BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF023A11

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP03931.1|  unnamed protein product                                164   2e-45   Coffea canephora [robusta coffee]
ref|XP_009777271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    165   2e-45   Nicotiana sylvestris
ref|XP_011089044.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    165   3e-45   Sesamum indicum [beniseed]
ref|XP_006366999.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    162   4e-44   Solanum tuberosum [potatoes]
ref|XP_009610543.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    159   4e-43   Nicotiana tomentosiformis
ref|XP_004247041.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    159   5e-43   Solanum lycopersicum
ref|XP_008244679.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    153   1e-40   Prunus mume [ume]
gb|EYU39188.1|  hypothetical protein MIMGU_mgv1a006049mg                151   4e-40   Erythranthe guttata [common monkey flower]
gb|EPS58986.1|  hypothetical protein M569_15824                         150   1e-39   Genlisea aurea
ref|XP_004144397.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    149   3e-39   Cucumis sativus [cucumbers]
ref|XP_008382581.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    149   3e-39   
ref|XP_008356234.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    149   5e-39   
ref|XP_002303070.2|  3-glucanase family protein                         148   6e-39   
ref|XP_011024596.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    148   7e-39   Populus euphratica
dbj|BAA89481.1|  beta-1,3-glucanase                                     148   9e-39   Salix gilgiana
ref|XP_009372203.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    147   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_011024595.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    147   1e-38   Populus euphratica
ref|XP_004290162.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    147   2e-38   Fragaria vesca subsp. vesca
ref|XP_006386885.1|  3-glucanase family protein                         146   3e-38   Populus trichocarpa [western balsam poplar]
gb|KDO46598.1|  hypothetical protein CISIN_1g038099mg                   141   4e-38   Citrus sinensis [apfelsine]
ref|XP_008460404.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    145   1e-37   Cucumis melo [Oriental melon]
gb|KEH22559.1|  glucan endo-1,3-beta-glucosidase-like protein           142   1e-36   Medicago truncatula
ref|XP_004492271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    141   2e-36   Cicer arietinum [garbanzo]
ref|XP_007049651.1|  O-Glycosyl hydrolases family 17 protein isof...    140   3e-36   
ref|XP_010036769.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    140   7e-36   Eucalyptus grandis [rose gum]
gb|KHG25787.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    139   9e-36   Gossypium arboreum [tree cotton]
gb|KDP45279.1|  hypothetical protein JCGZ_15144                         139   1e-35   Jatropha curcas
gb|KJB10879.1|  hypothetical protein B456_001G230200                    138   2e-35   Gossypium raimondii
gb|KJB10878.1|  hypothetical protein B456_001G230200                    138   2e-35   Gossypium raimondii
ref|XP_010100789.1|  putative glucan endo-1,3-beta-glucosidase A6       138   3e-35   Morus notabilis
ref|XP_003626949.1|  Beta-1 3-glucanase                                 137   5e-35   Medicago truncatula
ref|XP_006297636.1|  hypothetical protein CARUB_v10013655mg             134   1e-33   Capsella rubella
ref|XP_002884642.1|  glycosyl hydrolase family 17 protein               134   1e-33   Arabidopsis lyrata subsp. lyrata
ref|NP_683538.1|  O-Glycosyl hydrolases family 17 protein               131   6e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AAF20214.1|AC012395_1  putative beta-1,3-glucanase precursor         131   6e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464351.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    131   8e-33   Camelina sativa [gold-of-pleasure]
gb|KFK38190.1|  hypothetical protein AALP_AA3G081000                    131   1e-32   Arabis alpina [alpine rockcress]
ref|XP_010486278.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    130   1e-32   Camelina sativa [gold-of-pleasure]
gb|KHN10950.1|  Putative glucan endo-1,3-beta-glucosidase A6            130   2e-32   Glycine soja [wild soybean]
ref|XP_004510238.1|  PREDICTED: putative copper-transporting ATPa...    133   3e-32   
gb|KHG02504.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    129   4e-32   Gossypium arboreum [tree cotton]
gb|AAM65039.1|  putative glucan endo-1-3-beta-glucosidase               129   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003530849.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    129   5e-32   Glycine max [soybeans]
emb|CDY28063.1|  BnaC05g44650D                                          129   6e-32   Brassica napus [oilseed rape]
emb|CDY45466.1|  BnaC09g12840D                                          129   6e-32   Brassica napus [oilseed rape]
ref|XP_010451138.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    129   6e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006407848.1|  hypothetical protein EUTSA_v10020660mg             129   7e-32   Eutrema salsugineum [saltwater cress]
ref|XP_006407849.1|  hypothetical protein EUTSA_v10020660mg             129   7e-32   
ref|XP_007140788.1|  hypothetical protein PHAVU_008G142200g             128   1e-31   Phaseolus vulgaris [French bean]
ref|XP_006484802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    128   1e-31   Citrus sinensis [apfelsine]
ref|XP_006437250.1|  hypothetical protein CICLE_v10031440mg             128   1e-31   Citrus clementina [clementine]
gb|KJB84083.1|  hypothetical protein B456_N004800                       127   2e-31   Gossypium raimondii
ref|XP_003632052.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    126   4e-31   Vitis vinifera
emb|CDO96794.1|  unnamed protein product                                126   6e-31   Coffea canephora [robusta coffee]
ref|XP_009147086.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    125   1e-30   Brassica rapa
emb|CDY24629.1|  BnaA05g30280D                                          125   1e-30   Brassica napus [oilseed rape]
ref|XP_010246533.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    124   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010247391.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    123   7e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010547131.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    122   2e-29   Tarenaya hassleriana [spider flower]
emb|CDY08004.1|  BnaC03g35190D                                          121   3e-29   Brassica napus [oilseed rape]
ref|XP_010552026.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    120   6e-29   Tarenaya hassleriana [spider flower]
ref|XP_010685101.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    119   9e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003552101.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    119   1e-28   Glycine max [soybeans]
emb|CDX74052.1|  BnaA03g29950D                                          119   2e-28   
gb|ADE76604.1|  unknown                                                 119   2e-28   Picea sitchensis
ref|XP_009134961.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    118   2e-28   Brassica rapa
ref|XP_002976500.1|  hypothetical protein SELMODRAFT_105435             117   5e-28   
emb|CDP15106.1|  unnamed protein product                                117   8e-28   Coffea canephora [robusta coffee]
ref|XP_003541516.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    116   1e-27   Glycine max [soybeans]
ref|XP_002973407.1|  hypothetical protein SELMODRAFT_413735             117   1e-27   
ref|XP_002462618.1|  hypothetical protein SORBIDRAFT_02g029080          117   1e-27   Sorghum bicolor [broomcorn]
ref|XP_004505110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    116   2e-27   
ref|XP_009373620.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    113   2e-27   
ref|XP_003632055.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    115   3e-27   Vitis vinifera
emb|CAN60692.1|  hypothetical protein VITISV_007558                     115   4e-27   Vitis vinifera
ref|XP_007134154.1|  hypothetical protein PHAVU_010G0238000g            109   4e-27   Phaseolus vulgaris [French bean]
ref|XP_006830555.1|  hypothetical protein AMTR_s00117p00104410          114   8e-27   
ref|XP_006349905.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    114   8e-27   Solanum tuberosum [potatoes]
ref|XP_010314851.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    114   9e-27   
ref|XP_008380636.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    109   3e-26   
ref|XP_009385472.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    112   3e-26   
ref|XP_004298215.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    111   5e-26   Fragaria vesca subsp. vesca
ref|XP_008222761.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    111   9e-26   
gb|KHN47213.1|  Putative glucan endo-1,3-beta-glucosidase A6            110   1e-25   Glycine soja [wild soybean]
ref|XP_009411847.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    111   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006830552.1|  hypothetical protein AMTR_s00117p00097230          111   1e-25   
ref|XP_009625838.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    111   1e-25   Nicotiana tomentosiformis
ref|XP_009411846.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    111   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009625839.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    110   1e-25   Nicotiana tomentosiformis
ref|XP_007153895.1|  hypothetical protein PHAVU_003G073900g             110   2e-25   Phaseolus vulgaris [French bean]
ref|XP_010488453.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    110   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_004957267.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    110   3e-25   Setaria italica
ref|XP_006299757.1|  hypothetical protein CARUB_v10015952mg             110   3e-25   Capsella rubella
ref|XP_010466734.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    110   4e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010023613.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    109   4e-25   
ref|XP_007221306.1|  hypothetical protein PRUPE_ppa016789mg             109   4e-25   
ref|XP_009383833.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    109   5e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383834.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    109   5e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC84834.1|  hypothetical protein OsI_31928                          109   5e-25   Oryza sativa Indica Group [Indian rice]
gb|KCW48409.1|  hypothetical protein EUGRSUZ_K02112                     108   6e-25   Eucalyptus grandis [rose gum]
gb|KEH30957.1|  glucan endo-1,3-beta-glucosidase-like protein           108   7e-25   Medicago truncatula
ref|XP_009777293.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    108   7e-25   Nicotiana sylvestris
ref|XP_008792940.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    108   8e-25   
ref|XP_008792939.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    108   8e-25   Phoenix dactylifera
ref|NP_001149815.1|  glucan endo-1,3-beta-glucosidase A6 precursor      108   1e-24   Zea mays [maize]
ref|NP_001063586.1|  Os09g0502200                                       108   1e-24   
ref|XP_002520622.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    108   2e-24   
ref|XP_006661404.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    108   2e-24   
dbj|BAJ88052.1|  predicted protein                                      108   2e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002883459.1|  hypothetical protein ARALYDRAFT_479892             107   3e-24   
ref|XP_010238330.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    107   4e-24   Brachypodium distachyon [annual false brome]
ref|XP_010512882.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    107   4e-24   Camelina sativa [gold-of-pleasure]
gb|KDP32593.1|  hypothetical protein JCGZ_13143                         107   5e-24   Jatropha curcas
ref|XP_011101604.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    106   6e-24   
ref|NP_189019.1|  O-glycosyl hydrolases family 17 protein               106   6e-24   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28569.1|  unknown                                                 106   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010264204.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    102   6e-24   Nelumbo nucifera [Indian lotus]
ref|XP_006418839.1|  hypothetical protein EUTSA_v10002513mg             105   1e-23   Eutrema salsugineum [saltwater cress]
gb|KFK39673.1|  a6 anther-specific protein                              105   1e-23   Arabis alpina [alpine rockcress]
ref|XP_002444717.1|  hypothetical protein SORBIDRAFT_07g026540          106   1e-23   Sorghum bicolor [broomcorn]
dbj|BAK04571.1|  predicted protein                                      106   1e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU31523.1|  hypothetical protein MIMGU_mgv1a005774mg                105   1e-23   Erythranthe guttata [common monkey flower]
ref|XP_008439043.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    101   1e-23   Cucumis melo [Oriental melon]
gb|EYU31522.1|  hypothetical protein MIMGU_mgv1a005774mg                105   2e-23   Erythranthe guttata [common monkey flower]
gb|AAM64490.1|  beta-1,3-glucanase, putative                            105   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007199923.1|  hypothetical protein PRUPE_ppa006984mg             104   2e-23   
ref|XP_009135862.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    104   4e-23   Brassica rapa
emb|CDY53213.1|  BnaC03g74070D                                          103   5e-23   Brassica napus [oilseed rape]
gb|KJB28087.1|  hypothetical protein B456_005G026800                  99.8    5e-23   Gossypium raimondii
ref|XP_010532729.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    103   5e-23   Tarenaya hassleriana [spider flower]
gb|KJB10880.1|  hypothetical protein B456_001G230200                    102   7e-23   Gossypium raimondii
ref|XP_002971665.1|  hypothetical protein SELMODRAFT_231791             103   7e-23   
ref|XP_006373100.1|  hypothetical protein POPTR_0017s08720g             103   8e-23   Populus trichocarpa [western balsam poplar]
gb|KGN57233.1|  hypothetical protein Csa_3G172380                     96.3    1e-22   
emb|CDY63754.1|  BnaAnng19080D                                          102   1e-22   Brassica napus [oilseed rape]
ref|XP_004147671.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  96.3    1e-22   
emb|CDY59775.1|  BnaCnng35540D                                          102   2e-22   Brassica napus [oilseed rape]
ref|XP_009102583.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    102   2e-22   Brassica rapa
ref|XP_009106344.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    101   2e-22   Brassica rapa
emb|CDY50110.1|  BnaC01g43580D                                          100   2e-22   Brassica napus [oilseed rape]
ref|XP_003572424.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    100   2e-22   Brachypodium distachyon [annual false brome]
ref|XP_006421038.1|  hypothetical protein CICLE_v10004917mg             102   3e-22   
gb|KEH22560.1|  glucan endo-1,3-beta-glucosidase-like protein           100   3e-22   Medicago truncatula
emb|CAB71021.1|  putative beta-1,3-glucanase                          95.5    4e-22   Hieracium piloselloides
gb|KFK36299.1|  hypothetical protein AALP_AA4G104300                    101   4e-22   Arabis alpina [alpine rockcress]
emb|CDY18092.1|  BnaA01g23530D                                          100   4e-22   Brassica napus [oilseed rape]
gb|AEN82021.1|  AT3G23770-like protein                                97.4    5e-22   Capsella rubella
ref|NP_193144.1|  putative glucan endo-1,3-beta-glucosidase A6          100   7e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KDO47456.1|  hypothetical protein CISIN_1g012660mg                   100   9e-22   Citrus sinensis [apfelsine]
ref|XP_002534357.1|  Glucan endo-1,3-beta-glucosidase precursor, ...  99.8    9e-22   Ricinus communis
ref|XP_011045808.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    100   1e-21   Populus euphratica
gb|AEN82027.1|  AT3G23770-like protein                                96.7    1e-21   Capsella rubella
ref|XP_002965673.1|  hypothetical protein SELMODRAFT_85067            99.8    2e-21   
ref|XP_010450129.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  97.8    2e-21   
ref|XP_002868315.1|  hypothetical protein ARALYDRAFT_493503           99.4    3e-21   
ref|XP_002980798.1|  hypothetical protein SELMODRAFT_444643           99.0    4e-21   Selaginella moellendorffii
gb|AEN82025.1|  AT3G23770-like protein                                94.7    5e-21   Capsella rubella
gb|AEN82023.1|  AT3G23770-like protein                                94.7    6e-21   Capsella rubella
ref|XP_006282877.1|  hypothetical protein CARUB_v10006945mg           98.6    6e-21   Capsella rubella
gb|EEC76520.1|  hypothetical protein OsI_14306                        94.7    7e-21   Oryza sativa Indica Group [Indian rice]
gb|ADG38502.1|  AT3G23770-like protein                                94.4    9e-21   Capsella grandiflora
ref|XP_010450110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  98.2    9e-21   Camelina sativa [gold-of-pleasure]
gb|ADG38498.1|  AT3G23770-like protein                                94.0    1e-20   Capsella grandiflora
ref|XP_002298669.2|  glucan endo-1 family protein                     97.1    1e-20   
gb|ADG38497.1|  AT3G23770-like protein                                94.0    1e-20   Capsella grandiflora
gb|AAZ40342.1|  beta-1,3-glucanase 2                                  97.1    1e-20   Ziziphus jujuba [Chinese jujube]
ref|XP_011010072.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  97.4    1e-20   Populus euphratica
gb|ADG38503.1|  AT3G23770-like protein                                93.6    2e-20   Neslia paniculata [ball mustard]
dbj|BAG16366.1|  tapetum-specific protein A6 family protein           96.3    2e-20   Brassica rapa var. perviridis [kabuna]
ref|XP_009144683.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  96.3    2e-20   Brassica rapa
gb|KDP39185.1|  hypothetical protein JCGZ_00942                       93.2    2e-20   Jatropha curcas
ref|XP_007020717.1|  O-Glycosyl hydrolases family 17 protein          97.1    2e-20   
ref|XP_002529472.1|  Glucan endo-1,3-beta-glucosidase precursor, ...  90.9    3e-20   Ricinus communis
ref|XP_006414816.1|  hypothetical protein EUTSA_v10025081mg           96.7    3e-20   Eutrema salsugineum [saltwater cress]
ref|XP_002961854.1|  hypothetical protein SELMODRAFT_437767           96.7    3e-20   Selaginella moellendorffii
ref|XP_007034194.1|  O-Glycosyl hydrolases family 17 protein          93.2    3e-20   
emb|CDY08310.1|  BnaA05g13090D                                        96.3    3e-20   Brassica napus [oilseed rape]
gb|ADG38499.1|  AT3G23770-like protein                                92.8    4e-20   Capsella grandiflora
ref|XP_004251911.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.4    5e-20   Solanum lycopersicum
ref|XP_010435194.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  95.9    5e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010527440.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  95.9    5e-20   Tarenaya hassleriana [spider flower]
ref|NP_001051879.1|  Os03g0845600                                     95.1    1e-19   
ref|XP_010026682.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...  93.6    1e-19   
gb|AFU52656.1|  beta-1,3-glucanase 23                                 90.9    2e-19   Solanum tuberosum [potatoes]
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  93.6    2e-19   
emb|CDY01191.1|  BnaA04g06280D                                        94.4    2e-19   
ref|XP_009139564.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  94.4    2e-19   Brassica rapa
gb|ABR16205.1|  unknown                                               94.4    2e-19   Picea sitchensis
gb|ADU15553.1|  GLU                                                   92.8    2e-19   Gossypium hirsutum [American cotton]
gb|KHG04965.1|  hypothetical protein F383_30444                       92.4    2e-19   Gossypium arboreum [tree cotton]
ref|XP_006344866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.0    2e-19   Solanum tuberosum [potatoes]
gb|KJB62900.1|  hypothetical protein B456_009G442700                  92.0    3e-19   Gossypium raimondii
ref|XP_010539314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   92.0    3e-19   Tarenaya hassleriana [spider flower]
gb|KDO62115.1|  hypothetical protein CISIN_1g0115512mg                92.8    3e-19   Citrus sinensis [apfelsine]
gb|KDO62116.1|  hypothetical protein CISIN_1g0115512mg                92.8    3e-19   Citrus sinensis [apfelsine]
gb|KDO62114.1|  hypothetical protein CISIN_1g0115512mg                92.4    4e-19   Citrus sinensis [apfelsine]
ref|XP_003581305.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  93.6    4e-19   Brachypodium distachyon [annual false brome]
ref|XP_002964439.1|  hypothetical protein SELMODRAFT_230318           90.9    4e-19   
ref|XP_008382595.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  89.0    4e-19   Malus domestica [apple tree]
ref|XP_006344865.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  91.3    5e-19   Solanum tuberosum [potatoes]
emb|CDY12371.1|  BnaC08g08340D                                        93.2    5e-19   Brassica napus [oilseed rape]
emb|CDY12732.1|  BnaC04g29090D                                        93.2    6e-19   Brassica napus [oilseed rape]
emb|CDY27122.1|  BnaA08g07600D                                        93.2    6e-19   Brassica napus [oilseed rape]
ref|XP_009108090.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  92.8    6e-19   Brassica rapa
gb|KEH18116.1|  O-glycosyl hydrolase family 17 protein                91.7    7e-19   Medicago truncatula
ref|XP_006452449.1|  hypothetical protein CICLE_v10008176mg           92.0    7e-19   Citrus clementina [clementine]
ref|XP_006475009.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.0    7e-19   Citrus sinensis [apfelsine]
dbj|BAG16359.1|  tapetum-specific protein A6 family protein           92.0    7e-19   Brassica oleracea var. italica [asparagus broccoli]
ref|XP_002975355.1|  hypothetical protein SELMODRAFT_103308           91.3    7e-19   Selaginella moellendorffii
ref|XP_009771280.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.6    8e-19   Nicotiana sylvestris
emb|CDY06469.1|  BnaC06g11750D                                        92.4    1e-18   
emb|CAA49513.1|  beta-1,3-glucanase homologue                         92.4    1e-18   Brassica napus [oilseed rape]
gb|EEC76519.1|  hypothetical protein OsI_14305                        92.0    1e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_002316783.2|  glycosyl hydrolase family 17 family protein      91.3    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_010545233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   89.7    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_009347789.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  85.5    2e-18   Pyrus x bretschneideri [bai li]
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                   90.1    2e-18   Glycine soja [wild soybean]
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.1    2e-18   Glycine max [soybeans]
ref|XP_004497650.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.2    2e-18   Cicer arietinum [garbanzo]
dbj|BAC53928.1|  beta-1,3-glucanase-like protein                      90.1    2e-18   Nicotiana tabacum [American tobacco]
ref|XP_007204831.1|  hypothetical protein PRUPE_ppa1027206mg          87.0    2e-18   Prunus persica
ref|XP_009347788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  85.1    2e-18   Pyrus x bretschneideri [bai li]
gb|KEH41871.1|  O-glycosyl hydrolase family 17 protein                88.6    2e-18   Medicago truncatula
ref|XP_006853717.1|  hypothetical protein AMTR_s00056p00158530        85.5    3e-18   
ref|XP_008382596.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  86.7    3e-18   Malus domestica [apple tree]
ref|XP_009794437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.5    3e-18   Nicotiana sylvestris
ref|XP_010512954.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  92.0    3e-18   
ref|XP_008230022.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   89.4    3e-18   
ref|XP_011044921.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    3e-18   Populus euphratica
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg           90.5    4e-18   
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.5    4e-18   
ref|XP_010433433.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.1    5e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008364550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   90.5    5e-18   
dbj|BAB17320.1|  elicitor inducible beta-1,3-glucanase NtEIG-E76      88.6    5e-18   Nicotiana tabacum [American tobacco]
ref|XP_010412950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  90.9    5e-18   
ref|XP_009595038.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.6    5e-18   Nicotiana tomentosiformis
ref|XP_009334153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.1    6e-18   Pyrus x bretschneideri [bai li]
ref|XP_009348307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.1    6e-18   Pyrus x bretschneideri [bai li]
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.6    7e-18   Fragaria vesca subsp. vesca
ref|XP_006295997.1|  hypothetical protein CARUB_v10025141mg           90.5    7e-18   Capsella rubella
ref|XP_006413135.1|  hypothetical protein EUTSA_v10026799mg           89.7    7e-18   Eutrema salsugineum [saltwater cress]
gb|EPS69142.1|  hypothetical protein M569_05624                       88.6    7e-18   Genlisea aurea
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   84.0    8e-18   Tarenaya hassleriana [spider flower]
ref|XP_002274828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   89.7    8e-18   Vitis vinifera
ref|XP_007215327.1|  hypothetical protein PRUPE_ppa005206mg           89.7    8e-18   
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.4    9e-18   Cucumis sativus [cucumbers]
ref|XP_004161885.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...  89.4    9e-18   
emb|CDY20461.1|  BnaC04g05830D                                        89.4    9e-18   Brassica napus [oilseed rape]
gb|KDP30806.1|  hypothetical protein JCGZ_13749                       89.4    1e-17   Jatropha curcas
ref|XP_008385844.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.4    1e-17   
ref|XP_008449141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   89.0    1e-17   Cucumis melo [Oriental melon]
ref|XP_009143300.1|  PREDICTED: glucan endo-1,3-beta-glucosidase      89.0    1e-17   Brassica rapa
ref|XP_007142328.1|  hypothetical protein PHAVU_008G271000g           86.7    1e-17   Phaseolus vulgaris [French bean]
ref|XP_010438690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.0    1e-17   Camelina sativa [gold-of-pleasure]
emb|CDY53600.1|  BnaA05g34730D                                        89.0    1e-17   Brassica napus [oilseed rape]
ref|XP_008226995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  82.8    1e-17   Prunus mume [ume]
ref|XP_007160277.1|  hypothetical protein PHAVU_002G307800g           86.7    2e-17   Phaseolus vulgaris [French bean]
gb|AGV54422.1|  glucan endo-1,3-beta-glucosidase 13-like protein      86.7    2e-17   Phaseolus vulgaris [French bean]
ref|XP_008242469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  84.3    2e-17   Prunus mume [ume]
ref|XP_008242470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  84.0    2e-17   
ref|XP_009361042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  87.0    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_009771279.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.6    2e-17   Nicotiana sylvestris
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   85.5    2e-17   Glycine max [soybeans]
ref|XP_004243515.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   88.6    2e-17   Solanum lycopersicum
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   84.7    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_002972033.1|  hypothetical protein SELMODRAFT_96745            88.2    3e-17   
ref|XP_006357966.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.2    3e-17   Solanum tuberosum [potatoes]
ref|XP_009628415.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   88.2    3e-17   Nicotiana tomentosiformis
gb|EYU33669.1|  hypothetical protein MIMGU_mgv1a005896mg              86.7    3e-17   Erythranthe guttata [common monkey flower]
ref|XP_004140120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.2    3e-17   
ref|XP_002972579.1|  hypothetical protein SELMODRAFT_97838            87.8    3e-17   
ref|XP_006357965.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.2    4e-17   
gb|EPS63364.1|  glycoside hydrolase                                   87.4    4e-17   Genlisea aurea
ref|XP_011027332.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  86.3    4e-17   Populus euphratica
gb|KHM99816.1|  Glucan endo-1,3-beta-glucosidase 13                   85.5    5e-17   Glycine soja [wild soybean]
ref|XP_001759996.1|  predicted protein                                79.7    5e-17   
ref|XP_010505644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  88.2    5e-17   
ref|XP_011091523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  87.4    5e-17   Sesamum indicum [beniseed]
emb|CDY62387.1|  BnaCnng40170D                                        87.0    6e-17   Brassica napus [oilseed rape]
ref|XP_010110627.1|  Glucan endo-1,3-beta-glucosidase 13              87.4    6e-17   
ref|XP_010267108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   83.6    6e-17   
emb|CDY20780.1|  BnaA02g09200D                                        85.9    6e-17   
ref|XP_009103956.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  87.0    6e-17   
emb|CDY53692.1|  BnaA07g37860D                                        87.0    6e-17   
ref|XP_008391122.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   81.3    6e-17   
ref|XP_010557676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   87.4    6e-17   
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                   84.7    7e-17   
ref|XP_006280442.1|  hypothetical protein CARUB_v10026374mg           83.6    7e-17   
ref|XP_006584807.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  84.7    7e-17   
emb|CDP14397.1|  unnamed protein product                              87.4    7e-17   
ref|XP_009127019.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  85.5    7e-17   
gb|EEC82195.1|  hypothetical protein OsI_26335                        87.8    7e-17   
emb|CDY06601.1|  BnaC02g13250D                                        85.5    7e-17   
gb|KHN44765.1|  Glucan endo-1,3-beta-glucosidase 11                   86.3    7e-17   
ref|XP_004167482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  86.7    7e-17   
ref|XP_004251202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  85.9    8e-17   
ref|XP_008337610.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   80.1    8e-17   
ref|NP_001059878.1|  Os07g0538000                                     87.4    8e-17   
ref|NP_001275111.1|  glucan endo-1,3-beta-glucosidase 12-like pre...  87.0    8e-17   
ref|XP_009127020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  85.1    8e-17   
gb|AAC04713.1|  beta-1,3-glucanase 7                                  84.7    9e-17   
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  86.7    9e-17   
ref|XP_004147695.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  86.7    9e-17   
ref|XP_007049174.1|  O-Glycosyl hydrolases family 17 protein isof...  87.4    9e-17   
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg           86.7    9e-17   
ref|XP_011101632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  86.7    1e-16   
ref|XP_007049173.1|  O-Glycosyl hydrolases family 17 protein isof...  87.4    1e-16   
emb|CDX92794.1|  BnaC07g40520D                                        86.7    1e-16   
ref|XP_007212383.1|  hypothetical protein PRUPE_ppa005210mg           83.2    1e-16   
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  86.7    1e-16   
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  86.7    1e-16   
ref|XP_009365112.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  86.7    1e-16   
ref|XP_009352572.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   79.7    1e-16   
dbj|BAE99425.1|  beta-1,3-glucanase-like protein                      84.3    1e-16   
ref|XP_009365111.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  86.7    1e-16   
emb|CBI39414.3|  unnamed protein product                              85.5    1e-16   
ref|XP_002881667.1|  glycosyl hydrolase family 17 protein             86.7    1e-16   
ref|XP_002514201.1|  Glucan endo-1,3-beta-glucosidase precursor, ...  81.3    1e-16   
ref|XP_011009684.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  86.3    1e-16   
dbj|BAK05423.1|  predicted protein                                    86.3    2e-16   
ref|XP_004140121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  86.3    2e-16   
gb|EMT12040.1|  Glucan endo-1,3-beta-glucosidase 13                   84.0    2e-16   
ref|XP_006386788.1|  hypothetical protein POPTR_0002s21700g           85.9    2e-16   
ref|XP_002302861.2|  glycosyl hydrolase family 17 family protein      85.9    2e-16   
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  85.5    2e-16   
ref|XP_002890613.1|  predicted protein                                81.3    2e-16   
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  85.9    2e-16   
ref|XP_004498531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  84.7    2e-16   
gb|AGA95870.1|  beta-1,3-glucanase                                    84.3    2e-16   
ref|XP_010915632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  84.3    2e-16   
dbj|BAJ93567.1|  predicted protein                                    84.0    2e-16   
ref|XP_004968988.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  86.3    2e-16   
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  85.5    2e-16   
ref|XP_006297583.1|  hypothetical protein CARUB_v10013604mg           85.5    2e-16   
gb|KFK29190.1|  hypothetical protein AALP_AA7G101400                  85.1    3e-16   
ref|XP_002308921.2|  hypothetical protein POPTR_0006s04460g           84.0    3e-16   
gb|KHN16491.1|  Glucan endo-1,3-beta-glucosidase                      84.0    3e-16   
ref|XP_008357531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  77.4    3e-16   
ref|XP_010447863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  79.0    3e-16   
ref|XP_010673323.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  85.1    3e-16   
ref|XP_008357532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  77.4    3e-16   
ref|XP_008357533.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  77.4    4e-16   
ref|XP_008357534.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  77.4    4e-16   
ref|XP_009773157.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   74.7    4e-16   
ref|XP_009128829.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   79.3    4e-16   
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   80.5    4e-16   
ref|XP_010686003.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   77.0    4e-16   
gb|EAZ04201.1|  hypothetical protein OsI_26344                        85.5    4e-16   
ref|XP_002525335.1|  Glucan endo-1,3-beta-glucosidase precursor, ...  85.1    4e-16   
ref|XP_010438307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   78.6    4e-16   
ref|NP_849556.1|  glucan endo-1,3-beta-glucosidase 12                 78.6    4e-16   
ref|XP_007012989.1|  O-Glycosyl hydrolases family 17 protein isof...  81.3    4e-16   
ref|XP_006387253.1|  hypothetical protein POPTR_1409s00200g           82.4    5e-16   
gb|EMS66645.1|  Glucan endo-1,3-beta-glucosidase 3                    85.5    5e-16   
dbj|BAF01341.1|  putative beta-1,3-glucanase                          83.2    5e-16   
ref|XP_002463526.1|  hypothetical protein SORBIDRAFT_01g001430        84.7    5e-16   
ref|XP_009604117.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   75.9    5e-16   
emb|CAB79694.1|  beta-1, 3-glucanase-like protein                     78.6    5e-16   
dbj|BAB10628.1|  beta-1,3-glucanase-like protein                      84.3    6e-16   
ref|XP_002867412.1|  glycosyl hydrolase family 17 protein             79.0    6e-16   
ref|XP_006285688.1|  hypothetical protein CARUB_v10007158mg           78.6    6e-16   
ref|XP_009595793.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  84.0    6e-16   
ref|XP_009615622.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  84.0    6e-16   
gb|AIR93910.1|  glucanase                                             81.6    6e-16   
ref|XP_006401482.1|  hypothetical protein EUTSA_v10013478mg           82.4    6e-16   
ref|XP_010433104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  77.8    7e-16   
ref|NP_199086.2|  glycosyl hydrolase family 17 protein                84.0    7e-16   
emb|CDY17308.1|  BnaA10g09420D                                        82.4    7e-16   
dbj|BAC84505.1|  putative beta-1,3-glucanase                          84.7    7e-16   
ref|XP_009120040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  82.0    7e-16   
ref|NP_001059886.2|  Os07g0539400                                     84.7    7e-16   
ref|NP_181494.1|  glycosyl hydrolase-17                               84.7    7e-16   
ref|XP_006340433.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  83.6    7e-16   
gb|EYU33213.1|  hypothetical protein MIMGU_mgv1a006294mg              84.0    8e-16   
ref|XP_006403459.1|  hypothetical protein EUTSA_v10010363mg           84.0    8e-16   
gb|EYU43261.1|  hypothetical protein MIMGU_mgv1a008785mg              82.8    9e-16   
ref|XP_008379673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  84.0    9e-16   
ref|XP_007012991.1|  O-Glycosyl hydrolases family 17 protein isof...  80.9    1e-15   
emb|CDP13790.1|  unnamed protein product                              84.3    1e-15   
gb|AHL24654.1|  Fra e 9.01 allergen                                   83.6    1e-15   
ref|XP_010481959.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  83.6    1e-15   
ref|XP_010559242.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  79.7    1e-15   
ref|XP_007012992.1|  O-Glycosyl hydrolases family 17 protein isof...  80.5    1e-15   
ref|XP_002878033.1|  hypothetical protein ARALYDRAFT_485970           83.6    1e-15   
gb|KFK29497.1|  hypothetical protein AALP_AA7G142000                  78.6    1e-15   
ref|XP_009784615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  82.8    1e-15   
ref|XP_010442129.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  83.2    1e-15   
ref|XP_006412850.1|  hypothetical protein EUTSA_v10024870mg           78.2    1e-15   
gb|AAK76666.1|  putative beta-1,3-glucanase                           83.6    1e-15   
ref|NP_191103.1|  O-Glycosyl hydrolases family 17 protein             83.2    1e-15   
gb|AAM66982.1|  beta-1,3-glucanase-like protein                       83.2    1e-15   
ref|XP_010913393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  83.6    1e-15   
gb|ABK58141.1|  beta-1,3-glucanase                                    81.6    1e-15   
emb|CDY62033.1|  BnaC03g77660D                                        78.2    1e-15   
ref|XP_002867539.1|  hydrolase, hydrolyzing O-glycosyl compounds      80.9    1e-15   
gb|EMS59735.1|  Glucan endo-1,3-beta-glucosidase 11                   73.9    1e-15   
ref|XP_002278044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   83.2    1e-15   
ref|XP_010494214.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  83.2    2e-15   
ref|XP_007009341.1|  O-Glycosyl hydrolases family 17 protein, put...  83.2    2e-15   
ref|XP_004291598.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   75.1    2e-15   
ref|XP_008643986.1|  PREDICTED: uncharacterized protein LOC100382...  83.2    2e-15   
ref|NP_200470.1|  O-Glycosyl hydrolases family 17 protein             78.6    2e-15   
emb|CDP05678.1|  unnamed protein product                              83.2    2e-15   
ref|XP_004491103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  83.2    2e-15   
ref|XP_002864380.1|  glycosyl hydrolase family 17 protein             82.8    2e-15   
emb|CDY19908.1|  BnaC09g31740D                                        82.8    2e-15   
ref|NP_567828.3|  glucan endo-1,3-beta-glucosidase 12                 78.6    2e-15   
gb|KHG05496.1|  hypothetical protein F383_30989                       82.8    2e-15   
ref|XP_009374179.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7    82.8    2e-15   
ref|NP_001130652.1|  uncharacterized protein LOC100191753 precursor   81.6    2e-15   
emb|CDY64970.1|  BnaAnng19910D                                        79.7    2e-15   
gb|KHG04832.1|  hypothetical protein F383_29565                       78.6    2e-15   
gb|KJB13749.1|  hypothetical protein B456_002G092600                  82.8    2e-15   
ref|NP_001049543.1|  Os03g0246100                                     82.4    2e-15   
gb|KJB37880.1|  hypothetical protein B456_006G224700                  82.8    2e-15   
gb|EEC83592.1|  hypothetical protein OsI_29271                        82.4    2e-15   
emb|CDY46679.1|  BnaA03g48290D                                        82.8    2e-15   
ref|XP_009785958.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  82.4    2e-15   
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  82.8    2e-15   
ref|XP_004513066.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  79.7    2e-15   
gb|AAD26909.1|  putative beta-1,3-glucanase                           82.8    2e-15   
ref|XP_008804844.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   76.6    2e-15   
ref|NP_194413.2|  O-Glycosyl hydrolases family 17 protein             79.7    2e-15   
ref|XP_006280516.1|  hypothetical protein CARUB_v10026453mg           82.4    2e-15   
ref|XP_009789910.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  82.8    2e-15   
gb|KHG21190.1|  hypothetical protein F383_01641                       82.8    2e-15   
ref|XP_009593199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  82.8    3e-15   
emb|CAB36529.1|  putative beta-1, 3-glucanase                         79.7    3e-15   
emb|CDM85083.1|  unnamed protein product                              79.3    3e-15   
emb|CDY06818.1|  BnaC01g09170D                                        78.6    3e-15   
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein             82.8    3e-15   
dbj|BAB08587.1|  beta-1,3-glucanase-like protein                      82.4    3e-15   
gb|KDP33779.1|  hypothetical protein JCGZ_07350                       76.6    3e-15   
gb|KHG21189.1|  hypothetical protein F383_01641                       82.8    3e-15   
gb|KFK27118.1|  hypothetical protein AALP_AA8G337200                  82.0    3e-15   
ref|NP_568822.1|  O-Glycosyl hydrolases family 17 protein             82.0    3e-15   
ref|NP_001154780.1|  O-Glycosyl hydrolases family 17 protein          82.0    3e-15   
ref|XP_010449211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  82.4    3e-15   
ref|XP_006291113.1|  hypothetical protein CARUB_v10017225mg           82.4    3e-15   
ref|XP_002864470.1|  glycosyl hydrolase family 17 protein             78.6    3e-15   
ref|XP_009120169.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   79.3    3e-15   
ref|XP_009102359.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   82.4    3e-15   
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   82.4    3e-15   
ref|XP_004304086.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   82.4    3e-15   
emb|CDY56498.1|  BnaAnng14330D                                        82.0    3e-15   
ref|XP_001757144.1|  predicted protein                                80.9    3e-15   
ref|XP_002465561.1|  hypothetical protein SORBIDRAFT_01g041160        81.6    3e-15   
emb|CAA18827.1|  putative protein (fragment)                          80.9    3e-15   
emb|CDY18049.1|  BnaC07g04210D                                        82.0    4e-15   
gb|KJB10702.1|  hypothetical protein B456_001G216900                  82.4    4e-15   
tpg|DAA62996.1|  TPA: putative O-glycosyl hydrolase family 17 pro...  82.0    4e-15   
ref|XP_010091462.1|  putative glucan endo-1,3-beta-glucosidase A6     79.3    4e-15   
gb|KJB10701.1|  hypothetical protein B456_001G216900                  82.0    4e-15   
ref|XP_009405069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  82.0    4e-15   
ref|XP_002320484.1|  glycosyl hydrolase family 17 family protein      82.0    4e-15   
emb|CAB80165.1|  putative protein (fragment)                          80.9    4e-15   
gb|ABI49503.1|  Glycosyl hydrolases family 17 protein                 82.0    4e-15   
ref|XP_011095448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   81.6    4e-15   
ref|NP_001275363.1|  glucan endo-1,3-beta-glucosidase 13-like pre...  79.3    4e-15   
ref|XP_002883709.1|  hypothetical protein ARALYDRAFT_480193           82.0    5e-15   
emb|CDX76097.1|  BnaA04g03610D                                        81.6    5e-15   
ref|XP_010446151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  79.3    5e-15   
ref|XP_010482941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  81.3    5e-15   
ref|XP_004965529.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  81.3    5e-15   
ref|XP_010313365.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   72.4    5e-15   
emb|CDY14214.1|  BnaA08g13450D                                        75.9    5e-15   
emb|CDP03239.1|  unnamed protein product                              77.8    5e-15   
emb|CDP00093.1|  unnamed protein product                              81.6    5e-15   
ref|XP_001777261.1|  predicted protein                                81.6    6e-15   
dbj|BAJ92436.1|  predicted protein                                    80.9    6e-15   
gb|ACF88366.1|  unknown                                               81.3    6e-15   
gb|KJB65051.1|  hypothetical protein B456_010G078300                  78.2    6e-15   
gb|ACF85320.1|  unknown                                               81.3    6e-15   
ref|XP_010244978.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   72.8    6e-15   
gb|AAL77689.1|  AT5g55180/MCO15_13                                    80.9    6e-15   
ref|XP_002865493.1|  glycosyl hydrolase family 17 protein             81.3    6e-15   
ref|XP_010443128.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...  81.6    6e-15   
ref|NP_001150602.1|  LOC100284235                                     81.3    6e-15   
ref|NP_001151472.1|  hydrolase, hydrolyzing O-glycosyl compounds ...  81.3    7e-15   
ref|XP_006855691.1|  hypothetical protein AMTR_s00044p00136160        79.3    7e-15   
ref|XP_010483135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   77.4    7e-15   
gb|EPS68573.1|  hypothetical protein M569_06194                       80.1    7e-15   
emb|CDY32869.1|  BnaC09g33160D                                        77.8    7e-15   
ref|XP_004287489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13   76.6    7e-15   
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g           81.3    7e-15   
ref|XP_010476823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  77.4    8e-15   
gb|AFA26674.1|  beta-1,3-glucanase                                    79.7    8e-15   
ref|XP_011090341.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  72.4    9e-15   
ref|XP_008783886.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  80.5    9e-15   
ref|XP_009137621.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   81.3    9e-15   
ref|XP_011035318.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  75.1    9e-15   
emb|CDY02936.1|  BnaC04g25500D                                        80.9    9e-15   
ref|XP_008783885.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  80.5    9e-15   
gb|EPS73640.1|  hypothetical protein M569_01113                       75.1    9e-15   
ref|XP_010270042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   80.9    9e-15   
ref|XP_010942826.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7    80.9    1e-14   
gb|EPS68882.1|  hypothetical protein M569_05882                       80.1    1e-14   
ref|XP_001779924.1|  predicted protein                                80.1    1e-14   
ref|XP_006362893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  71.2    1e-14   
ref|NP_001275116.1|  glucan endo-1,3-beta-glucosidase 14-like pre...  71.2    1e-14   



