BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF022P17

Length=509
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009602562.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    272   5e-85   Nicotiana tomentosiformis
dbj|BAL14273.1|  FK506-binding protein                                  272   5e-85   Nicotiana tabacum [American tobacco]
ref|XP_009803135.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    269   8e-84   Nicotiana sylvestris
gb|KJB08782.1|  hypothetical protein B456_001G103400                    267   1e-83   Gossypium raimondii
ref|XP_004242423.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    268   2e-83   
gb|KJB08781.1|  hypothetical protein B456_001G103400                    268   2e-83   Gossypium raimondii
gb|KJB08784.1|  hypothetical protein B456_001G103400                    268   2e-83   Gossypium raimondii
ref|XP_010247135.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    267   5e-83   Nelumbo nucifera [Indian lotus]
ref|XP_010247134.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    267   6e-83   Nelumbo nucifera [Indian lotus]
ref|XP_006363451.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    266   7e-83   Solanum tuberosum [potatoes]
ref|XP_009610546.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    266   1e-82   Nicotiana tomentosiformis
ref|XP_009787495.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    266   1e-82   Nicotiana sylvestris
ref|XP_007049647.1|  Rotamase FKBP 1 isoform 2                          263   2e-82   
ref|XP_002263566.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    265   3e-82   Vitis vinifera
ref|XP_007049646.1|  Rotamase FKBP 1 isoform 1                          265   3e-82   
gb|KDO40263.1|  hypothetical protein CISIN_1g008113mg                   264   6e-82   Citrus sinensis [apfelsine]
gb|KDO40268.1|  hypothetical protein CISIN_1g008113mg                   262   6e-82   Citrus sinensis [apfelsine]
gb|KDO40265.1|  hypothetical protein CISIN_1g008113mg                   264   7e-82   Citrus sinensis [apfelsine]
ref|XP_006437244.1|  hypothetical protein CICLE_v10031088mg             263   8e-82   
ref|XP_006437245.1|  hypothetical protein CICLE_v10031088mg             264   8e-82   Citrus clementina [clementine]
gb|KDO40262.1|  hypothetical protein CISIN_1g008113mg                   264   8e-82   Citrus sinensis [apfelsine]
ref|XP_006352668.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    264   8e-82   Solanum tuberosum [potatoes]
gb|KDO40267.1|  hypothetical protein CISIN_1g008113mg                   262   8e-82   Citrus sinensis [apfelsine]
gb|KDO40264.1|  hypothetical protein CISIN_1g008113mg                   263   1e-81   Citrus sinensis [apfelsine]
gb|KDO40266.1|  hypothetical protein CISIN_1g008113mg                   263   1e-81   Citrus sinensis [apfelsine]
ref|XP_010647328.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    264   2e-81   
gb|KDP45275.1|  hypothetical protein JCGZ_15140                         262   3e-81   Jatropha curcas
ref|XP_004247044.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    262   3e-81   Solanum lycopersicum
gb|KJB42561.1|  hypothetical protein B456_007G157600                    258   5e-81   Gossypium raimondii
gb|KJB42564.1|  hypothetical protein B456_007G157600                    260   6e-81   Gossypium raimondii
gb|KHG19334.1|  Peptidyl-prolyl cis-trans isomerase FKBP62 -like ...    261   1e-80   Gossypium arboreum [tree cotton]
gb|KJB42563.1|  hypothetical protein B456_007G157600                    261   1e-80   Gossypium raimondii
gb|KJB42562.1|  hypothetical protein B456_007G157600                    261   1e-80   Gossypium raimondii
gb|KJB42560.1|  hypothetical protein B456_007G157600                    256   2e-80   Gossypium raimondii
gb|KJB42559.1|  hypothetical protein B456_007G157600                    259   5e-80   Gossypium raimondii
ref|XP_002535081.1|  peptidylprolyl isomerase, putative                 258   1e-79   Ricinus communis
ref|XP_009410619.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    258   1e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010905157.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    257   4e-79   
ref|XP_010905156.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    257   4e-79   Elaeis guineensis
ref|XP_002534361.1|  peptidylprolyl isomerase, putative                 257   5e-79   
ref|XP_008778812.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    256   1e-78   Phoenix dactylifera
ref|XP_008458076.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    254   3e-78   Cucumis melo [Oriental melon]
ref|XP_009372201.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    254   4e-78   Pyrus x bretschneideri [bai li]
emb|CDP03935.1|  unnamed protein product                                254   5e-78   Coffea canephora [robusta coffee]
ref|XP_011089642.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    253   1e-77   Sesamum indicum [beniseed]
ref|XP_009385667.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    253   1e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008794657.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    253   2e-77   Phoenix dactylifera
ref|XP_002301809.1|  hypothetical protein POPTR_0002s24970g             251   5e-77   Populus trichocarpa [western balsam poplar]
