   VHARIPGVYTSGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSG  78

Query  332  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            LSCGACFEIKC+ND + C  G+PSIFVTATNFCPPN+AL
Sbjct  79   LSCGACFEIKCANDPKWCHSGSPSIFVTATNFCPPNYAL  117



>gb|KFK32246.1| hypothetical protein AALP_AA6G217100 [Arabis alpina]
Length=257

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 96/111 (86%), Gaps = 3/111 (3%)
 Frame = +2

Query  113  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  292
            VL +  +L  LT   ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VLLVLTILADLT--EARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  64

Query  293  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            N AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA
Sbjct  65   NTAALSTALFNNGYSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFA  115



>ref|NP_001288961.1| expansin-A4 precursor [Brassica rapa]
 gb|AGM16346.1| alpha-expansin protein 4 [Brassica rapa]
Length=258

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 99/118 (84%), Gaps = 5/118 (4%)
 Frame = +2

Query  98   MAAVR--VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            MA ++  +L  A LL +L    ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAVIKLAILFTAYLLFNL--ADARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNL  58

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            YSQGYG N AALSTALFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA
Sbjct  59   YSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFA  116



>ref|XP_009124371.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A6 [Brassica rapa]
Length=260

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = +2

Query  113  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  289
            VLCI  +L   T +   RIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCILTILADFTTITEGRIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  290  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            VN AALSTALFNNG SCGACFE+ C++D + C  G+PSIFVTATNFCPPNFA
Sbjct  67   VNTAALSTALFNNGYSCGACFELXCASDPKWCHSGSPSIFVTATNFCPPNFA  118



>gb|AAM62987.1| expansin AtEx6 [Arabidopsis thaliana]
Length=257

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +2

Query  116  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  295
            L +++L   L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    LVLSVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  296  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
             AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFA  115



>gb|AFW67136.1| hypothetical protein ZEAMMB73_591538 [Zea mays]
Length=162

 Score =   169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 88/99 (89%), Gaps = 3/99 (3%)
 Frame = +2

Query  158  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  337
            ARIPGVY GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFN GLS
Sbjct  25   ARIPGVYGGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNQGLS  84

Query  338  CGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFAL  445
            CGACFEIKC +    R C PG+PSI VTATNFCPPN+AL
Sbjct  85   CGACFEIKCEDQPGWRWCRPGSPSILVTATNFCPPNYAL  123



>ref|XP_009380637.1| PREDICTED: expansin-A4 [Musa acuminata subsp. malaccensis]
Length=262

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 96/116 (83%), Gaps = 1/116 (1%)
 Frame = +2

Query  101  AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  280
            +AV      +L  S     ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  6    SAVAATVALVLASSALLADARIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQ  65

Query  281  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  445
            GYGV  AALSTALFN+GLSCGACFEIKC++D R C  G+PSIF+TATNFCPPN+AL
Sbjct  66   GYGVETAALSTALFNDGLSCGACFEIKCADDPRWCKGGSPSIFITATNFCPPNYAL  121



>gb|ACO52788.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52789.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52790.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52797.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52798.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52799.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52800.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52801.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52802.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52803.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52805.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52809.1| EXP6, partial [Brachypodium distachyon]
Length=150

 Score =   169 bits (428),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 91/109 (83%), Gaps = 3/109 (3%)
 Frame = +2

Query  128  LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAAL  307
            LLL    A  ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAAL
Sbjct  3    LLLLLPHAAEARIPGVYTGGDWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAAL  62

Query  308  STALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFAL  445
            STALFN G  CGACFEIKC N    + C PG+PSI VTATNFCPPN+AL
Sbjct  63   STALFNGGQRCGACFEIKCVNQPDWKWCHPGSPSILVTATNFCPPNYAL  111



>ref|NP_180461.1| expansin A6 [Arabidopsis thaliana]
 sp|Q38865.2|EXPA6_ARATH RecName: Full=Expansin-A6; Short=AtEXPA6; AltName: Full=Alpha-expansin-6; 
Short=At-EXP6; Short=AtEx6; AltName: Full=Ath-ExpAlpha-1.8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC33223.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAL25606.1| At2g28950/F8N16.24 [Arabidopsis thaliana]
 gb|AAB38072.2| expansin At-EXPA6 [Arabidopsis thaliana]
 gb|AAL62401.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAM15074.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAO30068.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AEC08194.1| expansin A6 [Arabidopsis thaliana]
Length=257

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +2

Query  116  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  295
            L +++L   L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    LVLSVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  296  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
             AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFA  115



>gb|ACO52804.1| EXP6, partial [Brachypodium distachyon]
Length=149

 Score =   169 bits (427),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 91/109 (83%), Gaps = 3/109 (3%)
 Frame = +2

Query  128  LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAAL  307
            LLL    A  ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAAL
Sbjct  3    LLLLLPHAAEARIPGVYTGGDWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAAL  62