>emb|CDP03931.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++LI GLKAK VKIYDANPKIL ALG + +QVSVMVPNEII NISS+Q LAD+WV+TNVV
Sbjct  47   VELIQGLKAKGVKIYDANPKILAALGGTPLQVSVMVPNEIITNISSNQTLADQWVKTNVV  106

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            PFY +T+IRYLLVGNEILS P  TTWF LVPAMR+IR SVK FGL
Sbjct  107  PFYRKTRIRYLLVGNEILSGPDKTTWFNLVPAMRRIRYSVKTFGL  151


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = +2

Query  107  GADISATVGICYGQLGNNLPTPSRSAAHPWLKGEAGQDLRCQPENPQ  247
            GA++SA VGICYGQLGNNLPTPS+S     ++G   + ++    NP+
Sbjct  22   GAEMSAKVGICYGQLGNNLPTPSKSVE--LIQGLKAKGVKIYDANPK  66



>ref|XP_009777271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=466

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI+GLKA RVKIYDANP+IL+A   + +QVSVMVPNE+I NIS++Q LAD+WV+TNVV
Sbjct  47   VDLINGLKANRVKIYDANPEILKAFKGTKIQVSVMVPNELINNISTNQDLADQWVKTNVV  106

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            PFY +T IRYLLVGNEILSNPPNTTWF LVPA+RKIR SVKKFGL
Sbjct  107  PFYPDTMIRYLLVGNEILSNPPNTTWFNLVPAIRKIRYSVKKFGL  151



>ref|XP_011089044.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=461

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QLI  L  KR+KIY  NPKIL+++  +D+Q+S+MVPN +IP+IS++Q LAD+WV+TNVV
Sbjct  46   IQLIQKLNGKRIKIYGTNPKILKSIQGTDLQISIMVPNNLIPDISTNQTLADQWVQTNVV  105

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            PFY E+KIRYLLVGNEILSNPPNTTWF+LVPAMRKIR SVKK+GL
Sbjct  106  PFYPESKIRYLLVGNEILSNPPNTTWFKLVPAMRKIRSSVKKYGL  150



>ref|XP_006366999.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=464

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
            + + LI GLKAKRVKIYD NP+IL AL  +++QVSVMVPNE+I NIS++Q LAD+WV+ N
Sbjct  43   NSVDLIKGLKAKRVKIYDTNPQILEALKGTNLQVSVMVPNELINNISTNQTLADQWVKNN  102

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            VVPFY  T IRYLLVGNEILS+PPNTTWF LVPA+RKIR SVKKFGL
Sbjct  103  VVPFYPHTMIRYLLVGNEILSSPPNTTWFNLVPAIRKIRFSVKKFGL  149


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 2/56 (4%)
 Frame = +2

Query  110  ADISATVGICYGQLGNNLPTPSRSAAHPWLKGEAGQDLRCQPENPQSSRELRCSSV  277
            A+IS+ VGICYGQLGNNLP P  S     +KG   + ++    NPQ    L+ +++
Sbjct  21   AEISSQVGICYGQLGNNLPIPKNSVD--LIKGLKAKRVKIYDTNPQILEALKGTNL  74



>ref|XP_009610543.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
tomentosiformis]
Length=465

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI+GLKA RVKIYDANP+IL+A   + +Q+SVMVPNE+I NIS++Q LAD+WV+TNVV
Sbjct  46   VDLINGLKANRVKIYDANPEILKAFKGTKLQLSVMVPNELINNISTNQDLADQWVKTNVV  105

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            PFY +T IRY+LVGNEILS+PPNTTWF LVPA+RKIR +VKKFGL
Sbjct  106  PFYPDTMIRYVLVGNEILSSPPNTTWFNLVPAIRKIRYAVKKFGL  150


 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 32/53 (60%), Gaps = 2/53 (4%)
 Frame = +2

Query  107  GADISATVGICYGQLGNNLPTPSRSAAHPWLKGEAGQDLRCQPENPQSSRELR  265
            GA+IS+ VGICYGQLGNNLP P++S     + G     ++    NP+  +  +
Sbjct  21   GAEISSKVGICYGQLGNNLPIPTKSVD--LINGLKANRVKIYDANPEILKAFK  71



>ref|XP_004247041.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=464

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
            + + LI GLKAKRVKIYD NP+IL AL  +++QVSVMVPNE+I NIS++Q LAD+WV+ N
Sbjct  43   NSVDLIKGLKAKRVKIYDTNPQILDALKGTNLQVSVMVPNELINNISTNQTLADQWVKNN  102

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            +VPFY  T IRYLLVGNEILS+PPNTTWF LVP +RKIR SVKKFGL
Sbjct  103  IVPFYPHTMIRYLLVGNEILSSPPNTTWFNLVPTIRKIRFSVKKFGL  149



>ref|XP_008244679.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=462

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  LKAKRVKIYDANPKIL AL N+D+QVS+MVPNE+I NISS+Q LAD+WV  N
Sbjct  42   ESVKLIQSLKAKRVKIYDANPKILEALRNTDLQVSMMVPNELINNISSNQTLADQWVHAN  101

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            VVPFY ET IRYLLVGNEILS P  T WF LVPAMRKI+ ++K  G+
Sbjct  102  VVPFYPETLIRYLLVGNEILSQPDKTIWFNLVPAMRKIKAALKTHGI  148



>gb|EYU39188.1| hypothetical protein MIMGU_mgv1a006049mg [Erythranthe guttata]
Length=459

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
               +QLI  L AKR+KIY ANPKIL+++  +D+Q+S+MVPN++I  I ++Q LAD WV+T
Sbjct  43   EKSIQLIQKLNAKRIKIYGANPKILKSIQGTDLQISIMVPNQLISAIYNNQTLADDWVKT  102

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            NVVPFY ++KIRYLLVGNEILS+ PN+TWFQLVPA+R+IR +VKK+GL+
Sbjct  103  NVVPFYPQSKIRYLLVGNEILSSQPNSTWFQLVPAIRRIRNAVKKYGLK  151



>gb|EPS58986.1| hypothetical protein M569_15824, partial [Genlisea aurea]
Length=453

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    ++LI  LKA RVKIYDANP+IL+AL   ++ VSVM+PN++IP +++DQ  +D WV
Sbjct  31   PPSESVRLIEKLKAGRVKIYDANPEILKALKGKNLLVSVMLPNQLIPAVAADQKFSDEWV  90

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
              NV PFY  TKIRY+LVGNEILSNPPNTTWF+LVPAM++IR SV K G++
Sbjct  91   RKNVAPFYPATKIRYILVGNEILSNPPNTTWFELVPAMKRIRISVVKLGMK  141



>ref|XP_004144397.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
 ref|XP_004167264.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
 gb|KGN58384.1| hypothetical protein Csa_3G634360 [Cucumis sativus]
Length=466

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P  H + LI  L A+ VKIYDANP+IL+AL N+D++VSVMVPNE+I NISS Q LAD+WV
Sbjct  39   PPSHSVNLIKSLNAQIVKIYDANPQILKALKNTDLRVSVMVPNELIINISSSQNLADQWV  98

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             TN++PFY +TKIRYLLVGNEI+S+  N TWF LVPAMR+I+ S+K +G+
Sbjct  99   RTNILPFYPQTKIRYLLVGNEIISSTGNQTWFSLVPAMRRIKHSLKTYGI  148



>ref|XP_008382581.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=463

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    ++LI  LKAKRVK+YDANPKIL AL N+D+QVS+MVPNE+I NISS+Q LAD WV
Sbjct  39   PPSQSVKLIQSLKAKRVKLYDANPKILTALRNTDLQVSIMVPNELINNISSNQTLADHWV  98

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVK  482
             TNVVPFY ET IRYLLVGNEILS P    W+ LVPAMRKI+ ++K
Sbjct  99   HTNVVPFYPETLIRYLLVGNEILSQPDKQIWYNLVPAMRKIKAALK  144



>ref|XP_008356234.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=524

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    ++LI  L AKRVK+YDANPKIL AL N+D+QVS+MVPNE+I NISS+Q LAD+WV
Sbjct  91   PPSQSVKLIQSLNAKRVKLYDANPKILAALRNTDLQVSIMVPNELISNISSNQTLADQWV  150