ref|XP_011024591.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    250   7e-77   Populus euphratica
ref|XP_008372538.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    251   8e-77   Malus domestica [apple tree]
ref|XP_006840897.1|  hypothetical protein AMTR_s00087p00078190          251   1e-76   Amborella trichopoda
ref|XP_011024590.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    250   1e-76   Populus euphratica
gb|EPS59147.1|  hypothetical protein M569_15662                         238   2e-76   Genlisea aurea
ref|XP_009349114.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    249   3e-76   Pyrus x bretschneideri [bai li]
ref|XP_010036768.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    249   4e-76   Eucalyptus grandis [rose gum]
gb|KJB37905.1|  hypothetical protein B456_006G225400                    249   4e-76   Gossypium raimondii
gb|KJB37901.1|  hypothetical protein B456_006G225400                    249   4e-76   Gossypium raimondii
ref|XP_010036767.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    249   5e-76   Eucalyptus grandis [rose gum]
gb|KJB37902.1|  hypothetical protein B456_006G225400                    246   5e-76   Gossypium raimondii
gb|KJB37904.1|  hypothetical protein B456_006G225400                    248   5e-76   Gossypium raimondii
gb|KJB37903.1|  hypothetical protein B456_006G225400                    246   5e-76   Gossypium raimondii
gb|KHF97531.1|  Peptidyl-prolyl cis-trans isomerase FKBP65 -like ...    248   1e-75   Gossypium arboreum [tree cotton]
ref|XP_007134161.1|  hypothetical protein PHAVU_010G024500g             248   1e-75   Phaseolus vulgaris [French bean]
emb|CDP15134.1|  unnamed protein product                                248   1e-75   Coffea canephora [robusta coffee]
ref|XP_008792944.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    247   2e-75   Phoenix dactylifera
ref|XP_004510236.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    247   2e-75   Cicer arietinum [garbanzo]
emb|CDX85348.1|  BnaC07g26590D                                          247   2e-75   
gb|EYU39186.1|  hypothetical protein MIMGU_mgv1a003614mg                247   2e-75   Erythranthe guttata [common monkey flower]
ref|XP_004492269.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    246   4e-75   Cicer arietinum [garbanzo]
emb|CDX86295.1|  BnaA06g30120D                                          246   5e-75   
ref|XP_009151655.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    246   7e-75   Brassica rapa
ref|XP_010547132.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    245   1e-74   Tarenaya hassleriana [spider flower]
ref|XP_008382577.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    244   2e-74   
gb|EMT25795.1|  70 kDa peptidyl-prolyl isomerase                        244   6e-74   
ref|XP_008439052.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    243   1e-73   Cucumis melo [Oriental melon]
ref|XP_010482107.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    242   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010550903.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   2e-73   Tarenaya hassleriana [spider flower]
emb|CDY15104.1|  BnaC03g44650D                                          233   3e-73   Brassica napus [oilseed rape]
ref|XP_004975324.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    242   4e-73   Setaria italica
gb|KGN57238.1|  hypothetical protein Csa_3G172920                       241   5e-73   Cucumis sativus [cucumbers]
ref|XP_004160641.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   5e-73   
ref|XP_004147650.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   5e-73   
ref|XP_002883594.1|  peptidylprolyl isomerase                           240   8e-73   
gb|ABK24451.1|  unknown                                                 240   1e-72   Picea sitchensis
emb|CDY52281.1|  BnaA03g57740D                                          240   1e-72   Brassica napus [oilseed rape]
dbj|BAK01956.1|  predicted protein                                      240   1e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY15103.1|  BnaC03g44640D                                          239   1e-72   Brassica napus [oilseed rape]
ref|XP_009406340.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    240   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010532918.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    240   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_002321107.2|  hypothetical protein POPTR_0014s14690g             240   1e-72   
gb|KHN10949.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              239   2e-72   Glycine soja [wild soybean]
ref|XP_010442282.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    239   2e-72   
ref|XP_011000006.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    239   2e-72   Populus euphratica
gb|KDP32575.1|  hypothetical protein JCGZ_13125                         239   4e-72   Jatropha curcas
ref|XP_006375512.1|  hypothetical protein POPTR_0014s14690g             239   4e-72   
ref|XP_006297572.1|  hypothetical protein CARUB_v10013595mg             236   4e-72   
ref|XP_003552100.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    238   4e-72   Glycine max [soybeans]