Query  308  STALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFAL  445
            STALFN G  CGACFEIKC N    + C PG+PSI VTATNFCPPN+AL
Sbjct  63   STALFNGGQRCGACFEIKCVNQPDWKWCHPGSPSILVTATNFCPPNYAL  111



>ref|XP_002870966.1| ATEXPA9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47225.1| ATEXPA9 [Arabidopsis lyrata subsp. lyrata]
Length=258

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MAA  +  +A+++ +   V+A+IPGVY+GG W  AHATFYG ADASGTMGGACGYGNLYS
Sbjct  1    MAARVITLMAVMVVTAFTVNAKIPGVYTGGPWINAHATFYGEADASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  439
            QGYGVN AALSTALFNNGLSCG+C+E+KC ND   C PGNPSI VTATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCYELKCVNDPGWCLPGNPSILVTATNFCPPNF  115



>ref|XP_010532011.1| PREDICTED: expansin-A4-like [Tarenaya hassleriana]
Length=261

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 96/114 (84%), Gaps = 3/114 (3%)
 Frame = +2

Query  110  RVL--CIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  283
            R+L   + L +   +   ARIPGVYSGGAWQ+AHATFYGG DASGTMGGACGYGNLYSQG
Sbjct  6    RILLNTLPLFVLFFSFADARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGNLYSQG  65

Query  284  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            YGVN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPNFA
Sbjct  66   YGVNTAALSTALFNNGFSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNFA  119



>ref|XP_010557251.1| PREDICTED: expansin-A6-like [Tarenaya hassleriana]
Length=259

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 97/114 (85%), Gaps = 3/114 (3%)
 Frame = +2

Query  107  VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  286
            V VL + + L S++   ARIPGVY GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  7    VFVLTVLVGLTSMS--EARIPGVYRGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGY  64

Query  287  GVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
            GV+ AALSTALFNNG  CGACFEIKC+ND + C  G+PSIF+TATNFCPPNFAL
Sbjct  65   GVSTAALSTALFNNGYRCGACFEIKCANDPTWCHSGSPSIFITATNFCPPNFAL  118



>emb|CDY69611.1| BnaCnng64440D [Brassica napus]
Length=258

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 99/118 (84%), Gaps = 5/118 (4%)
 Frame = +2

Query  98   MAAVR--VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  271
            MA ++  +L  A LL +L    ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAIIKLAILFTAYLLFNL--ADARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNL  58

Query  272  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            YSQGYG N AALSTALFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA
Sbjct  59   YSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFA  116



>ref|XP_006398690.1| hypothetical protein EUTSA_v10014430mg [Eutrema salsugineum]
 gb|ESQ40143.1| hypothetical protein EUTSA_v10014430mg [Eutrema salsugineum]
Length=261

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 97/119 (82%), Gaps = 4/119 (3%)
 Frame = +2

Query  98   MAAVRVLCIALLLC---SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  268
            MAA  +  +A+++    + T V A+IPGVY+GG W  AHATFYG ADASGTMGGACGYGN
Sbjct  1    MAAKVITVMAVMVVAALTATTVSAKIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGN  60

Query  269  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  442
            LYSQGYGVN AALSTALFNNG+SCGACFE+KC ND   C PGNPSI +TATNFCPPNFA
Sbjct  61   LYSQGYGVNTAALSTALFNNGVSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNFA  119



>emb|CDY07024.1| BnaA04g22910D [Brassica napus]
Length=258

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA  ++  +       T   A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAITKLAVLFTTFVLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYG N AALSTALFN+G+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA
Sbjct  61   QGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFA  116



>ref|XP_009141827.1| PREDICTED: expansin-A4-like [Brassica rapa]
Length=258

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = +2

Query  98   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  277
            MA  ++  +       T   A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAITKLAVLFTTFVLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  278  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  442
            QGYG N AALSTALFN+G+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA
Sbjct  61   QGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFA  116



>gb|ACO57092.1| EXP6 [Brachypodium phoenicoides]
Length=147

 Score =   169 bits (427),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 91/109 (83%), Gaps = 3/109 (3%)
 Frame = +2

Query  128  LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAAL  307
            LLL    A  ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAAL
Sbjct  3    LLLLLPHAAEARIPGVYTGGDWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAAL  62

Query  308  STALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFAL  445
            STALFN G  CGACFEIKC N    + C PG+PSI VTATNFCPPN+AL
Sbjct  63   STALFNGGQRCGACFEIKCVNQPDWKWCHPGSPSILVTATNFCPPNYAL  111



>gb|AAP48989.1| expansin [Sambucus nigra]
Length=256

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 96/111 (86%), Gaps = 2/111 (2%)
 Frame = +2

Query  119  CIALLLCSL-TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  295
            CIA L+ SL + V ARIPG Y GGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  5    CIASLVISLFSVVEARIPGNYGGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  64

Query  296  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFAL  445
             AALSTALFN G SCGACFEIKC+ND + C  G+PSI VTATNFCPPN+AL
Sbjct  65   TAALSTALFNKGESCGACFEIKCANDPNWCHSGSPSIMVTATNFCPPNYAL  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555551523900