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVK  482
             TNVVPFY +T IRYLLVGNEILS P    WF LVPAMRKI+ ++K
Sbjct  151  RTNVVPFYPDTLIRYLLVGNEILSQPNKQIWFNLVPAMRKIKAALK  196



>ref|XP_002303070.2| 3-glucanase family protein [Populus trichocarpa]
 gb|EEE82343.2| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  LKAKRVKIYDANP IL++L N+D+QVS+MVPN +IPNIS  Q  +D+WV+TN
Sbjct  43   RSVELIKSLKAKRVKIYDANPDILKSLKNTDIQVSIMVPNALIPNISKSQYFSDQWVKTN  102

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            VVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+ +  +R
Sbjct  103  VVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKISLTRHNIR  150



>ref|XP_011024596.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   148 bits (373),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  LKAKRVKIYDANP IL++L N+D+QVS+MVPN +IPNIS  Q  +D+WV+TN
Sbjct  43   RSVELIKSLKAKRVKIYDANPDILKSLKNTDIQVSIMVPNALIPNISKSQYFSDQWVKTN  102

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            VVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+ +  +R
Sbjct  103  VVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKISLTRHNIR  150



>dbj|BAA89481.1| beta-1,3-glucanase [Salix gilgiana]
Length=478

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++LI  LKAKRVKIYDANP IL++L N+D+QVS+MVPN +IPN+S+ Q  +D+WVETNVV
Sbjct  58   VELIKSLKAKRVKIYDANPDILKSLKNTDIQVSIMVPNALIPNMSTSQHFSDQWVETNVV  117

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            P+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+ +   R
Sbjct  118  PYYPDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKISLTRRNFR  163



>ref|XP_009372203.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=463

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    ++LI  LKAKRVK+YDANPKIL AL N+D+QVS+MVPNE+I NISS+Q LAD WV
Sbjct  39   PPSQSVKLIQSLKAKRVKLYDANPKILTALRNTDLQVSIMVPNELINNISSNQTLADHWV  98

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVK  482
             TN+VPFY ET IRYLLVGNEILS P    W+ LVPAMRKI+ ++K
Sbjct  99   YTNLVPFYPETLIRYLLVGNEILSQPDKQVWYNLVPAMRKIKAALK  144



>ref|XP_011024595.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  LKAKRVKIYDANP IL++L ++D+QVS+M+PNE+I NIS  Q+L+D WV+TN
Sbjct  43   ESVELIKSLKAKRVKIYDANPDILKSLKDTDIQVSIMIPNELIQNISKSQSLSDHWVKTN  102

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            VVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+K   ++
Sbjct  103  VVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKASLKSHKIK  150



>ref|XP_004290162.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Fragaria 
vesca subsp. vesca]
Length=463

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  LKAKRVKIYDANPKIL AL N+D+QVS+MVPNE+I NISS+Q LA++WV  N
Sbjct  42   ESVKLIQNLKAKRVKIYDANPKILEALRNTDLQVSMMVPNELINNISSNQTLANQWVHAN  101

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            VVPFY  T IRYLLVGNEILS P  + WF LVPAMRKI++++K  G+
Sbjct  102  VVPFYPHTLIRYLLVGNEILSAPDKSIWFNLVPAMRKIKKALKIHGI  148



>ref|XP_006386885.1| 3-glucanase family protein [Populus trichocarpa]
 gb|ERP64682.1| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++L+  LKAKRVKIYDANP IL++L ++D+QVS+M+PNE+I NIS  Q+L+D WV+TN
Sbjct  43   ESVELLKSLKAKRVKIYDANPDILKSLKDTDIQVSIMIPNELIQNISKSQSLSDHWVKTN  102

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVK  482
            VVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I+ S+K
Sbjct  103  VVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRIKASLK  145



>gb|KDO46598.1| hypothetical protein CISIN_1g038099mg, partial [Citrus sinensis]
Length=250

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNIS-SDQALADRW  341
            P      +I  LKA RVKIYDANPKIL+AL N D+QVS+MVPNEII NIS S Q L+D+W
Sbjct  41   PQESVELMIKSLKATRVKIYDANPKILKALKNIDIQVSIMVPNEIINNISLSSQTLSDQW  100

Query  342  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            V TNV+P+   TKIRYLLVGNEILS P  + W  LVPAMRKIR+S+K  G R
Sbjct  101  VRTNVLPYLPGTKIRYLLVGNEILSLPDKSIWPNLVPAMRKIRKSLKTLGAR  152



>ref|XP_008460404.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=465

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
            H + LI  L A+ VKIYDANP+IL AL N+D++VSVMVPNE+I NISS+Q LAD+WV TN
Sbjct  42   HSVNLIKSLNAQIVKIYDANPQILNALKNTDLRVSVMVPNELIINISSNQNLADQWVRTN  101

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            ++PFY + KIRYLLVGNEI+S+  N TWF LVPAMR+I+ S+K +G+
Sbjct  102  ILPFYPQIKIRYLLVGNEIISSTGNQTWFSLVPAMRRIKHSLKTYGI  148



>gb|KEH22559.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=463

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            L LI  L AKR+KIYD NP+IL  L N+++QVS+M+PNE+I NISS+Q L+D+W+++N++
Sbjct  44   LSLIKSLNAKRIKIYDTNPQILTTLKNTNIQVSIMLPNELITNISSNQTLSDQWIKSNIL  103

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            P+Y +T IRYLLVGNEI+S+ PN+TW  LVPAMR+I+ S+KKF ++
Sbjct  104  PYYPQTLIRYLLVGNEIISSTPNSTWLHLVPAMRRIKHSLKKFRVK  149



>ref|XP_004492271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=463

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
             + + LI  L +KR+KIYD NP+IL +L N+++QVS+M+PNE+I NIS++Q L+D+W+++
Sbjct  41   QNSISLIKSLNSKRIKIYDTNPQILTSLKNTNIQVSIMLPNELITNISTNQTLSDQWIKS  100

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            NVVPFY +T IRYLL+GNEI+S+ PN+TW  LVPAMR+I+ S+KKF ++
Sbjct  101  NVVPFYPQTLIRYLLIGNEIISSTPNSTWPHLVPAMRRIKHSLKKFRIK  149



>ref|XP_007049651.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOX93808.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=461

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  L AKRVKIYDANP IL AL ++++QVS+MVPN+++ NIS++Q LAD WVE+N
Sbjct  40   QSVKLIQSLGAKRVKIYDANPDILNALKDTNLQVSIMVPNQLLTNISTNQKLADSWVESN  99

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVK  482
            VVPFY +TKIRYLLVGNE++S+ P  TW+ +VPAMRK++ S+K
Sbjct  100  VVPFYPKTKIRYLLVGNEVISSSPKETWYSIVPAMRKLKNSLK  142



>ref|XP_010036769.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW48410.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
 gb|KCW48411.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
Length=466

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  192  HGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYG  371
            H LKA+RVKIYDANP ILRAL ++ +QVSVMVPNE+I  I+ +Q LAD WV +NVVPF+ 
Sbjct  50   HQLKAQRVKIYDANPSILRALEHTGIQVSVMVPNELINAIAVNQTLADSWVGSNVVPFHP  109

Query  372  ETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKK  485
             TKIRYLLVGNEILS+  NTTWF LVPAMRK+++++K+
Sbjct  110  ATKIRYLLVGNEILSSADNTTWFNLVPAMRKVKKALKR  147



>gb|KHG25787.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=461

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  L+AKRVKIYDAN  IL AL  +++QV +MVPNEII NIS+ Q LAD WVETN
Sbjct  40   QSVKLIQSLRAKRVKIYDANHDILNALKGTNLQVCIMVPNEIINNISTSQKLADSWVETN  99

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            VVPFY  TKIRYLLVGNE++S  P   W  +VPAMRKI++S+K  GL
Sbjct  100  VVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMRKIKKSLKAHGL  146



>gb|KDP45279.1| hypothetical protein JCGZ_15144 [Jatropha curcas]
Length=464

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 7/142 (5%)
 Frame = +3

Query  84   YWPCHLFPAQISQLRSEYAT---VNWATTF----PHHHDLQLIHGLKAKRVKIYDANPKI  242
            ++P  +F    S   SE +    +NW T      P  H ++LI  LKAKRVKIY A+ +I
Sbjct  5    FFPLFVFALLFSTCSSEISNKIGINWGTLGNNLPPPPHTVELIKSLKAKRVKIYSADQEI  64

Query  243  LRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP  422
            L AL N+D+QVS+M+PNE+IPN+S  Q  +D WV+ NVV F  + KIRYLLVGNEIL+NP
Sbjct  65   LTALKNTDIQVSIMLPNELIPNVSKSQHFSDHWVKNNVVRFLPDVKIRYLLVGNEILTNP  124

Query  423  PNTTWFQLVPAMRKIRRSVKKF  488
               TWF LVPAMR+I+ S++ +
Sbjct  125  DVGTWFNLVPAMRRIKCSLRAY  146



>gb|KJB10879.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=460

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  L AKRVKIYDAN  IL AL  +++QV +MVPNEII NIS+ Q LAD WVETN
Sbjct  40   QSVKLIQSLGAKRVKIYDANHDILNALKGTNLQVCIMVPNEIINNISTSQKLADSWVETN  99

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            VVPFY  TKIRYLLVGNE++S  P   W  +VPAMRKI++S+K  GL
Sbjct  100  VVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMRKIKKSLKTHGL  146



>gb|KJB10878.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=461

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  L AKRVKIYDAN  IL AL  +++QV +MVPNEII NIS+ Q LAD WVETN
Sbjct  40   QSVKLIQSLGAKRVKIYDANHDILNALKGTNLQVCIMVPNEIINNISTSQKLADSWVETN  99

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            VVPFY  TKIRYLLVGNE++S  P   W  +VPAMRKI++S+K  GL
Sbjct  100  VVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMRKIKKSLKTHGL  146



>ref|XP_010100789.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
 gb|EXB84487.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
Length=470

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  LKAKRVKIY+A+P+IL AL N+++QVS+MVPNEI+ NIS++Q LAD WV TN
Sbjct  46   RSVELIKTLKAKRVKIYNADPEILTALRNTNIQVSIMVPNEILINISTNQTLADEWVHTN  105

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            +VPFY +T IRYLLVGNEI+S+     W+ LVPAMRKI+ +++  G+R
Sbjct  106  LVPFYHDTMIRYLLVGNEIISSTAKPVWYALVPAMRKIKSALRTHGIR  153



>ref|XP_003626949.1| Beta-1 3-glucanase [Medicago truncatula]
 gb|AET01425.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=463

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  LKAKRVKIYDANP+IL+AL N+ +QVS+M+PNE++ N+SS+Q LA++WV+TN+V
Sbjct  47   VSLIKNLKAKRVKIYDANPQILKALENTGIQVSIMLPNELVTNVSSNQTLANQWVQTNLV  106

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            PFY +T IRYLLVGNE++S+  N TW  +VPAM +++ S+  FGL
Sbjct  107  PFYSKTLIRYLLVGNELISSTTNQTWPHIVPAMYRMKHSLTIFGL  151



>ref|XP_006297636.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
 gb|EOA30534.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
Length=460

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L AKRVK+YDANPKIL AL  +D+ VSVMVPNE++ NIS  ++L+D W+ +N++
Sbjct  42   VNLIKSLNAKRVKLYDANPKILAALNATDITVSVMVPNELLVNISKSESLSDDWIRSNIL  101

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++
Sbjct  102  PFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRKIQRSLKSLGVK  147



>ref|XP_002884642.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60901.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L AKRVK+YDANPKIL AL  +D+ VSVMVPNE+I NIS  ++L+D W+ +N++
Sbjct  42   VNLIKSLNAKRVKLYDANPKILTALNGTDITVSVMVPNELIVNISKSESLSDDWIRSNIL  101

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY  TKIRYLLVGNEILS P +     LVPAMRKI+RS+K  G++
Sbjct  102  PFYPTTKIRYLLVGNEILSFPDSELKSSLVPAMRKIQRSLKSLGVK  147



>ref|NP_683538.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAF02143.1|AC009853_3 putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
 dbj|BAC42699.1| putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
 gb|AAO64098.1| putative glycosyl hydrolase [Arabidopsis thaliana]
 gb|AEE74528.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=460

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L AKRVK+YDANPKIL AL  +D+ VSVMVPNE++ NIS   +L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILAALNGTDITVSVMVPNELLVNISKSASLSDDWIRSNIL  102

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY  TKIRYLLVGNEILS P +     LVPAMRKI+RS+K  G++
Sbjct  103  PFYPTTKIRYLLVGNEILSLPDSELKSSLVPAMRKIQRSLKSLGVK  148



>gb|AAF20214.1|AC012395_1 putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
Length=440

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L AKRVK+YDANPKIL AL  +D+ VSVMVPNE++ NIS   +L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILAALNGTDITVSVMVPNELLVNISKSASLSDDWIRSNIL  102

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY  TKIRYLLVGNEILS P +     LVPAMRKI+RS+K  G++
Sbjct  103  PFYPTTKIRYLLVGNEILSLPDSELKSSLVPAMRKIQRSLKSLGVK  148



>ref|XP_010464351.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L AKRVK+YDANPKIL AL ++D+ VSVMVPNE++ NIS  + L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILTALNSTDITVSVMVPNELLVNISKSETLSDDWIRSNIL  102

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++
Sbjct  103  PFYPTTKIRYLLVGNEILSSTDSELKASLVPAMRKIQRSLKSLGVK  148



>gb|KFK38190.1| hypothetical protein AALP_AA3G081000 [Arabis alpina]
Length=462

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++LI  L AKRVK+YDANPKIL AL ++D+ VSVMVPNE+I NIS    L+D WV++ ++
Sbjct  44   IKLIQSLNAKRVKLYDANPKILTALNSTDISVSVMVPNELIINISKSNTLSDEWVKSKIL  103

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++
Sbjct  104  PFYPTTKIRYLLVGNEILSSQNSQLKSSLVPAMRKIQRSLKTLGVK  149



>ref|XP_010486278.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L AKRVK+YDANPKIL AL  +D+ VSVMVPNE++ NIS  + L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILSALNATDITVSVMVPNELLVNISKSETLSDDWIRSNIL  102

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++
Sbjct  103  PFYPTTKIRYLLVGNEILSSTDSELKASLVPAMRKIQRSLKSLGVK  148



>gb|KHN10950.1| Putative glucan endo-1,3-beta-glucosidase A6 [Glycine soja]
Length=397

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    + LI  L AKRVK+YDANP IL AL ++ +QVS+MVPN++I NIS +Q+L+D+WV
Sbjct  42   PPQKSVSLITSLHAKRVKLYDANPAILHALRDTSLQVSIMVPNDLIVNISRNQSLSDKWV  101

Query  345  ETNVVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGLR  497
              NVVP++  T IRYLLVGNE+ S+  PN TW  LVPAMR+I+ S+K  G+R
Sbjct  102  SDNVVPYHPRTLIRYLLVGNEVTSSTAPNGTWPYLVPAMRRIKHSLKSLGIR  153



>ref|XP_004510238.1| PREDICTED: putative copper-transporting ATPase HMA5-like [Cicer 
arietinum]
Length=1239

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  LKAKRVKIYDANP+IL+AL N+ +QVS+M+PN++I +IS +Q L+++WV++N+V
Sbjct  823  ISLIKNLKAKRVKIYDANPQILKALENTGLQVSIMIPNQLITDISLNQTLSNQWVQSNLV  882

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            PFY +T IRYLLVGNE++S+  N TW  +VPAM +I+ S+  FGL
Sbjct  883  PFYPKTLIRYLLVGNELISSTTNQTWPHIVPAMHRIKNSLTNFGL  927



>gb|KHG02504.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=464

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
               ++LI  + AKRVKIYDANP IL AL  +D+QVS+MVPN+ + NIS++Q LAD W+++
Sbjct  42   EKSVKLIQSIGAKRVKIYDANPDILNALRGTDLQVSIMVPNQHLTNISTNQKLADSWIQS  101

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSV  479
            NV+PFY + KIRYLLVGNE++S+ P   W+ +VPAMRKI+ ++
Sbjct  102  NVLPFYPKVKIRYLLVGNEVISSSPKEIWYSIVPAMRKIKNAL  144



>gb|AAM65039.1| putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
Length=460

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L AKRVK+YDANPKIL AL  +D+ VSVMVPNE++ NIS   +L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILAALNGTDITVSVMVPNELLVNISKSASLSDDWIRSNIL  102

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY  TKIRYLLVGNEILS P +     LVPAMRKI+ S+K  G++
Sbjct  103  PFYPTTKIRYLLVGNEILSLPDSELKSSLVPAMRKIQHSLKSLGVK  148



>ref|XP_003530849.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    + LI  L AKRVK+YDANP IL AL ++ +QVS+MVPN++I NIS +Q+L+D+WV
Sbjct  42   PPQKSVSLITSLHAKRVKLYDANPAILHALRDTSLQVSIMVPNDLIVNISRNQSLSDKWV  101

Query  345  ETNVVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGLR  497
              NVVP++  T IRYLLVGNE+ S+  PN TW  LVPAMR+I+ S+K  G+R
Sbjct  102  SDNVVPYHPRTLIRYLLVGNEVTSSTAPNGTWPYLVPAMRRIKHSLKSLGIR  153



>emb|CDY28063.1| BnaC05g44650D [Brassica napus]
Length=460

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L AK VK+YDANP IL AL  +D+ VSVMVPNE+I NI+  + L+D WV++NV+
Sbjct  42   VSLIKSLNAKSVKLYDANPSILAALKATDIVVSVMVPNELIVNITKSKTLSDDWVKSNVL  101

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++
Sbjct  102  PFYPSTKIRYLLVGNEILSSPDSELKSALVPAMRKIQRSLKTLGVK  147



>emb|CDY45466.1| BnaC09g12840D [Brassica napus]
Length=460

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L AK VK+YDANP IL AL  +D+ VSVMVPNE+I NI+  + L+D W+++NV+
Sbjct  42   VSLIKSLNAKSVKLYDANPSILAALNATDIVVSVMVPNELIVNITKSKTLSDDWIKSNVL  101

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY  TKIRYLLVGNEILS+P +     LVPAMRKI+RS+K  G++
Sbjct  102  PFYPSTKIRYLLVGNEILSSPDSELKSALVPAMRKIQRSLKTLGVK  147



>ref|XP_010451138.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L AKRVK+YDANPKIL AL  +D+ VSVMVPNE++ NIS  + L+D W+ +N++
Sbjct  43   VNLIKSLNAKRVKLYDANPKILAALNATDITVSVMVPNELLVNISKSETLSDDWIRSNIL  102

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY  TKIRYLLVGNEILS   +     LVPAMRKI+RS+K  G++
Sbjct  103  PFYPTTKIRYLLVGNEILSFTDSELKASLVPAMRKIQRSLKSLGVK  148



>ref|XP_006407848.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49301.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=469

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++LI  L AKRVK+YDANP IL AL  +D+ VSVMVPN++I NIS   +L+D W+ +N++
Sbjct  51   VKLIKSLNAKRVKLYDANPTILAALNATDIAVSVMVPNQLIVNISKSDSLSDDWIRSNIL  110

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY +TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++
Sbjct  111  PFYPDTKIRYLLVGNEILSSTDSELKSALVPAMRKIQRSLKTLGVK  156



>ref|XP_006407849.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49302.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=470

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++LI  L AKRVK+YDANP IL AL  +D+ VSVMVPN++I NIS   +L+D W+ +N++
Sbjct  51   VKLIKSLNAKRVKLYDANPTILAALNATDIAVSVMVPNQLIVNISKSDSLSDDWIRSNIL  110

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY +TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++
Sbjct  111  PFYPDTKIRYLLVGNEILSSTDSELKSALVPAMRKIQRSLKTLGVK  156



>ref|XP_007140788.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
 gb|ESW12782.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
Length=465

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    +  +  L AKRVK+YDANP IL AL ++ +QVSVMVPN++I NISS+Q LAD+WV
Sbjct  41   PARQSVSHLTSLHAKRVKLYDANPAILHALQHTRLQVSVMVPNDLIMNISSNQTLADKWV  100

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
             +NV  F   T+IRY+LVGNEI+S+  N TW  +VPAMR+I+ ++K  G+R
Sbjct  101  SSNVAAFLPNTRIRYILVGNEIISSTTNATWRHVVPAMRRIKHALKSLGIR  151



>ref|XP_006484802.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=466

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADR-W  341
            P      +I  LKA RVKIYDANPKIL+AL N+D+QVS+MVPNEII NIS         W
Sbjct  41   PQESVELMIKSLKATRVKIYDANPKILKALKNTDIQVSIMVPNEIINNISLSSQSLSDQW  100

Query  342  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            V TNV+P+   TKIRYLLVGNEILS P  + W  LVPAMRKIR+S+K  G R
Sbjct  101  VRTNVLPYLPGTKIRYLLVGNEILSLPDKSIWPNLVPAMRKIRKSLKTLGAR  152



>ref|XP_006437250.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
 gb|ESR50490.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
Length=466

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADR-W  341
            P      +I  LKA RVKIYDANPKIL+AL N+D+QVS+MVPNEII NIS         W
Sbjct  41   PQESVELMIKSLKATRVKIYDANPKILKALKNTDIQVSIMVPNEIINNISLSSQSLSDQW  100

Query  342  VETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            V TNV+P+   TKIRYLLVGNEILS P  + W  LVPAMRKIR+S+K  G R
Sbjct  101  VRTNVLPYLPGTKIRYLLVGNEILSLPDKSIWPNLVPAMRKIRKSLKTLGAR  152



>gb|KJB84083.1| hypothetical protein B456_N004800 [Gossypium raimondii]
Length=464

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
               ++LI  + A RVKIYDANP IL AL  +D+QVS+MVPN+ + NIS++Q LAD W+++
Sbjct  42   EKSVKLIQSIGANRVKIYDANPDILNALRGTDLQVSIMVPNQHLTNISTNQKLADSWIQS  101

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSV  479
            NV+PFY + KIRYLLVGNE++S+ P   W+ +VPAMRKI+ ++
Sbjct  102  NVLPFYPKVKIRYLLVGNEVISSSPKEIWYSIVPAMRKIKNAL  144



>ref|XP_003632052.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Vitis 
vinifera]
 emb|CBI39470.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              +QLI GLKA RVK+YD NP+IL AL  +++QVS+MVPN+ I NIS  Q L+D+WV+TN
Sbjct  45   RSVQLIKGLKAGRVKLYDPNPEILEALSGTELQVSIMVPNQQISNISRSQKLSDQWVKTN  104

Query  354  VVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKIRRSVKKF  488
            VVP+Y ET IRY+LVGNE+LS       W  LVPAMR+I+ S++KF
Sbjct  105  VVPYYPETMIRYVLVGNEVLSLYDQKQGWPDLVPAMRRIKGSLRKF  150



>emb|CDO96794.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 89/129 (69%), Gaps = 1/129 (1%)
 Frame = +3

Query  108  AQISQLRSEYATVNWATTFPHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            AQI+Q+   Y  +      P    +QL+  L A +VK+YDANPKIL AL  S + ++VMV
Sbjct  23   AQINQVGVCYGQLGNNLPAPSQ-SVQLLQKLNATQVKLYDANPKILNALIGSKLYITVMV  81

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE+I NISS+Q LA++WV+ NV+P+Y    IRY+LVGNE+LS      WF LVPA+++I
Sbjct  82   PNELIINISSNQTLANQWVQNNVIPYYPRAMIRYILVGNEVLSYYFKPLWFYLVPAVKRI  141

Query  468  RRSVKKFGL  494
             +SVK FGL
Sbjct  142  HQSVKTFGL  150



>ref|XP_009147086.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=501

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L AK VK+YDANP IL AL  +D+ VSVMVPNE+I NI+  + L+D W+++NV+
Sbjct  83   VTLIKSLNAKSVKLYDANPSILAALNATDIVVSVMVPNELIVNITKSKTLSDDWIKSNVL  142

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++
Sbjct  143  PFYPSTKIRYLLVGNEILSSQDSELKSALVPAMRKIQRSLKTLGVK  188



>emb|CDY24629.1| BnaA05g30280D [Brassica napus]
Length=460

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L AK VK+YDANP IL AL  +D+ VSVMVPNE+I NI+  + L+D W+++NV+
Sbjct  42   VTLIKSLNAKSVKLYDANPSILAALNATDIVVSVMVPNELIVNITKSKTLSDDWIKSNVL  101

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY  TKIRYLLVGNEILS+  +     LVPAMRKI+RS+K  G++
Sbjct  102  PFYPSTKIRYLLVGNEILSSQDSELKSALVPAMRKIQRSLKTLGVK  147



>ref|XP_010246533.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  LKA RVK+YDANP IL+AL  +++ VS+MVPN++I NISS Q+LA+ WV TN
Sbjct  41   RSIELIKSLKAGRVKLYDANPDILKALEGTNIHVSIMVPNQLISNISSSQSLANEWVRTN  100

Query  354  VVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            VVPFY +T IRYLLVGNEI    S+    TW+ LV AMR+++ S+K   +R
Sbjct  101  VVPFYPKTLIRYLLVGNEIFSFYSDQDRQTWYDLVQAMRRLKYSLKIHSIR  151



>ref|XP_010247391.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 82/109 (75%), Gaps = 3/109 (3%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++ I  L+A R+K+YDANP+IL AL  +++QVS+MVPN++I NISS QA+AD WV TNV+
Sbjct  43   IEFIKTLEAGRIKLYDANPEILNALAWTNIQVSIMVPNQLISNISSSQAVADEWVRTNVI  102

Query  360  PFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY +T IR+LLVGNEI    S+    TW+ LV AMR+I+ S+  + +R
Sbjct  103  PFYSKTLIRHLLVGNEIFNFYSDEDRQTWYNLVLAMRRIKHSLSTYNIR  151



>ref|XP_010547131.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   122 bits (305),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  L A RVKIYDAN  IL+AL  +D+ VSVMVPNEII N+S  QA +D WV   
Sbjct  40   ESVKLIKSLNATRVKIYDANHSILKALNGTDIAVSVMVPNEIIVNVSKSQAQSDDWVRNK  99

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            ++PFY  TKIRYLLVGNE+LSNP       LV AM KI+ S+K+FG+
Sbjct  100  ILPFYPTTKIRYLLVGNEVLSNPDPALRSGLVSAMCKIKHSLKRFGV  146


 Score = 33.9 bits (76),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +2

Query  107  GADISATVGICYGQLGNNLPTPSRSA  184
            GA  S   G+ YGQLGNNLP+P+ S 
Sbjct  17   GAKFSGRPGVNYGQLGNNLPSPTESV  42



>emb|CDY08004.1| BnaC03g35190D [Brassica napus]
Length=460

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++LI  L AKRVK+YDANP IL AL  +D+ VSVMVPNE+I NIS   +L+D W+ +N++
Sbjct  42   VKLIQSLNAKRVKLYDANPAILAALNATDITVSVMVPNELIVNISKSSSLSDEWIRSNIL  101

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            PF+  TKIRYLLVGNEIL++  +     LVPAMRKI+RS
Sbjct  102  PFHPSTKIRYLLVGNEILTSADSELKSALVPAMRKIQRS  140



>ref|XP_010552026.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  L A RVKIYDA+  IL AL  +D+ VSVMVPNE+I NIS  +  +D WV TN
Sbjct  40   ESVKLIRSLNATRVKIYDADHSILEALNGTDIAVSVMVPNEMIVNISKSRTQSDNWVLTN  99

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            V+PFY  TKI YLLVGNE+LSNP       LVPAMRKI++S+K+ G+
Sbjct  100  VLPFYPTTKILYLLVGNEVLSNPHPELRSGLVPAMRKIKQSLKRLGV  146



>ref|XP_010685101.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=467

 Score =   119 bits (299),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 81/110 (74%), Gaps = 3/110 (3%)
 Frame = +3

Query  177  DLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNV  356
             ++LI  LKA RVK+Y+ +P+IL+AL  +++QVS+MVPNEII NIS++Q +A+ WV  N+
Sbjct  42   SVELIKSLKAGRVKLYNPDPEILKALNGTNIQVSIMVPNEIISNISTNQTMANEWVHKNL  101

Query  357  VPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            V +Y  T IRYLLVGNEILS        TW  LVPAMRK++ ++K  G+R
Sbjct  102  VAYYPHTLIRYLLVGNEILSLMGEADKKTWHDLVPAMRKLQYALKIHGIR  151


 Score = 33.5 bits (75),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +2

Query  107  GADISATVGICYGQLGNNLPTPSRSA  184
             A  S  VG+ YG LGNNLP PS+S 
Sbjct  18   AAAFSPKVGVNYGTLGNNLPKPSKSV  43



>ref|XP_003552101.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    + LI  + AKRVK+YDANP IL AL ++ +QVS+MVPN++I NIS++Q L+D+WV
Sbjct  42   PPRESVSLITSVHAKRVKLYDANPSILHALQDTRLQVSIMVPNDLILNISTNQTLSDQWV  101

Query  345  ETNVVPFYGETKIRYLLVGNEI-LSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
              NVVP++  T IRYLLVGNE+  +     TW  LVPAMR+I+RS+K  G+R
Sbjct  102  SDNVVPYHPRTLIRYLLVGNEVTSTTAATATWPHLVPAMRRIKRSLKSHGIR  153



>emb|CDX74052.1| BnaA03g29950D [Brassica napus]
Length=567

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++LI  L AKRVK+YDANP IL AL  +D+ VSVMVPNE+I NIS    L+D W+ +N++
Sbjct  42   VKLIQSLNAKRVKLYDANPAILAALNATDITVSVMVPNELIVNISKSSTLSDEWIRSNIL  101

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRR  473
            PF+  TKIRYLLVGNEILS+  +     LVPAMRKI+R
Sbjct  102  PFHPTTKIRYLLVGNEILSSADSELKSALVPAMRKIQR  139



>gb|ADE76604.1| unknown [Picea sitchensis]
Length=462

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  +KA RVKIYD NP+IL+AL ++ ++VSVMV NE I N+SS+Q+ A++WV+ NVV
Sbjct  47   IHLIQRMKAGRVKIYDTNPEILKALSHTGIKVSVMVKNEDIANVSSNQSFANKWVKNNVV  106

Query  360  PFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGL  494
             FY  T+I  +LVGNEILS+   N TW+QLVPAM +IRR++ ++ L
Sbjct  107  YFYPATRINIILVGNEILSDYSNNQTWYQLVPAMLRIRRALLRYKL  152



>ref|XP_009134961.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=460

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++LI  L AKRVK+YDANP IL AL  +D+ VSVM PNE++ NIS   +L+D W+ +N++
Sbjct  42   VKLIQSLNAKRVKLYDANPAILAALNATDITVSVMDPNELLVNISKSSSLSDEWITSNIL  101

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            PF+  TKIRYLLVGNEILS+  +     LVPAMRKI+RS
Sbjct  102  PFHPTTKIRYLLVGNEILSSTDSELKSALVPAMRKIQRS  140



>ref|XP_002976500.1| hypothetical protein SELMODRAFT_105435, partial [Selaginella 
moellendorffii]
 gb|EFJ22169.1| hypothetical protein SELMODRAFT_105435, partial [Selaginella 
moellendorffii]
Length=461

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 2/107 (2%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++LI  LK  RVKIYDANP IL AL N+ V+V+VMVPN+ IP+++S Q+ AD WV++NV 
Sbjct  19   VELIRQLKLGRVKIYDANPSILSALANTSVKVTVMVPNQQIPSVASSQSFADEWVKSNVT  78

Query  360  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGL  494
             +Y  T+IR +L+GNEILS+     +TW +LVPAM+ I RS+ K GL
Sbjct  79   AYYPFTRIRTVLIGNEILSDFSIRQSTWPKLVPAMKNIHRSLAKLGL  125



>emb|CDP15106.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            HH + L+  + A RVKIYDANP++L+ L  + +Q S+M+ + +IP+I+SDQ++AD+WV  
Sbjct  46   HHSINLLQSMNASRVKIYDANPEVLKLLSGTKLQASIMIQDGLIPDIASDQSIADQWVRD  105

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVK  482
            NV+ +Y +T IR++LVGNEILS+     W+ LVPAM +I  S+K
Sbjct  106  NVLAYYPQTMIRFVLVGNEILSSNNTLLWYNLVPAMVRIHNSIK  149



>ref|XP_003541516.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=391

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 79/112 (71%), Gaps = 3/112 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            H  ++L+  +KA RVKIYDANP+ILR L N+ ++VS+M+PN  I  I+++Q++AD WV  
Sbjct  38   HRSIELLTTMKAGRVKIYDANPEILRLLSNTKLKVSIMIPNNEISGIAANQSIADEWVRN  97

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            NV+P+Y  T IRYLL+GNE+L   S   +  W  LVPAMR I RS++   +R
Sbjct  98   NVLPYYPNTMIRYLLMGNEVLSYNSEQGHQMWRDLVPAMRSIERSLRAQNIR  149



>ref|XP_002973407.1| hypothetical protein SELMODRAFT_413735 [Selaginella moellendorffii]
 gb|EFJ25781.1| hypothetical protein SELMODRAFT_413735 [Selaginella moellendorffii]
Length=541

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 2/107 (2%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++LI  LK  RVKIYDANP IL AL N+ V+V+VMVPN+ IP+++S Q+ AD WV++NV 
Sbjct  111  VELIRQLKLGRVKIYDANPSILSALANTSVKVTVMVPNQQIPSVASSQSFADEWVKSNVT  170

Query  360  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGL  494
             +Y  T+IR +L+GNEILS+     +TW +LVPAM+ I RS+ K GL
Sbjct  171  AYYPFTRIRTVLIGNEILSDFSIRQSTWPKLVPAMKNIHRSLAKLGL  217



>ref|XP_002462618.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
 gb|EER99139.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
Length=483

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+    A  VKIYDANP +LRAL  +   VS+MVPNEIIP++++  A ADRWV  N+V
Sbjct  55   VELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNEIIPDLAASVAAADRWVAKNLV  114

Query  360  PFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVKKFGL  494
            P+Y  T++++LLVGNEILS+    N+TW +LVPAM  I RS++K G+
Sbjct  115  PYYPATRVKFLLVGNEILSDHSIANSTWPRLVPAMENIHRSLRKRGI  161



>ref|XP_004505110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=462

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 79/112 (71%), Gaps = 3/112 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  ++L+  +KA RVK+YDANP ILR L  + ++VS+M+PN  I  I+++Q++AD WV  
Sbjct  38   YRSIELLTIMKAARVKLYDANPDILRLLSTTKLKVSIMIPNHEISGIAANQSIADEWVRN  97

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            NVVPFY +T IR+LLVGNE+L   S   +  W  LVPAMR I+RS+K   +R
Sbjct  98   NVVPFYPKTMIRFLLVGNEVLSYNSEQGHKMWHDLVPAMRSIKRSLKSLNIR  149



>ref|XP_009373620.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=469

 Score =   113 bits (282),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 76/109 (70%), Gaps = 4/109 (4%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  ++L+  + A RVK+YDA+P+IL+ L  +++QVS+MVPN  I  I+SDQ  AD WV  
Sbjct  38   NRSIELLMAMNAGRVKLYDADPEILKLLSGTNLQVSIMVPNNEISTIASDQIKADEWVRN  97

Query  351  NVVPFYGETKIRYLLVGNEIL----SNPPNTTWFQLVPAMRKIRRSVKK  485
            NV+P+Y ET IRYLL+GNE+L    S+     W+ LVPAM KI+ S+K 
Sbjct  98   NVLPYYPETMIRYLLIGNEVLSYNSSDQDRQMWYDLVPAMSKIKSSLKS  146


 Score = 35.4 bits (80),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  110  ADISATVGICYGQLGNNLPTPSRS  181
            A+IS+ +GI YG+LGNNLP+ +RS
Sbjct  17   AEISSKIGINYGRLGNNLPSANRS  40



>ref|XP_003632055.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6 [Vitis vinifera]
Length=474

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 79/106 (75%), Gaps = 3/106 (3%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  +KA RVK+YDANP+IL  L  + +QVS+MVPN+ I NISS+Q LAD+WV  N
Sbjct  51   QSIELIKSMKAGRVKLYDANPEILNLLSGTKIQVSIMVPNQEISNISSNQTLADQWVRDN  110

Query  354  VVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVK  482
            V+ +Y +T IR+++VGNE+L   S+    TW  LVPAMR+I++S++
Sbjct  111  VLSYYPQTMIRFIVVGNEVLSYYSDRDRETWSNLVPAMRRIKKSLQ  156



>emb|CAN60692.1| hypothetical protein VITISV_007558 [Vitis vinifera]
Length=404

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 79/106 (75%), Gaps = 3/106 (3%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++LI  +KA RVK+YDANP+IL  L  + +QVS+MVPN+ I NISS+Q LAD+WV  N
Sbjct  39   QSIELIKSMKAGRVKLYDANPEILNLLSGTKIQVSIMVPNQEISNISSNQTLADQWVRDN  98

Query  354  VVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVK  482
            V+ +Y +T IR+++VGNE+L   S+    TW  LVPAMR+I++S++
Sbjct  99   VLSYYPQTMIRFIVVGNEVLSYYSDRDRETWSNLVPAMRRIKKSLQ  144



>ref|XP_007134154.1| hypothetical protein PHAVU_010G0238000g, partial [Phaseolus vulgaris]
 gb|ESW06148.1| hypothetical protein PHAVU_010G0238000g, partial [Phaseolus vulgaris]
Length=125

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    ++LI  LKAKRVKIYDAN +IL AL N+ ++VS+M+PNE++ N S++Q  +D+WV
Sbjct  40   PARTSVRLIQSLKAKRVKIYDANAEILEALRNTGIEVSIMLPNELVVNASTNQTFSDQWV  99

Query  345  ETNVVPFYGETKIRYLLVGNEILSN  419
             +NVVPFY +T IRYLLVGNE++S+
Sbjct  100  GSNVVPFYPQTLIRYLLVGNELISS  124



>ref|XP_006830555.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
 gb|ERM97971.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
Length=482

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 75/100 (75%), Gaps = 1/100 (1%)
 Frame = +3

Query  198  LKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  377
            +K  R+KIYD NP+IL AL N+ +QVSVM+PN+ I NIS+ Q  +D WV+TN++PFY  T
Sbjct  58   IKVSRIKIYDTNPQILHALTNTKIQVSVMLPNQAIQNISATQEASDSWVKTNILPFYPLT  117

Query  378  KIRYLLVGNEILSNPP-NTTWFQLVPAMRKIRRSVKKFGL  494
            +IR +LVGNE+LS+     TW  LVPAM+ I+RS++  G+
Sbjct  118  RIRTILVGNEVLSDSSIEPTWTMLVPAMQNIKRSLRALGI  157



>ref|XP_006349905.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=470

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = +3

Query  153  ATTFPHHHD-LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQAL  329
            A   P  +D ++L+  +KA RVKIYDANP+ILR L  +++QVS+MVPN  I  ++++Q+ 
Sbjct  39   ANNLPSPYDSIELLKNMKAGRVKIYDANPEILRLLSGTNLQVSIMVPNNQISIVAANQSA  98

Query  330  ADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKK  485
            A++WV  NV+P+Y  T IRY+LVGNE+LSN  +   W+ L+PAM  IR S+ +
Sbjct  99   ANQWVRDNVLPYYPNTMIRYILVGNEVLSNKDDQGLWYDLIPAMNNIRNSIDQ  151



>ref|XP_010314851.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=463

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 80/113 (71%), Gaps = 2/113 (2%)
 Frame = +3

Query  153  ATTFPHHHD-LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQAL  329
            A   P  +D ++L+  +KA RVKIYDANP+ILR L  +++QVS+MVPN  I  ++++Q  
Sbjct  33   ANNLPSPYDSIELLKNMKAGRVKIYDANPEILRLLSGTNLQVSIMVPNNQISVVAANQTA  92

Query  330  ADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKK  485
            A++WV  NV+P+Y  T IRY+LVGNE+LSN  +   W+ L+PAM  IR S+ +
Sbjct  93   ANQWVRDNVLPYYPNTMIRYILVGNEVLSNKDDQGLWYDLIPAMNNIRNSIDQ  145



>ref|XP_008380636.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=469

 Score =   109 bits (272),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 74/109 (68%), Gaps = 4/109 (4%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  ++L+  + A RVK+YDA+ +IL+ L  +++QVS+MVPN  I  I SDQ  AD WV  
Sbjct  38   NRSIELLKAMNAGRVKLYDADLEILKLLSGTNLQVSIMVPNNEISTIXSDQTKADEWVRN  97

Query  351  NVVPFYGETKIRYLLVGNEIL----SNPPNTTWFQLVPAMRKIRRSVKK  485
            NV+P+Y ET IRYLL+GNE+L    S+     W+ LVPAM KI+ S+K 
Sbjct  98   NVLPYYPETMIRYLLIGNEVLSYNSSDQDRQMWYDLVPAMSKIKSSLKS  146


 Score = 35.4 bits (80),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  110  ADISATVGICYGQLGNNLPTPSRS  181
            A+IS+ +GI YG+LGNNLP+ +RS
Sbjct  17   AEISSKIGINYGRLGNNLPSANRS  40



>ref|XP_009385472.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009385473.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 75/108 (69%), Gaps = 2/108 (2%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + L+H + A  VKIYDANP ILRAL  +  +VS+MVPNEIIP++  + + AD WV TN+ 
Sbjct  48   VHLLHSIGAGAVKIYDANPAILRALAGTRFRVSIMVPNEIIPSLGVNASAADAWVGTNLG  107

Query  360  PFYGETKIRYLLVGNEILS--NPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY   ++RYLLVGNEILS  +  N+TW  LVPAM  I R++    +R
Sbjct  108  PFYPAVRVRYLLVGNEILSYTSLANSTWPFLVPAMVNIHRALSARSIR  155



>ref|XP_004298215.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Fragaria 
vesca subsp. vesca]
Length=380

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  ++LI  +K  RVK+YDANP+ILR L  +++ VS+MVPN  I  I+SDQ+ AD W+  
Sbjct  39   NRSVELIKSMKIGRVKLYDANPEILRLLSGTNISVSIMVPNNEITGIASDQSKADEWIRN  98

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVK  482
            NV+P+Y ET IRYLLVGNEIL   S+     W  +VPAM KI+ S++
Sbjct  99   NVLPYYPETMIRYLLVGNEILSYFSDQDRRLWHDVVPAMTKIKHSLR  145



>ref|XP_008222761.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=477

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 75/108 (69%), Gaps = 4/108 (4%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  ++LI  + A RVK+YDANP+IL  L  +++QVS+MVPN  I  I+S+QA AD WV  
Sbjct  47   NSSIELIKSMNAGRVKLYDANPEILNLLSGTNLQVSIMVPNSEISIIASNQAKADEWVRN  106

Query  351  NVVPFYGETKIRYLLVGNEIL----SNPPNTTWFQLVPAMRKIRRSVK  482
            NV+P+Y +T IRYLLVGNE+L    S+     W  LVPAM KI+ S+K
Sbjct  107  NVLPYYPQTMIRYLLVGNEVLSYNSSDQDRQMWLDLVPAMTKIKSSLK  154



>gb|KHN47213.1| Putative glucan endo-1,3-beta-glucosidase A6 [Glycine soja]
Length=345

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = +3

Query  198  LKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  377
            +KA RVKIYDANP+ILR L N+ ++VS+M+PN  I  I+++Q++AD WV  NV+P+Y  T
Sbjct  1    MKAGRVKIYDANPEILRLLSNTKLKVSIMIPNNEISGIAANQSIADEWVRNNVLPYYPNT  60

Query  378  KIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
             IRYLL+GNE+L   S   +  W  LVPAMR I RS++   +R
Sbjct  61   MIRYLLMGNEVLSYNSEQGHQMWRDLVPAMRSIERSLRAQNIR  103



>ref|XP_009411847.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=455

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 74/103 (72%), Gaps = 2/103 (2%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + L+  L A  VKIYDANP IL AL  + ++VS+MVPNEI+P++ ++ +LAD WV  N+ 
Sbjct  29   VALLQSLGAGAVKIYDANPAILCALAGTGLRVSIMVPNEIVPSLGANASLADAWVADNLA  88

Query  360  PFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVK  482
            PFY   ++RY+LVGNEILS+    N+TW  LVPAM  I R+++
Sbjct  89   PFYPAVRVRYVLVGNEILSDASLANSTWPFLVPAMANIHRALR  131



>ref|XP_006830552.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
 gb|ERM97968.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
Length=464

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  198  LKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  377
            LK  RVK+Y+  P IL+AL N+++QV++MVPN+ IPNIS  Q ++D WV+ N++PFY +T
Sbjct  51   LKVPRVKLYEPRPDILQALSNTNIQVTIMVPNQAIPNISLSQNVSDSWVKINLLPFYPKT  110

Query  378  KIRYLLVGNEILSNPP-NTTWFQLVPAMRKIRRSVKKF  488
            +I+ LLVGNE+LS+P   TTW  LVPAMR ++ S++  
Sbjct  111  RIQTLLVGNEVLSDPSIKTTWSMLVPAMRNLKYSLRAL  148



>ref|XP_009625838.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Nicotiana tomentosiformis]
Length=470

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  ++LI  +KA +VK+YDANP+ILR L  +++ VS+MVPN+ I  ++++Q++A++WV  
Sbjct  47   YESIELIKTMKAGKVKLYDANPEILRLLSGTNLHVSIMVPNDQISIVAANQSVANQWVRD  106

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSV  479
            NV+ +Y  T IRY+LVGNE+LSN  + + W+ LVPAMR I++S+
Sbjct  107  NVLSYYPNTMIRYILVGNEVLSNKDDQSLWYDLVPAMRNIKKSI  150



>ref|XP_009411846.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=469

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 74/103 (72%), Gaps = 2/103 (2%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + L+  L A  VKIYDANP IL AL  + ++VS+MVPNEI+P++ ++ +LAD WV  N+ 
Sbjct  43   VALLQSLGAGAVKIYDANPAILCALAGTGLRVSIMVPNEIVPSLGANASLADAWVADNLA  102

Query  360  PFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVK  482
            PFY   ++RY+LVGNEILS+    N+TW  LVPAM  I R+++
Sbjct  103  PFYPAVRVRYVLVGNEILSDASLANSTWPFLVPAMANIHRALR  145



>ref|XP_009625839.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Nicotiana tomentosiformis]
Length=440

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  ++LI  +KA +VK+YDANP+ILR L  +++ VS+MVPN+ I  ++++Q++A++WV  
Sbjct  17   YESIELIKTMKAGKVKLYDANPEILRLLSGTNLHVSIMVPNDQISIVAANQSVANQWVRD  76

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSV  479
            NV+ +Y  T IRY+LVGNE+LSN  + + W+ LVPAMR I++S+
Sbjct  77   NVLSYYPNTMIRYILVGNEVLSNKDDQSLWYDLVPAMRNIKKSI  120



>ref|XP_007153895.1| hypothetical protein PHAVU_003G073900g [Phaseolus vulgaris]
 gb|ESW25889.1| hypothetical protein PHAVU_003G073900g [Phaseolus vulgaris]
Length=368

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 77/112 (69%), Gaps = 3/112 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
               ++L+  +KA  VK+YDANP+ILR L  + ++VS+M+PN  I  I+++Q++AD WV  
Sbjct  38   QRSIELLTSMKAGLVKLYDANPEILRLLSTTKLKVSIMIPNNEIAGIATNQSMADEWVRN  97

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            NV+P+Y +T IRYLLVGNE+L   S   +  W  LVPAMR I RS+K   +R
Sbjct  98   NVLPYYPKTLIRYLLVGNEVLSYNSEQGHQMWNDLVPAMRNIERSLKGQNIR  149



>ref|XP_010488453.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN+ I +I +DQA AD W+ T
Sbjct  52   YQSINLIKSLKAGHVKLYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQATADNWIAT  111

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+PFY +T+IR++LVGNEIL   S+     W  LVPAMRK+  S++  G+
Sbjct  112  NVLPFYPQTRIRFVLVGNEILSYSSDQDKQIWANLVPAMRKVVNSLRARGI  162



>ref|XP_004957267.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=483

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+    A  VKIYDANP +LRAL  +   VS+MVPN+IIP+I++  A ADRWV  N+V
Sbjct  56   VELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNQIIPDIAASAAAADRWVAENLV  115

Query  360  PFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRRSVKKFGL  494
            P+Y  T++++LLVGNEILS+    N+TW +LVPAM  I  S++K G+
Sbjct  116  PYYPATRVKFLLVGNEILSDYSIANSTWLRLVPAMENIHLSLRKRGI  162



>ref|XP_006299757.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
 gb|EOA32655.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
Length=476

 Score =   110 bits (274),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  +KA  VK+YDA+P+ L+ L  +++ V++MVPN+ I ++ SDQA AD+WV T
Sbjct  52   YQSINLIKTIKAGHVKLYDADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADKWVAT  111

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+PFY +T+IR++LVGNE+L   S+     W  LVPAMRK+  S++  G+
Sbjct  112  NVLPFYPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGI  162


 Score = 31.2 bits (69),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  116  ISATVGICYGQLGNNLPTPSRS  181
            +++ +GI YG+LGNNLP+P +S
Sbjct  33   LASRIGINYGKLGNNLPSPYQS  54



>ref|XP_010466734.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=474

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN+ I +I +DQA AD WV T
Sbjct  52   YQSINLIKSLKAGHVKLYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQATADNWVAT  111

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+PFY +T+IR++LVGNEIL   S+     W  LVPAMRK+  S++  G+
Sbjct  112  NVLPFYPQTRIRFVLVGNEILSYSSDQDKQIWANLVPAMRKVVNSLRVRGI  162



>ref|XP_010023613.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW59922.1| hypothetical protein EUGRSUZ_H02646 [Eucalyptus grandis]
Length=440

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 81/114 (71%), Gaps = 8/114 (7%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++ I  ++A+RVK+YDA+P+IL+ L  + VQVS+MV N+ IP ++S QALAD+WV  N
Sbjct  17   QSVERIQLMRARRVKLYDADPEILKLLSRTQVQVSIMVQNQEIPGVASSQALADKWVRNN  76

Query  354  VVPFYGETKIRYLLVGNEILSNPPNTT------WFQLVPAMRKIRRSVKKFGLR  497
            V+P+Y  T IR++LVGNE+LS   N+T      W  LVPAMR+I+ S++   +R
Sbjct  77   VLPYYPRTMIRFILVGNEVLSY--NSTDRDRQLWGDLVPAMRRIKSSLRSNRIR  128



>ref|XP_007221306.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
 gb|EMJ22505.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
Length=452

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 73/108 (68%), Gaps = 4/108 (4%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  ++ I  + A RVK+YDANP+IL  L  +++QVS+MVPN  I  I+S+QA AD WV  
Sbjct  22   NSSVEFIKSMNAGRVKLYDANPEILNLLSGTNLQVSIMVPNNEISTIASNQAKADEWVRN  81

Query  351  NVVPFYGETKIRYLLVGNEIL----SNPPNTTWFQLVPAMRKIRRSVK  482
            NV+P+Y +T IRYLLVGNE+L    S+     W  LVPAM K + S+K
Sbjct  82   NVLPYYPQTMIRYLLVGNEVLSYNSSDQDRQMWLDLVPAMTKFKSSLK  129



>ref|XP_009383833.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=476

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              + L+  + A  VKIYDANP ILRAL  + ++VS+MVPNEIIP++ ++ +LAD WV   
Sbjct  48   RSVALLRSIGAGAVKIYDANPAILRALAGTRLRVSIMVPNEIIPSLGTNASLADAWVAAY  107

Query  354  VVPFYGETKIRYLLVGNEILS--NPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            + PFY   ++RYLLVGNEILS  +  N+TW  LVPAM  I RS+    +R
Sbjct  108  LTPFYPAVRVRYLLVGNEILSYTSLANSTWPFLVPAMVNIHRSLIARSIR  157



>ref|XP_009383834.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=475

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              + L+  + A  VKIYDANP ILRAL  + ++VS+MVPNEIIP++ ++ +LAD WV   
Sbjct  47   RSVALLRSIGAGAVKIYDANPAILRALAGTRLRVSIMVPNEIIPSLGTNASLADAWVAAY  106

Query  354  VVPFYGETKIRYLLVGNEILS--NPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            + PFY   ++RYLLVGNEILS  +  N+TW  LVPAM  I RS+    +R
Sbjct  107  LTPFYPAVRVRYLLVGNEILSYTSLANSTWPFLVPAMVNIHRSLIARSIR  156



>gb|EEC84834.1| hypothetical protein OsI_31928 [Oryza sativa Indica Group]
Length=477

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 87/137 (64%), Gaps = 6/137 (4%)
 Frame = +3

Query  93   CHLFPAQISQLRSEYATVNWATTF----PHHHDLQLIHGLKAKRVKIYDANPKILRALGN  260
            CH+     S   +    VN+        P    ++L+  + A  VKIYDAN  +LRAL  
Sbjct  16   CHVVAQGRSTAAAHGIGVNYGRVADDIPPPARSVELLRAVGAGSVKIYDANSSVLRALAG  75

Query  261  SDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTT  434
            + ++VS+MVPNEIIP +++  A ADRWV  N+VP+Y ET+++YLLVGNE+LS+    N+T
Sbjct  76   TRMRVSIMVPNEIIPGLAASAAAADRWVAENLVPYYPETRVKYLLVGNELLSDYSIANST  135

Query  435  WFQLVPAMRKIRRSVKK  485
            W ++VPAM  +  S+++
Sbjct  136  WPRIVPAMENLHVSLRR  152



>gb|KCW48409.1| hypothetical protein EUGRSUZ_K02112 [Eucalyptus grandis]
Length=418

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +3

Query  198  LKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  377
            L +K VK+YDANP+IL AL N+ ++V  MVPNE+I NIS+DQAL+D WV +N++PFY +T
Sbjct  49   LSSKSVKLYDANPQILLALRNTGLEVCAMVPNELIANISADQALSDHWVGSNIIPFYPDT  108

Query  378  KIRYLLVGNEILSNPPN  428
            KIR+LLVGNEILS+P N
Sbjct  109  KIRHLLVGNEILSDPGN  125



>gb|KEH30957.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=462

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  ++L+  +KA RVK+YDANP ILR L  + ++VS+M+PN  I  I+++Q++AD WV  
Sbjct  38   YRSIELLTTMKAGRVKLYDANPDILRLLSTTKLKVSIMIPNHEISGIAANQSIADEWVRN  97

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            N++P+Y  T  RYLLVGNE+L   S   +  W  LVPAMR I+R++    +R
Sbjct  98   NILPYYPNTLFRYLLVGNEVLSYNSEQGHKMWHDLVPAMRSIKRALNSQNIR  149



>ref|XP_009777293.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=470

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = +3

Query  168  HHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVE  347
             +  ++ +  +KA RVK+YDANP+ILR L  +++ VS+MVPN+ I  ++++Q+ A++WV 
Sbjct  46   QYESIEHMKNMKAGRVKLYDANPEILRLLSGTNLHVSIMVPNDQISIVAANQSAANQWVR  105

Query  348  TNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKK  485
             NV+ +Y  T IRY+LVGNE+LSN  + + W+ LVPAMR I++S+ +
Sbjct  106  DNVLSYYPNTMIRYILVGNEVLSNKDDQSLWYDLVPAMRNIKKSIDE  152



>ref|XP_008792940.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Phoenix dactylifera]
Length=467

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 79/109 (72%), Gaps = 1/109 (1%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              +  +  L+A  VKIYDANP ILRAL  + ++VS+MVPN++ P+++++++LAD W+  N
Sbjct  43   RSIGFLQSLRAGAVKIYDANPAILRALAGTRLRVSIMVPNQVFPSLAANRSLADAWLAAN  102

Query  354  VVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGLR  497
            ++PFY + +IR+LLVGNE+LS+    ++W  LVPAM  + R+++   +R
Sbjct  103  LLPFYPQARIRFLLVGNEVLSDYSVKSSWPSLVPAMANLHRALRARSIR  151



>ref|XP_008792939.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Phoenix dactylifera]
Length=470

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 79/109 (72%), Gaps = 1/109 (1%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              +  +  L+A  VKIYDANP ILRAL  + ++VS+MVPN++ P+++++++LAD W+  N
Sbjct  46   RSIGFLQSLRAGAVKIYDANPAILRALAGTRLRVSIMVPNQVFPSLAANRSLADAWLAAN  105

Query  354  VVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKKFGLR  497
            ++PFY + +IR+LLVGNE+LS+    ++W  LVPAM  + R+++   +R
Sbjct  106  LLPFYPQARIRFLLVGNEVLSDYSVKSSWPSLVPAMANLHRALRARSIR  154



>ref|NP_001149815.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 gb|ACG36890.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 tpg|DAA62204.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=479

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 76/104 (73%), Gaps = 2/104 (2%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+    A  VKIYDANP +LRAL  +   VS+MVPN+IIP++++  A ADRWV  N+V
Sbjct  51   VELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNQIIPDLAASAAAADRWVAENLV  110

Query  360  PFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVKK  485
            P+Y  T++++LLVGNEILS+    N+TW  LVPAM  I RS++K
Sbjct  111  PYYPATRVKFLLVGNEILSDLSIANSTWPHLVPAMENIHRSLRK  154



>ref|NP_001063586.1| Os09g0502200 [Oryza sativa Japonica Group]
 dbj|BAF25500.1| Os09g0502200 [Oryza sativa Japonica Group]
 gb|EEE69998.1| hypothetical protein OsJ_29910 [Oryza sativa Japonica Group]
Length=480

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    ++L+  + A  VKIYDAN  +LRAL  + ++VS+MVPNEIIP +++  A ADRWV
Sbjct  47   PPARSVELLRAVGAGSVKIYDANSSVLRALAGTRMRVSIMVPNEIIPGLAASAAAADRWV  106

Query  345  ETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRRSVKK  485
              N+VP+Y ET+++YLLVGNE+LS+    N+TW ++VPAM  +  S+++
Sbjct  107  AENLVPYYPETRVKYLLVGNELLSDYSIANSTWPRIVPAMENLHVSLRR  155



>ref|XP_002520622.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF41758.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=463

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 75/112 (67%), Gaps = 3/112 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +Q++  +   RVK+YDANP+ILR L  + +QVSVMVPN  I NI+S+Q +A  WV  
Sbjct  43   YRSIQILQSMNTGRVKLYDANPEILRLLAGTKIQVSVMVPNNEINNIASNQTIAHNWVRE  102

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            NV+ +Y  T IR++LVGNEIL   S+     W  LVPAMRKI+ S++   ++
Sbjct  103  NVLQYYPNTMIRFILVGNEILSYSSDQDKKIWSNLVPAMRKIKNSLRSHNIQ  154



>ref|XP_006661404.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6-like [Oryza brachyantha]
Length=521

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 78/109 (72%), Gaps = 2/109 (2%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    ++L+  + A  VKIYD N  +LRAL  + ++VS+MVPNEIIP +++  A ADRWV
Sbjct  95   PPRRSVELLRAVGAGSVKIYDGNSSVLRALAGTGMRVSIMVPNEIIPGLAASAAAADRWV  154

Query  345  ETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRRSVKK  485
              N+VP+Y ET+++YLLVGNE+LS+    N+TW ++VPAM  +  S+++
Sbjct  155  AENLVPYYPETRVKYLLVGNELLSDYSIANSTWPRIVPAMENLHASLRR  203



>dbj|BAJ88052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 75/106 (71%), Gaps = 2/106 (2%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
               +QL+    A  VKIYDANP +LRAL  + + VS+MVPN++IP++++  A ADRWV  
Sbjct  58   RRSVQLLRAAGAGSVKIYDANPAVLRALAGTGMAVSIMVPNQVIPDLAASYAAADRWVAA  117

Query  351  NVVPFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVK  482
            N++P+   T++++LLVGNE+LS+     +TW ++VPAM  + RS++
Sbjct  118  NLLPYLPRTRVKFLLVGNEVLSDGSIAASTWPRIVPAMENLHRSLR  163



>ref|XP_002883459.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59718.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLIKTLKAGHVKLYDADPETLKLLSKTNLYVTIMVPNNQIISIGADQAAADNWVAT  111

Query  351  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+P+Y +T+IR++LVGNEILS   +     W  LVPAMRK+  S++  G+
Sbjct  112  NVLPYYPQTRIRFVLVGNEILSYNTDQDKQIWANLVPAMRKVVNSLRARGI  162



>ref|XP_010238330.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=477

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QL+    A  VKIYDANP +LRAL  + + VS+MVPNEIIP++++  A AD WV  N++
Sbjct  53   VQLLRAAGAGSVKIYDANPAVLRALAGTRIPVSIMVPNEIIPDLAASAAKADEWVVQNLL  112

Query  360  PFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVK  482
            P+  +T++++LLVGNE+LS+     +TW ++VPAM  + RS++
Sbjct  113  PYLAKTRVKFLLVGNEVLSDRSIATSTWPRIVPAMENLHRSLR  155



>ref|XP_010512882.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN+ I +I +DQA AD W+ T
Sbjct  52   YQSINLIKSLKAGHVKLYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQATADNWIAT  111

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+PF  +T+IR++LVGNEIL   S+     W  LVPAMRK+  S++  G+
Sbjct  112  NVLPFSPQTRIRFVLVGNEILSYSSDQDKQIWANLVPAMRKVVNSLRARGI  162



>gb|KDP32593.1| hypothetical protein JCGZ_13143 [Jatropha curcas]
Length=479

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 75/108 (69%), Gaps = 4/108 (4%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +Q++  + A RVK+Y+A+P+ILR L  S +QVS+MVPN+ I  I+SDQ LA++WV  
Sbjct  56   YQSIQILKSINASRVKLYNADPEILRLLAGSKIQVSIMVPNQEIIRIASDQTLANQWVRQ  115

Query  351  NVVPFYGETKIRYLLVGNEILSN----PPNTTWFQLVPAMRKIRRSVK  482
            NV+ +Y  T IR++LVGNEI S+      N  W  LVPAMR I+ S+K
Sbjct  116  NVLQYYPNTMIRFILVGNEIFSSVSVQEQNYVWPNLVPAMRNIKNSLK  163



>ref|XP_011101604.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=468

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 80/124 (65%), Gaps = 4/124 (3%)
 Frame = +3

Query  123  LRSEYATVNWA---TTFPH-HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            L SE   +N+       P  +  + L++ ++A  VK+YDANP++L+ L  +D+ VS+MV 
Sbjct  26   LSSEKIGINYGRLGNNLPSPYQTITLLNSMEAGHVKLYDANPEVLKLLSGTDLHVSIMVT  85

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
            NE I  I+++Q+ AD WV+ NVV +Y  TKIR++LVGNE+ S      W  LVPAMR I+
Sbjct  86   NEQISGIAANQSKADLWVQENVVAYYPSTKIRFVLVGNEVFSYNDLKMWHDLVPAMRNIK  145

Query  471  RSVK  482
            RS+ 
Sbjct  146  RSLS  149



>ref|NP_189019.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB01853.1| beta-1,3-glucanase [Arabidopsis thaliana]
 gb|ABE65959.1| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
 gb|AEE76811.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=476

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 85/132 (64%), Gaps = 4/132 (3%)
 Frame = +3

Query  108  AQISQLRSEYATVNWATTFPHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A  S++   Y  +     FP+   + LI  +KA  VK+YDA+P+ L+ L  +++ V++MV
Sbjct  32   ALASRIGINYGKLGNNLPFPYQ-SINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMV  90

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAM  458
            PN  I +I +DQA AD WV TNV+PF+ +T+IR++LVGNE+L   S+     W  LVPAM
Sbjct  91   PNNQIISIGADQAAADNWVATNVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAM  150

Query  459  RKIRRSVKKFGL  494
            RK+  S++  G+
Sbjct  151  RKVVNSLRARGI  162



>gb|ABK28569.1| unknown [Arabidopsis thaliana]
Length=477

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 85/132 (64%), Gaps = 4/132 (3%)
 Frame = +3

Query  108  AQISQLRSEYATVNWATTFPHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A  S++   Y  +     FP+   + LI  +KA  VK+YDA+P+ L+ L  +++ V++MV
Sbjct  32   ALASRIGINYGKLGNNLPFPYQ-SINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMV  90

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAM  458
            PN  I +I +DQA AD WV TNV+PF+ +T+IR++LVGNE+L   S+     W  LVPAM
Sbjct  91   PNNQIISIGADQAAADNWVATNVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAM  150

Query  459  RKIRRSVKKFGL  494
            RK+  S++  G+
Sbjct  151  RKVVNSLRARGI  162



>ref|XP_010264204.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=339

 Score =   102 bits (254),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 72/107 (67%), Gaps = 5/107 (5%)
 Frame = +3

Query  186  LIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPF  365
            LI  LKA  VK   ANP IL AL  +++QVS+MVPN++I NISS Q+LA+ WV TN VPF
Sbjct  38   LIKSLKAGHVK--HANPDILNALEGTNIQVSIMVPNQLISNISSSQSLANEWVRTNNVPF  95

Query  366  YGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            Y +T   YLLVGNEI    SN    TW+ LV AM +++ S+K   +R
Sbjct  96   YPKTLTHYLLVGNEIFSFSSNQDRQTWYGLVQAMSRLKYSLKIHNIR  142


 Score = 34.7 bits (78),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +2

Query  107  GADISATVGICYGQLGNNLPTPSRSAA  187
             A+IS  +G+  GQLGNNLP+PSRS  
Sbjct  11   NAEISRKMGVNCGQLGNNLPSPSRSIV  37



>ref|XP_006418839.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
 gb|ESQ37275.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
Length=474

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN  I ++ SD+A AD WV T
Sbjct  50   YQSINLIKSLKAGHVKLYDADPETLKLLSQTNLYVTIMVPNNQIISVGSDKAAADNWVNT  109

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+P++ +T+IR++LVGNEIL   S+     W  LVPAMRKI  S++  G+
Sbjct  110  NVLPYHPQTRIRFVLVGNEILSYSSDQDKQIWSNLVPAMRKIVNSLRARGI  160



>gb|KFK39673.1| a6 anther-specific protein [Arabis alpina]
Length=474

 Score =   105 bits (261),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 76/111 (68%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  +KA  VK+YDA+P+ L  L  +++ V++MVPN+ I +I SDQ+ AD WV T
Sbjct  50   YQSINLIKSIKAGHVKLYDADPETLMLLAQTNLYVTIMVPNDHIISIGSDQSAADNWVAT  109

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            +V+P+Y  T+IR++LVGNEIL   S+     W  LVPAMRKI  S++  G+
Sbjct  110  SVIPYYPATRIRFVLVGNEILSYSSDQDKQIWTNLVPAMRKIVNSLRARGI  160


 Score = 31.2 bits (69),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  116  ISATVGICYGQLGNNLPTPSRS  181
            +++ +GI YG+LGNNLP+P +S
Sbjct  31   LASRIGINYGKLGNNLPSPYQS  52



>ref|XP_002444717.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
 gb|EES14212.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
Length=484

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 81/141 (57%), Gaps = 8/141 (6%)
 Frame = +3

Query  93   CHLFPAQISQLRS---EYATVNWATTFPH-HHDLQLIHGLKAKRVKIYDANPKILRALGN  260
            CH   A  +  R     Y TV  A   P     +QL+    A  VKIYDAN  ILRAL  
Sbjct  35   CHCHGANGNGCRGLGINYGTV--ADDLPSASRSVQLLRATGAGAVKIYDANADILRALAG  92

Query  261  SDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP--PNTT  434
            + + VS+MVPN  IP+++S +A A+ WV  N+ P    T++ YLLVGNE+LSN     +T
Sbjct  93   TGMPVSIMVPNSAIPSLASSRAAAEDWVAANLAPHIPATRVAYLLVGNEVLSNRAIAGST  152

Query  435  WFQLVPAMRKIRRSVKKFGLR  497
            W  +VPAM  + R+++  G+R
Sbjct  153  WRSVVPAMANLHRALRAHGIR  173



>dbj|BAK04571.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   106 bits (265),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/103 (47%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QL+    A  VKIYDANP +LRAL  + + VS+MVPN++IP++++  A ADRWV  N++
Sbjct  109  VQLLRAAGAGSVKIYDANPAVLRALAGTGMAVSIMVPNQVIPDLAASYAAADRWVAANLL  168

Query  360  PFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSVK  482
            P+   T++++LLVGNE+LS+     +TW ++VPAM  + RS++
Sbjct  169  PYLPRTRVKFLLVGNEVLSDGSIAASTWPRIVPAMENLHRSLR  211



>gb|EYU31523.1| hypothetical protein MIMGU_mgv1a005774mg [Erythranthe guttata]
Length=426

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QL+  +KA  VK+YDA+P++L+ L ++D+ V++MV N+ I  I+S+++ AD W++ NV+
Sbjct  52   IQLLLSMKAGHVKLYDADPEVLKLLSDTDLHVTIMVTNQEISMIASNESHADAWIDDNVL  111

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKK  485
              Y  TKIR++LVGNE+ S      W  LVPAMR+I+RS+ K
Sbjct  112  AHYPSTKIRFILVGNEVFSYNDRQLWLDLVPAMRRIKRSLNK  153



>ref|XP_008439043.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=467

 Score =   101 bits (251),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P +  +++++ +K  RVK+YDAN +IL  L  +  QVS+M+PN  I +I+++Q  AD+W+
Sbjct  41   PPNLAIEMMNSMKVGRVKLYDANHEILGNLSKTKFQVSIMIPNNEISDIANNQTRADQWI  100

Query  345  ETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
              NV+PFY +T IR++LVGNE+L   S+     W  LVPAMR+I  S+K   L+
Sbjct  101  SNNVLPFYPQTMIRFILVGNEVLSFDSDKDRQVWNDLVPAMRRIWSSLKANNLQ  154


 Score = 34.7 bits (78),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  110  ADISATVGICYGQLGNNLPTPS  175
            A+IS+ +G+ YGQLGNNLP P+
Sbjct  22   AEISSKIGVNYGQLGNNLPPPN  43



>gb|EYU31522.1| hypothetical protein MIMGU_mgv1a005774mg [Erythranthe guttata]
Length=471

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QL+  +KA  VK+YDA+P++L+ L ++D+ V++MV N+ I  I+S+++ AD W++ NV+
Sbjct  52   IQLLLSMKAGHVKLYDADPEVLKLLSDTDLHVTIMVTNQEISMIASNESHADAWIDDNVL  111

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKK  485
              Y  TKIR++LVGNE+ S      W  LVPAMR+I+RS+ K
Sbjct  112  AHYPSTKIRFILVGNEVFSYNDRQLWLDLVPAMRRIKRSLNK  153



>gb|AAM64490.1| beta-1,3-glucanase, putative [Arabidopsis thaliana]
Length=476

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  +KA  VK+YDA+P+ L+ L  +++ V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMVPNNQIISIGADQAAADNWVAT  111

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+PF+ +T+IR++LVGNE+L   S+     W  LVPAMRK+  S++  G+
Sbjct  112  NVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGI  162



>ref|XP_007199923.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
 gb|EMJ01122.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
Length=387

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  279  VMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAM  458
            +MVPNE+I NISS+Q LAD+WV  NVVPFY ET IRYLLVGNEILS P  T WF LVPAM
Sbjct  1    MMVPNELINNISSNQTLADQWVHANVVPFYPETLIRYLLVGNEILSQPDKTIWFNLVPAM  60

Query  459  RKIRRSVKKFGL  494
            RKI+ ++K  G+
Sbjct  61   RKIKAALKTHGI  72



>ref|XP_009135862.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  + A  VK+YDA+P+ L  L  +++ V++MVPN  I  I +DQA AD WV T
Sbjct  56   YQSINLIKSINAGHVKLYDADPETLMVLSQTNLYVTIMVPNNHIIPIGADQAAADNWVNT  115

Query  351  NVVPFYGETKIRYLLVGNEILSNPPN---TTWFQLVPAMRKIRRSVKKFGL  494
            NV+  Y +TKIR++LVGNEILSN  +    TW  LVPAMRKI  S++  G+
Sbjct  116  NVLAHYPQTKIRFVLVGNEILSNNSDQDKQTWSSLVPAMRKIVTSLRARGI  166



>emb|CDY53213.1| BnaC03g74070D [Brassica napus]
Length=480

 Score =   103 bits (257),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  + A  VK+YDA+P+ L  L  +++ V++MVPN  I  I +DQA AD WV T
Sbjct  56   YQSINLIKSINAGHVKLYDADPETLMVLSQTNLYVTIMVPNNQIIPIGADQAAADNWVNT  115

Query  351  NVVPFYGETKIRYLLVGNEILSNPPN---TTWFQLVPAMRKIRRSVKKFGL  494
            NV+  Y +T+IR++LVGNEILSN  +    TW  LVPAMRKI  S++  G+
Sbjct  116  NVLAHYPQTRIRFVLVGNEILSNNSDQDKQTWSSLVPAMRKIITSLRARGI  166


 Score = 30.8 bits (68),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  116  ISATVGICYGQLGNNLPTPSRS  181
            +++ +GI YG+LGNNLP+P +S
Sbjct  37   LASRIGINYGRLGNNLPSPYQS  58



>gb|KJB28087.1| hypothetical protein B456_005G026800 [Gossypium raimondii]
Length=462

 Score = 99.8 bits (247),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  ++ +  + A R+K+YD++P+IL+ L  +++ VSVMV N  I  I+S QA+A++WV+ 
Sbjct  41   YQTIETVKSMNAGRIKLYDSDPEILKLLSGTNIHVSVMVQNNDIIRIASSQAVAEQWVQD  100

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            NV+ +Y +T IR++LVGNE+LS+     W  LV AMR+I+ S+    ++
Sbjct  101  NVLAYYPDTMIRFVLVGNEVLSHQDRRIWLSLVSAMRRIKNSLNTHDIK  149


 Score = 34.3 bits (77),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  110  ADISATVGICYGQLGNNLPTPSRS  181
            A+IS+ +GI YG++GNNLP+P ++
Sbjct  20   AEISSKIGINYGRIGNNLPSPYQT  43



>ref|XP_010532729.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=480

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  +KA  VK+YDA+P+ L  L  +++ V++MVPN  + +I SDQ  AD WV+T
Sbjct  56   YQSINLIKSVKAGHVKLYDADPETLTLLSQTNLYVTIMVPNHQVISIGSDQTAADNWVKT  115

Query  351  NVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            NV+P+Y +T IR++LVGNE+LS   +     W  LVPAMRK+  S++  G+R
Sbjct  116  NVLPYYPQTLIRFVLVGNEVLSYSTDQDREVWRNLVPAMRKLVNSLRAQGIR  167



>gb|KJB10880.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=386

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  282  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  461
            MVPNEII NIS+ Q LAD WVETNVVPFY  TKIRYLLVGNE++S  P   W  +VPAMR
Sbjct  1    MVPNEIINNISTSQKLADSWVETNVVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMR  60

Query  462  KIRRSVKKFGL  494
            KI++S+K  GL
Sbjct  61   KIKKSLKTHGL  71



>ref|XP_002971665.1| hypothetical protein SELMODRAFT_231791 [Selaginella moellendorffii]
 gb|EFJ27414.1| hypothetical protein SELMODRAFT_231791 [Selaginella moellendorffii]
Length=449

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L   R KI+ A+  I+RA  NS V++SVMV N+ IP I+S Q+ AD WVE NV 
Sbjct  19   VGLIKDLGFDRAKIFSADSSIIRAFANSGVKLSVMVANQQIPEIASSQSSADAWVEKNVA  78

Query  360  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGL  494
             +Y +T I  +LVGNEILS+     +TW +LVPAM KI+ +V+KF L
Sbjct  79   AYYPKTAIESVLVGNEILSDSSIRESTWPKLVPAMEKIQSAVEKFEL  125



>ref|XP_006373100.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
 gb|ERP50897.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
Length=466

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++ +  +KA  VK+YDANP+ILR L  +D++VS+MVPN  I NI+++Q  A++WVE N
Sbjct  43   QSIESLRAMKAGSVKLYDANPEILRLLAGTDIRVSIMVPNYEIINIATNQTSANKWVEDN  102

Query  354  VVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            V+ ++ ET IR +LVGNE+L   S+     W  LVPAMR+I+ S++   +R
Sbjct  103  VLAYHPETMIRTILVGNEVLSYCSDEGKRIWNHLVPAMRRIKISLRAQDIR  153



>gb|KGN57233.1| hypothetical protein Csa_3G172380 [Cucumis sativus]
Length=487

 Score = 96.3 bits (238),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 74/109 (68%), Gaps = 3/109 (3%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +++++ ++  RVK+YDAN +IL  L  +  QVS+M+PN  I  I+++Q  AD+W+  N++
Sbjct  46   IEMMNSMRVGRVKLYDANHEILSNLSKTKFQVSIMIPNNEISGIANNQTRADQWILNNLL  105

Query  360  PFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY +T IR++LVGNE+L   S+     W  LVPAMR+I  S+K   L+
Sbjct  106  PFYPQTMIRFILVGNEVLSLDSDIDRQVWNDLVPAMRRIWSSLKANNLQ  154


 Score = 36.2 bits (82),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  110  ADISATVGICYGQLGNNLPTPS  175
            A+IS+ +GI YGQLGNNLP P+
Sbjct  22   AEISSKIGINYGQLGNNLPAPN  43



>emb|CDY63754.1| BnaAnng19080D [Brassica napus]
Length=478

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 73/111 (66%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  LKA  VK+YDA+ + L  L  +++ V++MVPN  I  I +DQ  AD WV T
Sbjct  54   YQSINLIKTLKAGHVKLYDADQETLTLLSKTNLYVTIMVPNNQIITIGADQTAADNWVNT  113

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+P Y +T+IR++LVGNEIL   S+    TW  LVPAMRKI  S++  G+
Sbjct  114  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQTWANLVPAMRKIVNSLRARGI  164



>ref|XP_004147671.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
Length=461

 Score = 96.3 bits (238),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 74/109 (68%), Gaps = 3/109 (3%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +++++ ++  RVK+YDAN +IL  L  +  QVS+M+PN  I  I+++Q  AD+W+  N++
Sbjct  40   IEMMNSMRVGRVKLYDANHEILSNLSKTKFQVSIMIPNNEISGIANNQTRADQWILNNLL  99

Query  360  PFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            PFY +T IR++LVGNE+L   S+     W  LVPAMR+I  S+K   L+
Sbjct  100  PFYPQTMIRFILVGNEVLSLDSDIDRQVWNDLVPAMRRIWSSLKANNLQ  148


 Score = 36.2 bits (82),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  110  ADISATVGICYGQLGNNLPTPS  175
            A+IS+ +GI YGQLGNNLP P+
Sbjct  16   AEISSKIGINYGQLGNNLPAPN  37



>emb|CDY59775.1| BnaCnng35540D [Brassica napus]
Length=474

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 73/111 (66%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  LKA  VK+YDA+ + L  L  +++ V++MVPN  I  I +DQ  AD WV T
Sbjct  50   YQSINLIKTLKAGHVKLYDADQETLTLLSKTNLYVTIMVPNNQIITIGADQTAADNWVNT  109

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+P Y +T+IR++LVGNEIL   S+    TW  LVPAMRKI  S++  G+
Sbjct  110  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQTWANLVPAMRKIVNSLRARGI  160



>ref|XP_009102583.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=478

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 73/111 (66%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  LKA  VK+YDA+ + L  L  +++ V++MVPN  I  I +DQ  AD WV T
Sbjct  54   YQSINLIKTLKAGHVKLYDADQETLTLLSKTNLYVTIMVPNNQIITIGADQTAADNWVNT  113

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+P Y +T+IR++LVGNEIL   S+    TW  LVPAMRKI  S++  G+
Sbjct  114  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQTWANLVPAMRKIVNSLRARGI  164



>ref|XP_009106344.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=476

 Score =   101 bits (251),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + L+  +KA  VK+YDA+ + L  L  +++ V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLVKSIKAGHVKLYDADQETLMLLSQTNLYVTIMVPNNQIISIGADQAAADNWVNT  111

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+P Y +T+IR++LVGNEIL   S+     W  LVPAMRKI  S++  G+
Sbjct  112  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQIWANLVPAMRKIVNSLRARGI  162


 Score = 30.8 bits (68),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  116  ISATVGICYGQLGNNLPTPSRS  181
            +++ +GI YG+LGNNLP+P +S
Sbjct  33   LASRIGINYGRLGNNLPSPYQS  54



>emb|CDY50110.1| BnaC01g43580D [Brassica napus]
Length=476

 Score =   100 bits (250),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + L+  +KA  VK+YDA+ + L  L  +++ V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLVKSIKAGHVKLYDADQETLMLLSQTNLYVTIMVPNNQIISIGADQAAADNWVNT  111

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+P Y +T+IR++LVGNEIL   S+     W  LVPAMRKI  S++  G+
Sbjct  112  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQIWANLVPAMRKIVNSLRARGI  162


 Score = 30.8 bits (68),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  116  ISATVGICYGQLGNNLPTPSRS  181
            +++ +GI YG+LGNNLP+P +S
Sbjct  33   LASRIGINYGRLGNNLPSPYQS  54



>ref|XP_003572424.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=590

 Score =   100 bits (249),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 73/108 (68%), Gaps = 3/108 (3%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNV-  356
            ++L+    A  VKIYDANP+IL A   + + VS MVPNEIIP+I++ +A A +WV  N+ 
Sbjct  62   VRLLRDAGAGAVKIYDANPEILSAFAGTGIPVSAMVPNEIIPSIAASRAAAHKWVVNNLP  121

Query  357  VPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGL  494
             P     KI YLLVGNE+LSN    ++TW  +VPAMR +R +++K G+
Sbjct  122  KPSSHGPKIVYLLVGNELLSNQAIKDSTWGAIVPAMRNLRHALRKHGM  169


 Score = 31.2 bits (69),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +2

Query  128  VGICYGQLGNNLPTPSRSA  184
            +G+ YG LG+NLPTP+RS 
Sbjct  44   LGVNYGTLGDNLPTPTRSV  62



>ref|XP_006421038.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
 gb|ESR34278.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
Length=466

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 72/106 (68%), Gaps = 3/106 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  ++ I  LKA  VKIYDANP+IL+ L  +D++VS+MV N  I +I+S Q +AD+WV  
Sbjct  43   YQSIESIKFLKAGSVKIYDANPEILKLLSGTDLKVSIMVQNHEIIDIASKQKVADQWVHD  102

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNT---TWFQLVPAMRKIRRSV  479
            NV+ FY ET IR++LVGNEILS         W  LVPAM +I++ +
Sbjct  103  NVLSFYPETMIRFILVGNEILSQSSEEYKQIWKNLVPAMHRIKKCL  148



>gb|KEH22560.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=386

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  282  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  461
            M+PNE+I NISS+Q L+D+W+++N++P+Y +T IRYLLVGNEI+S+ PN+TW  LVPAMR
Sbjct  1    MLPNELITNISSNQTLSDQWIKSNILPYYPQTLIRYLLVGNEIISSTPNSTWLHLVPAMR  60

Query  462  KIRRSVKKFGLR  497
            +I+ S+KKF ++
Sbjct  61   RIKHSLKKFRVK  72



>emb|CAB71021.1| putative beta-1,3-glucanase [Hieracium piloselloides]
Length=379

 Score = 95.5 bits (236),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+  + A RVK+YDA+ +IL  L   D++V++ V N+ I  I+++Q LAD+WV  +V+
Sbjct  58   IELLESMNAGRVKLYDADHEILHLLSGKDIEVAITVANDEISAIAANQHLADQWVYEHVL  117

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQ----LVPAMRKIRRSVKKFGLR  497
              Y  TKIR++LVGNE+ S+  N    Q    LVPAMR+I+ ++K  G+R
Sbjct  118  AHYPNTKIRFILVGNEVFSSTNNVQDMQIARDLVPAMRRIKNTIKAQGIR  167


 Score = 35.4 bits (80),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +2

Query  110  ADISATVGICYGQLGNNLPTPSRS  181
            A IS  +GI YG+LGNNLP+P++S
Sbjct  34   AAISNRIGINYGRLGNNLPSPAKS  57



>gb|KFK36299.1| hypothetical protein AALP_AA4G104300 [Arabis alpina]
Length=479

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++SS+Q++A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPETLTLLSQTNLYVTITVPNHQITSLSSNQSIAEDWVKT  117

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  S++  G+
Sbjct  118  NILPYYPQTQIRFVLVGNEILSAQDTNVTANLVPAMRKIVNSLRTHGI  165



>emb|CDY18092.1| BnaA01g23530D [Brassica napus]
Length=476

 Score =   100 bits (248),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + L+  +KA  VK+YDA+ + L  L  +++ V++MVPN  I +I +DQA AD WV T
Sbjct  52   YQSINLVKSIKAGHVKLYDADQETLMLLSQTNLYVTIMVPNNQIISIGADQAAADNWVNT  111

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+P Y +T+IR++LVGNEIL   S+     W  LVPAMRK+  S++  G+
Sbjct  112  NVLPHYPQTRIRFVLVGNEILSYNSDQDKQIWANLVPAMRKMVNSLRARGI  162


 Score = 30.8 bits (68),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  116  ISATVGICYGQLGNNLPTPSRS  181
            +++ +GI YG+LGNNLP+P +S
Sbjct  33   LASRIGINYGRLGNNLPSPYQS  54



>gb|AEN82021.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82022.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82024.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82028.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 69/95 (73%), Gaps = 3/95 (3%)
 Frame = +3

Query  219  IYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  398
            +YDA+P+ L+ L  +++ V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  399  GNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            GNE+L   S+     W  LVPAMRK+  S++  G+
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGI  95



>ref|NP_193144.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
 sp|Q06915.1|EA6_ARATH RecName: Full=Probable glucan endo-1,3-beta-glucosidase A6; AltName: 
Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Anther-specific protein A6; AltName: 
Full=Beta-1,3-endoglucanase; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA49853.1| A6 [Arabidopsis thaliana]
 emb|CAB10187.1| A6 anther-specific protein [Arabidopsis thaliana]
 emb|CAB78450.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAM20432.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAN72161.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AEE83368.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
Length=478

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I  +SS+Q +AD WV T
Sbjct  57   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHQITALSSNQTIADEWVRT  116

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  S++  G+
Sbjct  117  NILPYYPQTQIRFVLVGNEILSYNSGNVSVNLVPAMRKIVNSLRLHGI  164



>gb|KDO47456.1| hypothetical protein CISIN_1g012660mg [Citrus sinensis]
Length=459

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  ++ I  L+A  VKIYDANP+IL+ L  +D++VS+MV N  I +I+S Q +AD+WV  
Sbjct  43   YQSIESIKFLQAGSVKIYDANPEILKLLSGTDLKVSIMVQNHEIIDIASKQKVADQWVHD  102

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNT---TWFQLVPAMRKIRR  473
            NV+ FY ET IR++LVGNEILS         W  LVPAM +I++
Sbjct  103  NVLSFYPETMIRFILVGNEILSQSSEEYKQIWKNLVPAMHRIKK  146



>ref|XP_002534357.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF28022.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=388

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  461
            MVPNE+I NIS  Q+L+D+WV +NVVPFY + KIRYLL+GNEIL+NP   TWF LVPAMR
Sbjct  1    MVPNELIANISKSQSLSDQWVNSNVVPFYPDVKIRYLLIGNEILTNPDTGTWFNLVPAMR  60

Query  462  KIRRSVK  482
            +I+ S++
Sbjct  61   RIKSSLR  67



>ref|XP_011045808.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=475

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 77/112 (69%), Gaps = 3/112 (3%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  ++++  +KA  VK+YDANP+ILR L  +++ VS+MV N+ I NI+++Q  A++WVE 
Sbjct  51   YESIEILRSMKAGSVKLYDANPEILRLLARTNIHVSIMVSNDEIINIAANQTTANKWVED  110

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            NV+ +Y +T IR +LVGNE+L   S+     W  LVPAMR+I  S++   +R
Sbjct  111  NVLRYYPDTIIRIILVGNEVLSYSSDAGKQIWNNLVPAMRRINISLRAQDIR  162



>gb|AEN82027.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 69/95 (73%), Gaps = 3/95 (3%)
 Frame = +3

Query  219  IYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  398
            +YDA+P+ L+ L  +++ V++MVPN+ I ++ +DQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISVGTDQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  399  GNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            GNE+L   S+     W  LVPAMRK+  S++  G+
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGI  95



>ref|XP_002965673.1| hypothetical protein SELMODRAFT_85067 [Selaginella moellendorffii]
 gb|EFJ33093.1| hypothetical protein SELMODRAFT_85067 [Selaginella moellendorffii]
Length=449

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L   R KI+ A+  I+RA  NS V++SVMV N+ IP I+S Q+ AD WV+ NV 
Sbjct  19   VGLIKDLGFDRAKIFSADSSIIRAFANSGVKLSVMVANQQIPEIASSQSSADAWVKKNVA  78

Query  360  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGL  494
             +Y +T I  +LVGNEILS+     +TW +LVPAM KI+ +++KF L
Sbjct  79   AYYPKTAIDSVLVGNEILSDSSIRESTWPKLVPAMEKIQSALEKFEL  125



>ref|XP_010450129.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score = 97.8 bits (242),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++SS+Q  AD WV T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPECLTLLSQTNLYVTITVPNHQITSLSSNQTTADEWVRT  117

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNE+LS         LVPAMRKI  S++  G+
Sbjct  118  NILPYYPQTQIRFVLVGNEVLSYNYGNISANLVPAMRKIVNSLRFRGI  165


 Score = 30.8 bits (68),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  113  DISATVGICYGQLGNNLPTPSRS  181
            D+++ +GI YG+ GNNLP+P +S
Sbjct  38   DLASKIGINYGRQGNNLPSPYQS  60



>ref|XP_002868315.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44574.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++SS+Q  AD WV T
Sbjct  57   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHQITSLSSNQTTADEWVRT  116

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  S++  G+
Sbjct  117  NILPYYPQTQIRFVLVGNEILSYNYGNVSANLVPAMRKIVNSLRLHGI  164



>ref|XP_002980798.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
 gb|EFJ17983.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
Length=464

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 83/130 (64%), Gaps = 2/130 (2%)
 Frame = +3

Query  108  AQISQLRSEYATVNWATTFPHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            + + Q+   Y  V+     P+   ++L+  +  + VK++DANP++L AL NS ++V++MV
Sbjct  25   SGLDQIGVNYGRVSDNIPSPNQT-VELLKSMNVRLVKLFDANPQVLTALSNSSIRVTIMV  83

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP-NTTWFQLVPAMRK  464
            PNEII  ++S Q+ AD W+  +V+P+Y  T+I  ++VGNEI S P    TW QL+PA+  
Sbjct  84   PNEIIGAVASSQSSADDWIAQSVLPYYPSTQIIVIVVGNEIFSYPALAQTWQQLMPAIEN  143

Query  465  IRRSVKKFGL  494
            + RS++   L
Sbjct  144  LHRSLQSHNL  153



>gb|AEN82025.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 68/95 (72%), Gaps = 3/95 (3%)
 Frame = +3

Query  219  IYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  398
            +YDA+P+ L+ L  +++ V++MVPN+ I +I +DQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  399  GNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            GNE+L   S+     W  LVPAM K+  S++  G+
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMHKVVNSLRARGI  95



>gb|AEN82023.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82026.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 68/95 (72%), Gaps = 3/95 (3%)
 Frame = +3

Query  219  IYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  398
            +YDA+P+ L+ L  +++ V++MVPN+ I +I +DQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  399  GNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            GNE+L   S+     W  LVPAM K+  S++  G+
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMHKVVNSLRARGI  95



>ref|XP_006282877.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
 gb|EOA15775.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
Length=478

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++SS+Q +AD WV T
Sbjct  57   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHQITSLSSNQTIADEWVRT  116

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVG+EILS         LVPAMRKI  S++  G+
Sbjct  117  NIIPYYPQTQIRFVLVGHEILSYNYGNVSANLVPAMRKIVNSLRFHGI  164



>gb|EEC76520.1| hypothetical protein OsI_14306 [Oryza sativa Indica Group]
Length=174

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P H  L+L     A  V+ YD+N   L     S +     VPNE+IP++++ +  AD WV
Sbjct  40   PPHRALELARSAGAAAVRFYDSNATFLSPAAASGLVFVPGVPNELIPSLAASRRAADEWV  99

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLR  497
               ++PF    ++RYL VGNE+LS+P   + WFQLVPAM  + R++++ G+R
Sbjct  100  AATLLPFRRNRRLRYLFVGNEVLSDPTTKSRWFQLVPAMANLERALRRHGMR  151



>gb|ADG38502.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +3

Query  225  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  404
            DA+P+ L+ L  +++ V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLVGN  60

Query  405  EIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            E+L   S+     W  LVPAMRK+  S++  G+
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGI  93



>ref|XP_010450110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I +ISS+Q  AD WV T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSRTNLYVTITVPNHQITSISSNQTTADEWVRT  117

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++PFY +T+IR++LVGNE+L+         LVPAMRKI  S++  G+
Sbjct  118  NILPFYPQTQIRFVLVGNEVLNYNYGNISANLVPAMRKIVNSLRFRGI  165



>gb|ADG38498.1| AT3G23770-like protein [Capsella grandiflora]
 gb|ADG38500.1| AT3G23770-like protein [Capsella grandiflora]
 gb|ADG38501.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +3

Query  225  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  404
            DA+P+ L+ L  +++ V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLVGN  60

Query  405  EIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            E+L   S+     W  LVPAMRK+  S++  G+
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGI  93



>ref|XP_002298669.2| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE83474.2| glucan endo-1 family protein [Populus trichocarpa]
Length=416

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = +3

Query  198  LKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  377
            +KA  VK+YDANP+ILR L  +++ VS+MV N+ I NI+++Q  A++WVE NV+ +Y +T
Sbjct  1    MKAGSVKLYDANPEILRLLARTNIHVSIMVRNDEIINIAANQTTANKWVEDNVLRYYPDT  60

Query  378  KIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
             IR +LVGNE+L   S+     W  LVPAMR+I+ S++   +R
Sbjct  61   IIRTILVGNEVLSYSSDAGKQIWNHLVPAMRRIKISLRAQDIR  103



>gb|ADG38497.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +3

Query  225  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  404
            DA+P+ L+ L  +++ V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLVGN  60

Query  405  EIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            E+L   S+     W  LVPAMRK+  S++  G+
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGI  93



>gb|AAZ40342.1| beta-1,3-glucanase 2 [Ziziphus jujuba]
Length=468

 Score = 97.1 bits (240),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      RVK+YD +  +L AL NS + V V +PNE++ + ++DQ+ AD+WV+ N+ 
Sbjct  40   VELLKSQGIDRVKLYDTDSDVLTALANSGIGVVVALPNELLSSTANDQSFADKWVQANIS  99

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
             +Y +TKI  + VGNE+  +P NTT F LVPAM+ I  S+ K+ L 
Sbjct  100  QYYPKTKIEAIAVGNEVFVDPNNTTKF-LVPAMKNIHTSLSKYNLN  144


 Score = 28.9 bits (63),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = +2

Query  125  TVGICYGQLGNNLPTPSR  178
            ++GI YG++ N+LPTPS+
Sbjct  21   SIGINYGRVANDLPTPSK  38



>ref|XP_011010072.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=466

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 76/111 (68%), Gaps = 3/111 (3%)
 Frame = +3

Query  174  HDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETN  353
              ++ +  +KA  VK+YDANP+ILR L  +D++VS+MVPN  I +I+++Q  A++WVE N
Sbjct  43   QSIESLRAMKAGSVKLYDANPEILRLLAGTDIRVSIMVPNYEIISIATNQTSANKWVEDN  102

Query  354  VVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            V+ ++ ET IR +LVGNE+L   S+     W  LV AMR+I+ S++   +R
Sbjct  103  VLAYHPETMIRTILVGNEVLSYCSDEGKRIWNHLVLAMRRIKISLRAQDIR  153



>gb|ADG38503.1| AT3G23770-like protein [Neslia paniculata]
Length=169

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +3

Query  225  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  404
            DA+P+ L+ L  +++ V++MVPN+ I  I SDQA AD WV T V+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIITIGSDQAAADNWVATKVIPFYPQTRIRFVLVGN  60

Query  405  EIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            EIL   S+     W  LVPAMRK+  S++  G+
Sbjct  61   EILSYSSDQDKQIWANLVPAMRKVVNSLRARGI  93



>dbj|BAG16366.1| tapetum-specific protein A6 family protein [Brassica rapa var. 
perviridis]
Length=399

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++S++Q  AD WV+T
Sbjct  5    YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPNHQITSLSANQTTADDWVKT  64

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+
Sbjct  65   NILPYYPQTQIRFVLVGNEILSVQDRNITANVVPAMRKIVNSLRAHGI  112



>ref|XP_009144683.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score = 96.3 bits (238),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++S++Q  AD WV+T
Sbjct  58   YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPNHQITSLSANQTTADDWVKT  117

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVKDRNITANVVPAMRKIVNSLRAHGI  165


 Score = 28.9 bits (63),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  113  DISATVGICYGQLGNNLPTPSRS  181
            ++++ +GI YG+ GNNLP+P +S
Sbjct  38   ELASKIGINYGRQGNNLPSPYQS  60



>gb|KDP39185.1| hypothetical protein JCGZ_00942 [Jatropha curcas]
Length=463

 Score = 93.2 bits (230),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 68/103 (66%), Gaps = 1/103 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      R K+YD +  +L AL NS + V V +PNE++ + ++DQ+ AD+WV+ N+ 
Sbjct  41   VELLKSQGINRAKLYDTDSTVLTALANSGISVVVALPNELLASTAADQSFADKWVQANIS  100

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKF  488
             +Y +T+I  + VGNE+  +P NTT F LVPAM+ +  S+ KF
Sbjct  101  QYYPQTQIEAIAVGNEVFVDPNNTTKF-LVPAMKNVYNSLVKF  142


 Score = 32.0 bits (71),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  110  ADISATVGICYGQLGNNLPTPSR  178
            AD +  +G+ YG++ NNLPTP +
Sbjct  17   ADATGKIGVNYGRIANNLPTPEK  39



>ref|XP_007020717.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY12242.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=475

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+  +  ++VK+YD +  +L AL NS + V V +PNE++ + ++DQ+ AD WV++N+ 
Sbjct  51   VELLKSIGVEKVKLYDTDATVLTALANSGISVMVALPNELLASAAADQSFADNWVQSNIS  110

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             FY  TKI  + VGNE+  +P NTT + +VPAM+ +  S+ KF L
Sbjct  111  KFYPATKIEAIAVGNEVFVDPKNTTSY-VVPAMKNVHASLVKFNL  154



>ref|XP_002529472.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF32938.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=472

 Score = 90.9 bits (224),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      RVK+YD +  +L AL NS + V V +PNE++ + ++DQ+ AD WV+ N+ 
Sbjct  49   VELLKSQGINRVKLYDTDSTVLTALANSGITVVVALPNELLASTAADQSFADNWVQANIS  108

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             ++ +T+I  + VGNE+  +P NTT + LVPAM+ +  S+ KF L
Sbjct  109  QYHPKTQIEAIAVGNEVFVDPQNTTKY-LVPAMKNVYNSLVKFNL  152


 Score = 34.3 bits (77),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +2

Query  110  ADISATVGICYGQLGNNLPTPSR  178
            AD S TVGI YG++ NNLP+P +
Sbjct  25   ADASGTVGINYGRVANNLPSPEK  47



>ref|XP_006414816.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
 gb|ESQ56269.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
Length=479

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L ++++ V++ VPN  I ++ S+Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSHTNLYVTITVPNHQIISLGSNQTTAEDWVKT  117

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  S++  G+
Sbjct  118  NILPYYPQTQIRFVLVGNEILSAENRNITANLVPAMRKIVTSLRAHGI  165



>ref|XP_002961854.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
 gb|EFJ37114.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
Length=464

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + L+  +  + VK++DANP++L AL NS ++V++MVPNEII  ++S Q+ AD W+  
Sbjct  45   NQTVALLKSMNVRLVKLFDANPQVLTALSNSSIRVTIMVPNEIIGAVASSQSSADDWIAQ  104

Query  351  NVVPFYGETKIRYLLVGNEILSNPP-NTTWFQLVPAMRKIRRSVKKFGL  494
            +V+P+Y  T+I  ++VGNEI S P    TW QL+PA+  + R+++   L
Sbjct  105  SVLPYYPSTQIIVIVVGNEIFSYPALAQTWQQLMPAIENLHRALQSHNL  153



>ref|XP_007034194.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY05120.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=552

 Score = 93.2 bits (230),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  ++++  +KA+RVK+YD++P+IL+    +++ +++MVPN+ I  ISS Q  A++WV  
Sbjct  129  YQSIEIMKSMKARRVKLYDSDPEILKLFSGTNIDMAIMVPNKDIVLISSSQTAAEQWVRN  188

Query  351  NVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRSVK  482
            NV+  Y  T IR++LVGNE+L   S    T W  LVPAMR+I+ S+ 
Sbjct  189  NVLA-YPNTNIRFVLVGNEVLSYVSKQDQTIWAHLVPAMRRIKNSLS  234


 Score = 31.2 bits (69),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  113  DISATVGICYGQLGNNLPTPSRS  181
            +IS+ +GI YG+ G+NLP+P +S
Sbjct  109  EISSKIGINYGRQGDNLPSPYQS  131



>emb|CDY08310.1| BnaA05g13090D [Brassica napus]
Length=479

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++S++Q  AD WV+T
Sbjct  58   YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPNHQITSLSANQTTADDWVKT  117

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVQDRNITANVVPAMRKIVNSLRAHGI  165



>gb|ADG38499.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +3

Query  225  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  404
            DA+P+ L+ L  +++ V++MVPN  I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNXQIISVGSDQAAADXWVATNVLPFYPQTRIRFVLVGN  60

Query  405  EIL---SNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            E+L   S+     W  LVPAMRK+  S++  G+
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGI  93



>ref|XP_004251911.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
lycopersicum]
Length=480

 Score = 92.4 bits (228),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QL+      RVK+YD +  +L AL  S++ VSV +PNE + + +S Q+  D WV++N+V
Sbjct  43   VQLLKSQGIHRVKLYDTDSAVLTALSGSNISVSVALPNEQLSDAASKQSFTDSWVQSNIV  102

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+
Sbjct  103  RYYPKTNIESIAVGNEVFVDPNNTTKF-LVPAMKNVYASLVKYGV  146


 Score = 31.6 bits (70),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTPSR  178
            S ++GI YG++ NNLPTPS 
Sbjct  22   SGSIGINYGRIANNLPTPSE  41



>ref|XP_010435194.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++SS+Q  AD WV T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSRTNLYVTITVPNHQITSLSSNQTTADEWVRT  117

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNE+L+         LVPAMRKI  S++  G+
Sbjct  118  NILPYYPQTQIRFVLVGNEVLNYNYGNISANLVPAMRKIVNSLRFRGI  165



>ref|XP_010527440.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=489

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 73/112 (65%), Gaps = 4/112 (4%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  + LI  + A  VK+YDA+P+ L  L  ++++V++MV N  I +I SDQ  AD WV T
Sbjct  57   YKSINLIKSVNAGHVKLYDADPETLILLSQTNLRVTIMVQNHDIVSIGSDQRAADDWVRT  116

Query  351  NVVPFYGETKIRYLLVGNEILS----NPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+P+Y  T IR++LVGNE+LS    +     W  LVPAMRKI +S++  G+
Sbjct  117  NVLPYYPRTLIRFVLVGNEVLSYYNTDQDRDIWRNLVPAMRKIVKSLRAQGI  168



>ref|NP_001051879.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|AAO73280.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|AAS07356.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF99870.1| Glycosyl hydrolases family 17 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13793.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|EAZ29287.1| hypothetical protein OsJ_13350 [Oryza sativa Japonica Group]
 dbj|BAG98908.1| unnamed protein product [Oryza sativa Japonica Group]
Length=474

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P H  L+L     A  V+ YD+N   L     S +     VPNE+IP++++ +  AD WV
Sbjct  40   PPHRALELARSAGAAAVRFYDSNATFLSPAAASGLVFVPGVPNELIPSLAASRRAADEWV  99

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLR  497
               ++PF    ++RYL VGNE+LS+P   + WFQLVPAM  + R++++ G+R
Sbjct  100  AATLLPFRRNRRLRYLFVGNEVLSDPTTKSRWFQLVPAMANLERALRRHGMR  151



>ref|XP_010026682.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6 [Eucalyptus grandis]
Length=337

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = +3

Query  198  LKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  377
            ++A  VK+Y+A+P+IL+ L  + VQVS+MV N  IP ++S QALAD+WV  NV+ +Y  T
Sbjct  1    MRAGHVKLYNADPEILKLLSGTKVQVSIMVQNHEIPGVASSQALADKWVRNNVLLYYHGT  60

Query  378  KIRYLLVGNEILS----NPPNTTWFQLVPAMRKIRRSVKKFGL  494
             IR++LVGNE  S    +  +  W  LVPAM +I+ S++  G+
Sbjct  61   MIRFVLVGNEFSSYNSTDRDHQLWRDLVPAMCRIKSSLRSNGI  103



>gb|AFU52656.1| beta-1,3-glucanase 23 [Solanum tuberosum]
Length=473

 Score = 90.9 bits (224),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QL+      RVK+YD +  +L AL  S++ V+V +PNE + + +S Q+  D WV++N++
Sbjct  43   VQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVALPNEQLSDAASKQSFTDSWVQSNIL  102

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+
Sbjct  103  RYYPKTNIESIAVGNEVFVDPKNTTKF-LVPAMKNVYASLVKYGV  146


 Score = 31.2 bits (69),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTPSR  178
            S ++GI YG++ NNLPTPS 
Sbjct  22   SGSIGINYGRIANNLPTPSE  41



>ref|XP_003519593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score = 93.6 bits (231),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      RVK+YD +  +L A  NS ++V V +PNE++ N ++DQ+  D WV+ N+ 
Sbjct  49   VELLKAQGLNRVKLYDTDATVLTAFANSGIKVVVAMPNELLANAAADQSFTDAWVQANIS  108

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y  T+I  + VGNE+  +P NTT F LVPAM+ +  S+ K+ L
Sbjct  109  TYYPATQIEAIAVGNEVFVDPNNTTKF-LVPAMKNVHASLTKYNL  152


 Score = 28.9 bits (63),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = +2

Query  125  TVGICYGQLGNNLPTPSR  178
            +VGI YG++ N+LPTP++
Sbjct  30   SVGINYGRVANDLPTPAK  47



>emb|CDY01191.1| BnaA04g06280D [Brassica napus]
Length=480

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN +I ++S++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHLITSLSTNQTTAEDWVQT  117

Query  351  NVVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T IR++LVGNEILS          +VPAMRKI  S++  G+
Sbjct  118  NIIPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKIVTSLRAHGI  166



>ref|XP_009139564.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN +I ++S++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHLITSLSTNQTTAEDWVQT  117

Query  351  NVVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T IR++LVGNEILS          +VPAMRKI  S++  G+
Sbjct  118  NIIPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKIVTSLRAHGI  166



>gb|ABR16205.1| unknown [Picea sitchensis]
Length=494

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L+A  VKIYDA+P++L AL N+ +QV++ V N+ I NISS   +A++WV+ NV+
Sbjct  66   VALIKNLQAGYVKIYDADPQVLSALSNTALQVTITVRNQDISNISSSPTVAEQWVQANVL  125

Query  360  PFYGETKIRYLLVGNEILSNPPN-TTWFQLVPAMRKIRRSVKKFGL  494
            P Y  T I  ++VGNE+LS+  N  TW  ++PAM  I  S+   GL
Sbjct  126  PHYPSTLITAIMVGNEVLSDYQNQATWLLMLPAMPNIHASLLNHGL  171



>gb|ADU15553.1| GLU [Gossypium hirsutum]
Length=469

 Score = 92.8 bits (229),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      +VK+YD +  +L AL +S + V V +PNE++ + ++DQ+ AD WVE N+ 
Sbjct  45   VELLKSQGINKVKLYDTDATVLTALADSGITVVVALPNELLSSTAADQSFADNWVEANIT  104

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             FY +TKI  + VGNE+  +P NTT + LVPAM+ I  S+ K  L
Sbjct  105  KFYPKTKIEAIAVGNEVFVDPANTTKY-LVPAMKNIHASLVKSKL  148


 Score = 29.3 bits (64),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTPSR  178
            S +VGI YG++ NNLP+P +
Sbjct  24   SGSVGINYGRVANNLPSPEK  43



>gb|KHG04965.1| hypothetical protein F383_30444 [Gossypium arboreum]
 gb|KHG22638.1| hypothetical protein F383_01203 [Gossypium arboreum]
Length=469

 Score = 92.4 bits (228),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      +VK+YD +  +L AL +S + V V +PNE++ + ++DQ+ AD WVE N+ 
Sbjct  45   VELLKSQGINKVKLYDTDATVLTALADSGITVVVALPNELLSSTAADQSFADNWVEANIT  104

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             FY +TKI  + VGNE+  +P NTT + LVPAM+ I  S+ K  L
Sbjct  105  KFYPKTKIEAIAVGNEVFVDPANTTKY-LVPAMKNIHASLVKSKL  148


 Score = 29.3 bits (64),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTPSR  178
            S +VGI YG++ NNLP+P +
Sbjct  24   SGSVGINYGRVANNLPSPEK  43



>ref|XP_006344866.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
tuberosum]
Length=518

 Score = 92.0 bits (227),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QL+      RVK+YD +  +L AL  S++ V+V +PNE + + +S Q+  D WV++N++
Sbjct  87   VQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVALPNEQLSDAASKQSFTDSWVQSNII  146

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+
Sbjct  147  RYYPKTNIESIAVGNEVFVDPKNTTKF-LVPAMKNVYASLVKYGV  190


 Score = 30.0 bits (66),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 10/18 (56%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTP  172
            S ++G+ YG++ NNLPTP
Sbjct  66   SGSIGVNYGRIANNLPTP  83



>gb|KJB62900.1| hypothetical protein B456_009G442700 [Gossypium raimondii]
Length=469

 Score = 92.0 bits (227),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      +VK+YD    +L AL +S + V V +PNE++ + ++DQ+ AD WVE N+ 
Sbjct  45   VELLKSQGINKVKLYDTGATVLTALADSGITVVVALPNELLSSTAADQSFADNWVEANIT  104

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             FY +TKI  + VGNE+  +P NTT + LVPAM+ I  S+ K  L
Sbjct  105  KFYPKTKIEAIAVGNEVFVDPANTTKY-LVPAMKNIHASLVKSKL  148


 Score = 29.3 bits (64),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTPSR  178
            S +VGI YG++ NNLP+P +
Sbjct  24   SGSVGINYGRVANNLPSPEK  43



>ref|XP_010539314.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Tarenaya hassleriana]
Length=462

 Score = 92.0 bits (227),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      RVK+YD +  +L AL NS ++V V +PNE++ + ++DQ+ AD+WVE N+ 
Sbjct  44   VELLKTQGIHRVKLYDTDKTVLTALANSSIKVVVALPNELLSSAAADQSFADKWVEANIT  103

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y  T+I  + VGNE+  +P NTT F LV AM+ +  S+ K+ L
Sbjct  104  KYYPSTEIEAIAVGNEVFVDPNNTTEF-LVQAMKNVHSSLVKYDL  147


 Score = 29.6 bits (65),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTPSR  178
            S +VGI YG++ +NLPTP +
Sbjct  23   SGSVGINYGRIADNLPTPEK  42



>gb|KDO62115.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=472

 Score = 92.8 bits (229),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+   +  RVK YD +  +L AL NSD+ V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  44   VELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  103

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L
Sbjct  104  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKL  147


 Score = 28.5 bits (62),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  128  VGICYGQLGNNLPTPSR  178
            VGI YG++ NNLP+P +
Sbjct  26   VGINYGRVANNLPSPEK  42



>gb|KDO62116.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=475

 Score = 92.8 bits (229),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+   +  RVK YD +  +L AL NSD+ V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  44   VELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  103

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L
Sbjct  104  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKL  147


 Score = 28.1 bits (61),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  128  VGICYGQLGNNLPTPSR  178
            VGI YG++ NNLP+P +
Sbjct  26   VGINYGRVANNLPSPEK  42



>gb|KDO62114.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=483

 Score = 92.4 bits (228),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+   +  RVK YD +  +L AL NSD+ V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  44   VELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  103

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L
Sbjct  104  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKL  147


 Score = 28.5 bits (62),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  128  VGICYGQLGNNLPTPSR  178
            VGI YG++ NNLP+P +
Sbjct  26   VGINYGRVANNLPSPEK  42



>ref|XP_003581305.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=473

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 69/111 (62%), Gaps = 1/111 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P H  L+L     A  V+ YD+N  +L A  +S +     VPNE+IP++S+ +  AD WV
Sbjct  44   PPHVALELARSAGAAAVRFYDSNATLLAAASSSGLGFVPGVPNELIPSLSASRRAADAWV  103

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGL  494
             + ++PF    ++RYL VGNE+LS+P   + W QLVPAM  + R++++ GL
Sbjct  104  ASTLLPFRRNPRLRYLFVGNEVLSDPTTKSRWSQLVPAMANLHRALRRHGL  154



>ref|XP_002964439.1| hypothetical protein SELMODRAFT_230318 [Selaginella moellendorffii]
 gb|EFJ34772.1| hypothetical protein SELMODRAFT_230318 [Selaginella moellendorffii]
Length=339

 Score = 90.9 bits (224),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L   RVKI+DA+ ++L AL N+ ++VS+MV N+ IP I+S+ + AD WV  NVV
Sbjct  32   VSLIKSLGIDRVKIFDADSQVLAALANTSIKVSIMVRNQDIPGIASNASHADSWVAQNVV  91

Query  360  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVK  482
              Y  T I  +LVGNEILS+    ++TW  LVPAM  I  S++
Sbjct  92   HHYPATHIATILVGNEILSDTSIKSSTWPALVPAMENIFASLQ  134


 Score = 29.6 bits (65),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  122  ATVGICYGQLGNNLPTPSRSAA  187
            A VGI YG++ NNLP+PS + +
Sbjct  12   AQVGINYGRVANNLPSPSTAVS  33



>ref|XP_008382595.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Malus domestica]
Length=134

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 54/94 (57%), Gaps = 21/94 (22%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    ++LI  LKAKRVK+YDANPKIL A                     S+Q LAD WV
Sbjct  39   PPSQSVKLIQSLKAKRVKLYDANPKILTA---------------------SNQTLADHWV  77

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQL  446
             TNVVPFY ET IRYL VGNEILS P    W+ L
Sbjct  78   HTNVVPFYPETLIRYLFVGNEILSQPNKQIWYNL  111



>ref|XP_006344865.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
tuberosum]
Length=480

 Score = 91.3 bits (225),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QL+      RVK+YD +  +L AL  S++ V+V +PNE + + +S Q+  D WV++N++
Sbjct  43   VQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVALPNEQLSDAASKQSFTDSWVQSNII  102

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+
Sbjct  103  RYYPKTNIESIAVGNEVFVDPNNTTKF-LVPAMKNVYASLVKYGV  146


 Score = 29.6 bits (65),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTP  172
            S ++GI YG++ NNLPTP
Sbjct  22   SGSIGINYGRVANNLPTP  39



>emb|CDY12371.1| BnaC08g08340D [Brassica napus]
Length=479

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L ++++ VS+ V N  I ++ ++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHNHQITSLGTNQTTAEDWVKT  117

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  +++  G+
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVQDRNITANLVPAMRKIVNALRAHGI  165



>emb|CDY12732.1| BnaC04g29090D [Brassica napus]
Length=480

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VPN +I ++S++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHLITSLSTNQTSAEDWVQT  117

Query  351  NVVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N+ P+Y +T IR++LVGNEILS          +VPAMRKI  S++  G+
Sbjct  118  NITPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKIVTSLRAHGI  166



>emb|CDY27122.1| BnaA08g07600D [Brassica napus]
Length=479

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L ++++ VS+ V N  I ++ ++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHNHQITSLGTNQTTAEDWVKT  117

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  +++  G+
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVQDRNITSNLVPAMRKIVNALRAHGI  165



>ref|XP_009108090.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L ++++ VS+ V N  I ++ ++Q  A+ WV+T
Sbjct  58   YQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHNHQITSLGTNQTTAEDWVKT  117

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNEILS         LVPAMRKI  +++  G+
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVQDRNITSNLVPAMRKIVNALRAHGI  165



>gb|KEH18116.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=383

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  282  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  461
            M+PNE++ N+SS+Q LA++WV+TN+VPFY +T IRYLLVGNE++S+  N TW  +VPAM 
Sbjct  1    MLPNELVTNVSSNQTLANQWVQTNLVPFYSKTLIRYLLVGNELISSTTNQTWPHIVPAMY  60

Query  462  KIRRSVKKFGLR  497
            +++ S+  FGL 
Sbjct  61   RMKHSLTIFGLH  72



>ref|XP_006452449.1| hypothetical protein CICLE_v10008176mg [Citrus clementina]
 gb|ESR65689.1| hypothetical protein CICLE_v10008176mg [Citrus clementina]
Length=473

 Score = 92.0 bits (227),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      RVK YD +  +L AL NSD+ V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  45   VELLKSQGIGRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  104

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L
Sbjct  105  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKL  148


 Score = 28.1 bits (61),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  128  VGICYGQLGNNLPTPSR  178
            VGI YG++ NNLP+P +
Sbjct  27   VGINYGRVANNLPSPEK  43



>ref|XP_006475009.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Citrus sinensis]
Length=472

 Score = 92.0 bits (227),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      RVK YD +  +L AL NSD+ V V  PNE +   ++DQ+  D WV+ N+ 
Sbjct  44   VELLKSQGIGRVKTYDTDSAVLAALANSDISVVVAFPNEELSKAAADQSFTDNWVQANIS  103

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S+ K+ L
Sbjct  104  KYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNSLVKYKL  147


 Score = 28.1 bits (61),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  128  VGICYGQLGNNLPTPSR  178
            VGI YG++ NNLP+P +
Sbjct  26   VGINYGRVANNLPSPEK  42



>dbj|BAG16359.1| tapetum-specific protein A6 family protein [Brassica oleracea 
var. italica]
Length=399

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VP   I ++S++Q  A+ WV+T
Sbjct  5    YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPTHQITSLSANQTTAEDWVKT  64

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+
Sbjct  65   NILPYYPQTQIRFVLVGNEILSVKDRNITGNVVPAMRKIVNSLRAHGI  112



>ref|XP_002975355.1| hypothetical protein SELMODRAFT_103308, partial [Selaginella 
moellendorffii]
 gb|EFJ23556.1| hypothetical protein SELMODRAFT_103308, partial [Selaginella 
moellendorffii]
Length=320

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + LI  L   RVKI+DA+ ++L AL N+ ++VS+MV N+ IP I+S+ + AD WV  NVV
Sbjct  13   VSLIKSLGIDRVKIFDADSQVLAALANTSIKVSIMVRNQDIPGIASNASHADSWVAQNVV  72

Query  360  PFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVK  482
              Y  T I  +LVGNEILS+    ++TW  LVPAM  I  S++
Sbjct  73   HHYPATHIATILVGNEILSDTSIKSSTWPALVPAMENIFASLQ  115



>ref|XP_009771280.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Nicotiana 
sylvestris]
Length=154

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +3

Query  207  KRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIR  386
            +RVK+YD +P +L+AL  S + V+V +PNE++ N +  Q+ A  WV+ NVV +Y  T+I 
Sbjct  53   ERVKVYDTDPAVLKALSGSGIMVTVNLPNELLYNAAKRQSFAYSWVQRNVVAYYPSTQIE  112

Query  387  YLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             + VGNE+  +P NTT F LVPAM+ I  ++ K+ +
Sbjct  113  SIAVGNEVFVDPHNTTRF-LVPAMKNIHEALLKYNI  147



>emb|CDY06469.1| BnaC06g11750D [Brassica napus]
Length=479

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VP   I ++S++Q  A+ WV+T
Sbjct  58   YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPTHQITSLSANQTTAEDWVKT  117

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+
Sbjct  118  NILPYYPQTQIRFVLVGNEILSVKDRNITGNVVPAMRKIVNSLRAHGI  165



>emb|CAA49513.1| beta-1,3-glucanase homologue [Brassica napus]
Length=474

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +3

Query  171  HHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            +  +  I  +KA  VK+YDA+P+ L  L  +++ V++ VP   I ++S++Q  A+ WV+T
Sbjct  53   YQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPTHQITSLSANQTTAEDWVKT  112

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            N++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+
Sbjct  113  NILPYYPQTQIRFVLVGNEILSVKDRNITGNVVPAMRKIVNSLRAHGI  160



>gb|EEC76519.1| hypothetical protein OsI_14305 [Oryza sativa Indica Group]
Length=474

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 66/112 (59%), Gaps = 1/112 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P H  L+L     A  V+ YD+N   L     S +     VPNE+IP++++ +  AD WV
Sbjct  40   PPHRALELARSAGAAAVRFYDSNATFLSPAAASGLVFVPGVPNELIPSLAASRRAADEWV  99

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVKKFGLR  497
               ++PF    ++RYL VGNE+LS+P   + WFQLV AM  + R++++ G+R
Sbjct  100  AATLLPFRRNRRLRYLFVGNEVLSDPTTKSRWFQLVSAMANLERALRRHGMR  151



>ref|XP_002316783.2| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE97395.2| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=476

 Score = 91.3 bits (225),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 67/101 (66%), Gaps = 3/101 (3%)
 Frame = +3

Query  192  HGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYG  371
            HG+   R+K+YD +  +L AL  S + V V +PNE++ ++++DQ+ AD WV+ N+   + 
Sbjct  55   HGIN--RIKLYDTDSDVLTALAGSSINVVVALPNELLSSVAADQSFADSWVKGNISQHFP  112

Query  372  ETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            +TKI  + VGNE+  +P NTT F LVPAM+ +  S+ KF L
Sbjct  113  QTKIEAIAVGNEVFVDPKNTTPF-LVPAMKNVHNSLVKFNL  152


 Score = 27.7 bits (60),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +2

Query  125  TVGICYGQLGNNLPTPSR  178
            T+G+ YG++ NNLP P+ 
Sbjct  30   TIGVNYGRVANNLPAPAE  47



>ref|XP_010545233.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Tarenaya hassleriana]
Length=461

 Score = 89.7 bits (221),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      RVK+YD++  +L AL NS ++V V +PNE++ + ++DQ+ +D WVE N+ 
Sbjct  43   VELLKKQGIDRVKLYDSDKSVLTALANSGIKVVVALPNELLSSAAADQSFSDNWVEANIT  102

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y  T+I  + VGNE+  +P NTT + LV AM+ +  S+ K+ L
Sbjct  103  EYYPATQIEAIAVGNEVFVDPNNTTEY-LVQAMKNVHSSLMKYNL  146


 Score = 28.9 bits (63),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTPSR  178
            S  VGI YG++ +NLPTP +
Sbjct  22   SGMVGINYGRIADNLPTPDK  41



>ref|XP_009347789.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14 isoform X2 [Pyrus 
x bretschneideri]
Length=384

 Score = 85.5 bits (210),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 0/104 (0%)
 Frame = +3

Query  186  LIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPF  365
            L+  L   RVK+YDA+P +L+A  NSDV   + + NE + ++S+D   A  W++ NV P+
Sbjct  49   LLQSLNVSRVKLYDADPNVLQAFSNSDVDFIIGLGNEYLQSMSTDPLTAQSWIQQNVQPY  108

Query  366  YGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
              +TKI  + VGNE+L       W  L+PAM+ + R++   GL 
Sbjct  109  LPQTKITCINVGNEVLGGNDTQLWSYLLPAMQSVYRALVDLGLS  152


 Score = 33.5 bits (75),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTPSRSA  184
            S + GI YGQ+ NNLP+PSR A
Sbjct  26   SLSFGINYGQIANNLPSPSRVA  47



>gb|KHN23902.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=458

 Score = 90.1 bits (222),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      RVK+YD +  +L A  NS ++V V +PNE++ N +++Q+  D WV+ N+ 
Sbjct  43   VELLKSQGLNRVKLYDTDATVLTAFANSGMKVVVAMPNELLANAAAEQSFTDAWVQANIS  102

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y  T+I  + VGNE+  +P NTT F LVPAM+ +  S+ K+ L
Sbjct  103  SYYPATQIEAIAVGNEVFVDPNNTTKF-LVPAMKNVHASLVKYSL  146


 Score = 28.5 bits (62),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = +2

Query  125  TVGICYGQLGNNLPTPSR  178
            ++GI YG++ N+LPTP++
Sbjct  24   SIGINYGRIANDLPTPAK  41



>ref|XP_003544773.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=461

 Score = 90.1 bits (222),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      RVK+YD +  +L A  NS ++V V +PNE++ N +++Q+  D WV+ N+ 
Sbjct  43   VELLKSQGLNRVKLYDTDATVLTAFANSGMKVVVAMPNELLANAAAEQSFTDAWVQANIS  102

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y  T+I  + VGNE+  +P NTT F LVPAM+ +  S+ K+ L
Sbjct  103  SYYPATQIEAIAVGNEVFVDPNNTTKF-LVPAMKNVHASLVKYSL  146


 Score = 28.5 bits (62),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = +2

Query  125  TVGICYGQLGNNLPTPSR  178
            ++GI YG++ N+LPTP++
Sbjct  24   SIGINYGRIANDLPTPAK  41



>ref|XP_004497650.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Cicer arietinum]
 gb|AIR93907.1| glucanase [Cicer arietinum]
Length=468

 Score = 88.2 bits (217),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      RVK+YD +  +L AL NS + V+V +PNE++   ++DQ+  D W++ N++
Sbjct  43   VELLKSQGINRVKLYDTDATVLTALANSGINVTVAMPNELLSAAAADQSFTDTWLQANII  102

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y  T+I  + VGNE+  +P NTT + LVPAM+ +  S+ K  L
Sbjct  103  KYYPSTQIEAIAVGNEVFVDPQNTTNY-LVPAMKNVHASLVKQNL  146


 Score = 30.4 bits (67),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = +2

Query  125  TVGICYGQLGNNLPTPSR  178
            +VGI YG++ NNLPTP++
Sbjct  24   SVGINYGRVANNLPTPTK  41



>dbj|BAC53928.1| beta-1,3-glucanase-like protein [Nicotiana tabacum]
Length=358

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    +QL+      RVK+YD +  +L AL  S++ V+V +PNE + + +  Q+  D WV
Sbjct  37   PPAQVVQLLKTQGVNRVKLYDTDSNVLTALSGSNISVTVALPNEQLADAAGKQSFTDSWV  96

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            ++N++ +Y +T+I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+
Sbjct  97   QSNILTYYPKTQIESIAVGNEVFVDPKNTTKF-LVPAMKNMYASLVKYGV  145



>ref|XP_007204831.1| hypothetical protein PRUPE_ppa1027206mg [Prunus persica]
 gb|EMJ06030.1| hypothetical protein PRUPE_ppa1027206mg [Prunus persica]
Length=497

 Score = 87.0 bits (214),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 69/104 (66%), Gaps = 1/104 (1%)
 Frame = +3

Query  183  QLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVP  362
            QL+     K V+IYD+N ++L+A GN+ V++ + VPN  +  IS  Q+ AD W++ +++P
Sbjct  45   QLVQLHNIKYVRIYDSNIQVLKAFGNTGVELMIGVPNSDLLAISQYQSNADTWLKNSILP  104

Query  363  FYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            +Y  TKI Y+ VG E+  +P N +  Q+VPAMR +  ++KK GL
Sbjct  105  YYPATKITYITVGAEVTESPSNFSA-QVVPAMRNVLTALKKVGL  147


 Score = 31.2 bits (69),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +2

Query  122  ATVGICYGQLGNNLPTPSRSA  184
            +T+GICYG+  ++LPTP ++A
Sbjct  24   STIGICYGRNADDLPTPDKAA  44



>ref|XP_009347788.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14 isoform X1 [Pyrus 
x bretschneideri]
Length=397

 Score = 85.1 bits (209),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 0/104 (0%)
 Frame = +3

Query  186  LIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPF  365
            L+  L   RVK+YDA+P +L+A  NSDV   + + NE + ++S+D   A  W++ NV P+
Sbjct  49   LLQSLNVSRVKLYDADPNVLQAFSNSDVDFIIGLGNEYLQSMSTDPLTAQSWIQQNVQPY  108

Query  366  YGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
              +TKI  + VGNE+L       W  L+PAM+ + R++   GL 
Sbjct  109  LPQTKITCINVGNEVLGGNDTQLWSYLLPAMQSVYRALVDLGLS  152


 Score = 33.1 bits (74),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTPSRSA  184
            S + GI YGQ+ NNLP+PSR A
Sbjct  26   SLSFGINYGQIANNLPSPSRVA  47



>gb|KEH41871.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=494

 Score = 88.6 bits (218),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 70/105 (67%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            ++L+      RVK+YD +  +L AL NS ++V+V +PNE++ + ++DQ+  D W+++N++
Sbjct  56   VELLKAQGFNRVKLYDTDATVLTALANSGIKVTVAMPNELLSSAAADQSYTDTWIQSNIL  115

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
              Y  T+I  + VGNE+  +P NTT + LVPAM+ +  S++K  L
Sbjct  116  NHYPATEIEAIAVGNEVFVDPKNTTNY-LVPAMKNVHASLQKQNL  159


 Score = 29.6 bits (65),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = +2

Query  125  TVGICYGQLGNNLPTPSR  178
            ++GI YG++ +NLPTPS+
Sbjct  37   SIGINYGRIADNLPTPSK  54



>ref|XP_006853717.1| hypothetical protein AMTR_s00056p00158530 [Amborella trichopoda]
 gb|ERN15184.1| hypothetical protein AMTR_s00056p00158530 [Amborella trichopoda]
Length=548

 Score = 85.5 bits (210),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QLI G   K V+IYD+N ++L+A  N+ +++ + +PN  +   S  Q+ AD WV+ N++
Sbjct  32   VQLIQGHSIKYVRIYDSNIQVLKAFANTGIELMIGIPNADLLAFSQYQSNADTWVKNNIL  91

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            P+Y  TKI Y+ VG E+  +P N +   +VPAM  +  +++K GL 
Sbjct  92   PYYPSTKITYITVGAEVTESPVNVSSL-VVPAMTNVHNALRKAGLN  136


 Score = 33.1 bits (74),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 10/24 (42%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +2

Query  110  ADISATVGICYGQLGNNLPTPSRS  181
            + +++ +GICYG+ G++LPTP ++
Sbjct  8    SSVASIIGICYGRNGDDLPTPDKA  31



>ref|XP_008382596.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Malus domestica]
Length=120

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 52/91 (57%), Gaps = 21/91 (23%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    ++LI  LKAKRVK+YDANPKIL A                     S+Q LAD WV
Sbjct  39   PPSQSVKLIQSLKAKRVKLYDANPKILTA---------------------SNQTLADHWV  77

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTTW  437
             TNVVPFY ET IRYL VGNEILS P    W
Sbjct  78   HTNVVPFYPETLIRYLFVGNEILSQPNKQIW  108



>ref|XP_009794437.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Nicotiana 
sylvestris]
Length=475

 Score = 90.5 bits (223),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    +QL+      RVK+YD +  +L AL  S++ V+V +PNE + + +  Q+  D WV
Sbjct  37   PPAQVVQLLKTQGVNRVKLYDTDSNVLTALSGSNISVTVALPNEQLADAAGKQSFTDSWV  96

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            ++N++ +Y +T+I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+
Sbjct  97   QSNILTYYPKTQIESIAVGNEVFVDPKNTTKF-LVPAMKNMYASLVKYGV  145


 Score = 27.3 bits (59),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTPSR  178
            S ++GI YG++ NNLP P++
Sbjct  21   SGSIGINYGRIANNLPPPAQ  40



>ref|XP_010512954.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=774

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = +3

Query  213  VKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYL  392
            VKIYDANP ILRAL  S++ V++MVPN  IP +  + A A +WV  NV+PF+ + K +YL
Sbjct  59   VKIYDANPNILRALAGSEINVTIMVPNGNIPAMV-NVANARQWVAANVLPFHKQIKFKYL  117

Query  393  LVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             VGNEI ++  N     LVPAM+ + +++K  GL
Sbjct  118  CVGNEIFASNDNNLISNLVPAMQSLNKALKASGL  151



>ref|XP_008230022.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Prunus mume]
Length=344

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 70/104 (67%), Gaps = 1/104 (1%)
 Frame = +3

Query  183  QLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVP  362
            QL+     +RVK++D++P +LRAL  S+++V+V VPNE++ +++  Q+ A  WV+ NVV 
Sbjct  53   QLLKSQGLERVKVFDSDPAVLRALAGSNIKVTVDVPNELLSSVAKSQSFATNWVQRNVVA  112

Query  363  FYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            ++  T+I  + VGNE+  +  NTT F L+PAM+ I  ++  F +
Sbjct  113  YHPNTEIEAIAVGNEVFVDTHNTTKF-LIPAMKNIHTALIHFDI  155



>ref|XP_011044921.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Populus 
euphratica]
Length=476

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + L+      R+K+YD +  +L AL  S + V V +PNE++ ++++DQ+ AD WV+ N+ 
Sbjct  49   VSLLKSQGINRIKLYDTDSDVLTALAGSSINVVVALPNELLSSVAADQSFADSWVKANIS  108

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
              + +TKI  + VGNE+  +P NTT F LVPAM+ +  S+ KF L
Sbjct  109  QHFPQTKIEAIAVGNEVFVDPKNTTPF-LVPAMKNVHNSLVKFNL  152



>ref|XP_006283767.1| hypothetical protein CARUB_v10004853mg [Capsella rubella]
 gb|EOA16665.1| hypothetical protein CARUB_v10004853mg [Capsella rubella]
Length=432

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + L+      R+KIYD +  +L AL NS ++V V +PNE++ + +S+Q+ AD WV+TNV 
Sbjct  20   VNLVKSQGISRIKIYDTDKNVLTALANSGIKVIVALPNELLFSAASNQSFADYWVQTNVT  79

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             ++  T+I  + VGNE+  +P NTT + LVPAM+ I  S+ K+ L
Sbjct  80   SYFPATEIEAIAVGNEVFVDPKNTTPY-LVPAMKNIHTSLVKYNL  123



>ref|XP_010448205.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=457

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 82/146 (56%), Gaps = 10/146 (7%)
 Frame = +3

Query  84   YWPCHL----FPA-QISQLRSEYATVNW---ATTFPHHHDL-QLIHGLKAKRVKIYDANP  236
            + PC L    FP    +   S    VN+   A   P   ++  L+      R+KIYD + 
Sbjct  5    FLPCFLILCLFPTISFTHTESGMIGVNYGRIANNLPSPKNVVSLLKSQGINRIKIYDTDK  64

Query  237  KILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS  416
            K+L AL N+ ++V V +PNE++ + SS+Q+ AD W++TNV   +  T+I  + VGNE+  
Sbjct  65   KVLTALANTGIKVIVALPNELLSSASSNQSFADHWIQTNVASHFPATEIEAIAVGNEVFV  124

Query  417  NPPNTTWFQLVPAMRKIRRSVKKFGL  494
            +P NTT + LVPAM+ I  S+ K  L
Sbjct  125  DPKNTTPY-LVPAMKNIHTSLVKRNL  149



>ref|XP_010433433.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=455

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 81/146 (55%), Gaps = 10/146 (7%)
 Frame = +3

Query  84   YWPCHL----FPA-QISQLRSEYATVNW---ATTFPHHHDL-QLIHGLKAKRVKIYDANP  236
            + PC L    FP    +   S    VN+   A   P   ++  L+      R+KIYD + 
Sbjct  5    FLPCFLILCLFPTISFTHAESGMIGVNYGRIANNLPSPKNVVSLLKSQGISRIKIYDTDK  64

Query  237  KILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS  416
             +L AL NS ++V V +PNE++ + SS+Q+ ADRW++TNV   +  T+I  + VGNE+  
Sbjct  65   NVLAALANSGIKVIVALPNELLSSASSNQSFADRWIQTNVASHFPATEIEAIAVGNEVFV  124

Query  417  NPPNTTWFQLVPAMRKIRRSVKKFGL  494
            +P NTT + L PAM+ I  S+ K  L
Sbjct  125  DPKNTTPY-LDPAMKNIHTSLVKHNL  149



>ref|XP_008364550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14 [Malus domestica]
 ref|XP_008364558.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14 [Malus domestica]
Length=465

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 71/111 (64%), Gaps = 1/111 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    + L+      +VK+YD +  +L AL NS + V V +PNE++ + +SD + AD+WV
Sbjct  41   PPEKVVALLKSQGINKVKLYDTDATVLTALANSGISVVVALPNELLSSAASDPSFADKWV  100

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            ++N+  ++ +T+I  + VGNE+  +P NTT F LVPAM+ I+ S+ K+ L 
Sbjct  101  QSNISHYHPKTQIEAIAVGNEVFVDPNNTTQF-LVPAMKNIQSSLVKYNLS  150



>dbj|BAB17320.1| elicitor inducible beta-1,3-glucanase NtEIG-E76 [Nicotiana tabacum]
Length=467

 Score = 88.6 bits (218),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QL+      R+K+YD +  +L AL  S++ V+V +PNE + + +  Q+  D WV++N++
Sbjct  42   VQLLKTQGVNRIKLYDTDSNVLTALSGSNISVTVALPNEQLSDAAEKQSFTDSWVQSNIL  101

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+
Sbjct  102  TYYPKTLIESIAVGNEVFVDPKNTTKF-LVPAMKNVYASLVKYGV  145


 Score = 28.9 bits (63),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTPSR  178
            S ++GI YG++ NNLP+P++
Sbjct  21   SGSIGINYGRIANNLPSPAQ  40



>ref|XP_010412950.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=561

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 74/122 (61%), Gaps = 5/122 (4%)
 Frame = +3

Query  144  VNWATTFPHHHDLQLIHGLKAK----RVKIYDANPKILRALGNSDVQVSVMVPNEIIPNI  311
            +N+ T        Q++  ++ K     VKIYDANP ILR L  S + V++MVPN +IP +
Sbjct  32   INYGTLGKLQPPQQVVDFIRTKTNFDSVKIYDANPNILRPLAGSKINVTIMVPNGLIPAM  91

Query  312  SSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFG  491
              + A A +WV  NV+PF+ + K +YL VGNEIL++  N     LVPAM+ + +++K  G
Sbjct  92   V-NVANARQWVAANVLPFHQQIKFKYLCVGNEILASNDNNLISNLVPAMQSLHKALKASG  150

Query  492  LR  497
            L 
Sbjct  151  LE  152



>ref|XP_009595038.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Nicotiana 
tomentosiformis]
Length=467

 Score = 88.6 bits (218),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QL+      R+K+YD +  +L AL  S++ V+V +PNE + + +  Q+  D WV++N++
Sbjct  42   VQLLKTQGVNRIKLYDTDSNVLTALSGSNISVTVALPNEQLSDAAEKQSFTDSWVQSNIL  101

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S+ K+G+
Sbjct  102  TYYPKTLIESIAVGNEVFVDPKNTTKF-LVPAMKNVYASLVKYGV  145


 Score = 28.9 bits (63),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTPSR  178
            S ++GI YG++ NNLP+P++
Sbjct  21   SGSIGINYGRIANNLPSPAQ  40



>ref|XP_009334153.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=463

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 71/111 (64%), Gaps = 1/111 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    + L       +VK+YD +  +L AL NS + V V +PNE++ + +SD + AD+WV
Sbjct  39   PPEKVVALFKSQGINKVKLYDTDAAVLTALANSGIGVVVAIPNELLSSAASDPSFADKWV  98

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            ++N+  ++ +T+I  + VGNE+ ++P NTT F LVPA++ I+ S+ K+ L 
Sbjct  99   QSNISQYHPKTQIEAIAVGNEVFADPNNTTQF-LVPAIKNIQSSLVKYNLS  148



>ref|XP_009348307.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=463

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 71/111 (64%), Gaps = 1/111 (1%)
 Frame = +3

Query  165  PHHHDLQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWV  344
            P    + L       +VK+YD +  +L AL NS + V V +PNE++ + +SD + AD+WV
Sbjct  39   PPEKVVALFKSQGINKVKLYDTDAAVLTALANSGIGVVVAIPNELLSSAASDPSFADKWV  98

Query  345  ETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            ++N+  ++ +T+I  + VGNE+ ++P NTT F LVPA++ I+ S+ K+ L 
Sbjct  99   QSNISQYHPKTQIEAIAVGNEVFADPNNTTQF-LVPAIKNIQSSLVKYNLS  148



>ref|XP_004294409.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Fragaria 
vesca subsp. vesca]
Length=464

 Score = 88.6 bits (218),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            + L+       VK+YD +  +L AL +S++ V V +PNE++ + + DQ+ AD+WV+ N+ 
Sbjct  46   VDLLKSQGITNVKLYDTDAAVLTALADSNISVIVCLPNELLSSAAKDQSFADKWVQANIS  105

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y +T+I  + VGNE+L +  N T F LVPAM+ I  S+KK+ L
Sbjct  106  HYYPKTQIEAIAVGNEVLDDKNNATDF-LVPAMKNIHASLKKYNL  149


 Score = 28.1 bits (61),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  128  VGICYGQLGNNLPTPSR  178
            +GI YG++ NNLP P++
Sbjct  28   IGINYGRIANNLPAPTK  44



>ref|XP_006295997.1| hypothetical protein CARUB_v10025141mg [Capsella rubella]
 gb|EOA28895.1| hypothetical protein CARUB_v10025141mg [Capsella rubella]
Length=540

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +3

Query  201  KAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETK  380
            K   VKI+DANP ILR L  +++ V++MVPN  IP +  D A A +WV  NV+PF+ + K
Sbjct  55   KLDSVKIFDANPDILRGLAGTEISVTIMVPNGNIPAMV-DVANARQWVAANVLPFHQQIK  113

Query  381  IRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +YL VGNEIL +  N     LVPAM+ +  ++K  GL
Sbjct  114  FKYLCVGNEILVSKDNNLISNLVPAMKSLNEALKASGL  151



>ref|XP_006413135.1| hypothetical protein EUTSA_v10026799mg [Eutrema salsugineum]
 gb|ESQ54588.1| hypothetical protein EUTSA_v10026799mg [Eutrema salsugineum]
Length=462

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 82/146 (56%), Gaps = 10/146 (7%)
 Frame = +3

Query  84   YWPCHLFPA-----QISQLRSEYATVNW---ATTFPHHHDL-QLIHGLKAKRVKIYDANP  236
            + P  L P+      ++Q  S    VN+   A   P   ++  L+      R+KI+D + 
Sbjct  5    FLPYFLIPSFFSAISLTQADSGMIGVNYGRIANNLPSPENVVNLLKSQGINRIKIFDTDH  64

Query  237  KILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS  416
             +L +L NS ++V V +PNE++ + +SDQ+ AD WV+ N+   +  T+I  + VGNE+  
Sbjct  65   TVLASLANSGIKVVVALPNELLSSAASDQSFADNWVQANITKHFPATEIEAIAVGNEVFV  124

Query  417  NPPNTTWFQLVPAMRKIRRSVKKFGL  494
            +P NTT + LVPAM+ I  S+ KF L
Sbjct  125  DPSNTTPY-LVPAMKNIHSSLVKFNL  149



>gb|EPS69142.1| hypothetical protein M569_05624, partial [Genlisea aurea]
Length=349

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +3

Query  210  RVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRY  389
            RVKI+D NP ILRA  N+ + VSV VPN  IPN+++ +  A RWV  N+ PF+ +T+I Y
Sbjct  53   RVKIFDVNPDILRAFANTGILVSVTVPNGEIPNLTNIR-YARRWVSVNIKPFHPQTRINY  111

Query  390  LLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
            +LVGNEIL   P      LV AM+ + R++ + G+R
Sbjct  112  ILVGNEILHWGPQAAVDNLVLAMKTLHRALNREGIR  147



>ref|XP_010541008.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Tarenaya hassleriana]
Length=535

 Score = 84.0 bits (206),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 64/104 (62%), Gaps = 1/104 (1%)
 Frame = +3

Query  183  QLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVP  362
            +LI  L  K V+IYDAN  +L+A  N+ V++ + VPN  +   S  Q+  D W++ N++P
Sbjct  47   ELIQQLSIKYVRIYDANIDVLKAFSNTGVELMIGVPNSDLLAFSQFQSNVDSWLKNNILP  106

Query  363  FYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            +Y  TKI Y+ VG E+   P N T   +VPAMR I  +++K GL
Sbjct  107  YYPATKINYISVGLEVTEAPDNATGL-VVPAMRNIHTALRKAGL  149


 Score = 32.3 bits (72),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  119  SATVGICYGQLGNNLPTPSR  178
            ++T+GICYG+  +NLP+P R
Sbjct  25   ASTIGICYGRNADNLPSPDR  44



>ref|XP_002274828.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Vitis vinifera]
Length=471

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QL+     +RVK++D +P +L+ALG S ++V+V +PNE++ + +  Q+ A+ WV+ NV 
Sbjct  42   VQLLKSQGIERVKVFDTDPAVLKALGESGIKVTVDLPNELLISAAKRQSFANTWVQKNVA  101

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             ++  TKI  + VGNE+  +P NTT   LVPA++ I +++ K+ L
Sbjct  102  DYFPATKIEAIAVGNEVFVDPHNTT-LSLVPALKNIHKALVKYNL  145



>ref|XP_007215327.1| hypothetical protein PRUPE_ppa005206mg [Prunus persica]
 gb|EMJ16526.1| hypothetical protein PRUPE_ppa005206mg [Prunus persica]
Length=472

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QL+     +RVK++D++P +LRAL  S+++V+V VPNE++ +++  Q+ A  WV+ NVV
Sbjct  43   MQLLKSQGLERVKVFDSDPAVLRALAGSNIKVTVDVPNELLSSVAKSQSFATNWVQRNVV  102

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             ++  T+I  + VGNE+  +  NTT F L+PAM+ I  ++  F +
Sbjct  103  AYHPNTQIEAIAVGNEVFVDTHNTTKF-LIPAMKNIHTALIHFDI  146



>ref|XP_004149346.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 gb|KGN56102.1| hypothetical protein Csa_3G073920 [Cucumis sativus]
Length=458

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 66/102 (65%), Gaps = 3/102 (3%)
 Frame = +3

Query  192  HGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYG  371
            HG+   R+K++D    +L AL NS++ V V +PNE + + +SD +  D WV++N+  FY 
Sbjct  48   HGID--RIKLFDTESTVLTALSNSNISVVVSLPNEYLSSAASDPSFTDNWVQSNISHFYP  105

Query  372  ETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
             TKI  + VGNE+  +P NTT F LVPAM+ +  S++KF L 
Sbjct  106  STKIDAIAVGNEVFVDPNNTTNF-LVPAMKNVYASLQKFNLH  146



>ref|XP_004161885.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
13-like [Cucumis sativus]
Length=458

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 66/102 (65%), Gaps = 3/102 (3%)
 Frame = +3

Query  192  HGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYG  371
            HG+   R+K++D    +L AL NS++ V V +PNE + + +SD +  D WV++N+  FY 
Sbjct  48   HGID--RIKLFDTESTVLTALSNSNISVVVSLPNEYLSSAASDPSFTDNWVQSNISHFYP  105

Query  372  ETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
             TKI  + VGNE+  +P NTT F LVPAM+ +  S++KF L 
Sbjct  106  STKIDAIAVGNEVFVDPNNTTNF-LVPAMKNVYASLQKFNLH  146



>emb|CDY20461.1| BnaC04g05830D [Brassica napus]
Length=450

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = +3

Query  183  QLIHGLKAK----RVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVET  350
            Q++  +K K     VKIYDANP ILRAL  + + V++MVPN  IP +++ +  A +WV  
Sbjct  45   QVVDFIKTKTIIDSVKIYDANPDILRALSGTGIDVTIMVPNGNIPALANVEN-ARQWVGA  103

Query  351  NVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
            NV+PF+ +TKI+Y+ VGNEIL    N     L+PAM+ +  ++K  GL
Sbjct  104  NVLPFHQQTKIKYICVGNEILLTKDNNLISNLIPAMQSLHEALKVSGL  151



>gb|KDP30806.1| hypothetical protein JCGZ_13749 [Jatropha curcas]
Length=469

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = +3

Query  180  LQLIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVV  359
            +QL+     +RVK++DA+P +L+AL  S ++V+V +PNE++ + +  Q+ A  WV+ N+ 
Sbjct  42   VQLLKSQGLQRVKVFDADPAVLKALSGSSIKVTVDLPNELLYSAAKRQSFALSWVQRNIA  101

Query  360  PFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGL  494
             +Y  T+I  + VGNE+  +P NTT F L+PAM+ I ++++K  L
Sbjct  102  AYYPSTQIEAIAVGNEVFVDPHNTTKF-LIPAMKNIHQALEKLNL  145



>ref|XP_008385844.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Malus domestica]
Length=454

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = +3

Query  189  IHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFY  368
            I G+   +VK+YD +  +L AL NS + V V +PNE++ + +SD + AD+WV++N+  ++
Sbjct  49   IQGIN--KVKLYDTDAAVLTALANSGIGVVVALPNELLSSAASDPSFADKWVQSNISQYH  106

Query  369  GETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLR  497
             +T+I  + VGNE+ ++P NTT F LVPA++ I+ S+ K+ L 
Sbjct  107  PKTQIEAIAVGNEVFADPNNTTQF-LVPAIKNIQSSLVKYNLS  148



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567283606695