ref|XP_011000005.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    239   5e-72   Populus euphratica
ref|XP_004149324.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    238   6e-72   Cucumis sativus [cucumbers]
gb|ABK95085.1|  unknown                                                 239   7e-72   Populus trichocarpa [western balsam poplar]
gb|EMS57053.1|  70 kDa peptidyl-prolyl isomerase                        238   7e-72   Triticum urartu
ref|XP_008222791.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    238   9e-72   Prunus mume [ume]
gb|KHG01160.1|  Peptidyl-prolyl cis-trans isomerase FKBP65 -like ...    238   1e-71   Gossypium arboreum [tree cotton]
ref|XP_004975323.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    240   1e-71   
gb|KHN21278.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              233   1e-71   Glycine soja [wild soybean]
ref|XP_007222365.1|  hypothetical protein PRUPE_ppa003399mg             237   1e-71   Prunus persica
ref|XP_006659596.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    237   1e-71   Oryza brachyantha
gb|AGT17361.1|  peptidylprolyl isomerase                                238   1e-71   Saccharum hybrid cultivar R570
ref|XP_007140683.1|  hypothetical protein PHAVU_008G133100g             236   1e-71   Phaseolus vulgaris [French bean]
ref|XP_009136108.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    236   2e-71   Brassica rapa
ref|XP_010493687.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    236   3e-71   Camelina sativa [gold-of-pleasure]
ref|NP_001062292.1|  Os08g0525600                                       236   3e-71   
gb|KJB71964.1|  hypothetical protein B456_011G150600                    237   3e-71   Gossypium raimondii
gb|KJB71963.1|  hypothetical protein B456_011G150600                    237   3e-71   Gossypium raimondii
ref|XP_004296967.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    236   3e-71   Fragaria vesca subsp. vesca
ref|XP_004504385.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    236   3e-71   
gb|EEC83911.1|  hypothetical protein OsI_29964                          236   4e-71   Oryza sativa Indica Group [Indian rice]
ref|XP_004504386.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    236   4e-71   Cicer arietinum [garbanzo]
ref|XP_010023594.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    236   5e-71   Eucalyptus grandis [rose gum]
ref|XP_010023593.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    236   7e-71   Eucalyptus grandis [rose gum]
ref|XP_006280236.1|  hypothetical protein CARUB_v10026151mg             235   1e-70   Capsella rubella
ref|XP_002865651.1|  hypothetical protein ARALYDRAFT_494919             234   1e-70   
gb|AFK48238.1|  unknown                                                 234   1e-70   Lotus japonicus
ref|XP_008669632.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    234   2e-70   Zea mays [maize]
ref|XP_006358774.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    233   7e-70   Solanum tuberosum [potatoes]
ref|XP_007034164.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    232   1e-69   
ref|XP_007034165.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    230   2e-69   
ref|XP_006418643.1|  hypothetical protein EUTSA_v10002468mg             231   3e-69   Eutrema salsugineum [saltwater cress]
gb|KEH20636.1|  peptidyl-prolyl cis-trans isomerase FKBP62-like p...    231   3e-69   Medicago truncatula
ref|XP_007034162.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    231   4e-69   
ref|XP_007034163.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    231   4e-69   
ref|NP_001052535.1|  Os04g0352400                                       231   5e-69   
dbj|BAH19789.1|  AT5G48570                                              226   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199668.1|  peptidyl-prolyl cis-trans isomerase FKBP65            229   2e-68   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99990.1|  peptidylprolyl isomerase                               229   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003579568.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    229   3e-68   Brachypodium distachyon [annual false brome]
ref|XP_010466944.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    228   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010488634.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    228   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_002436973.1|  hypothetical protein SORBIDRAFT_10g012970          228   5e-68   Sorghum bicolor [broomcorn]
gb|KJB28026.1|  hypothetical protein B456_005G022600                    225   8e-68   Gossypium raimondii
ref|XP_004290160.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    227   9e-68   Fragaria vesca subsp. vesca
ref|XP_010100792.1|  Peptidyl-prolyl cis-trans isomerase FKBP62         226   1e-67   
ref|XP_004247908.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    227   1e-67   
ref|XP_010514063.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    226   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009420312.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    226   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006395163.1|  hypothetical protein EUTSA_v10003906mg             226   3e-67   Eutrema salsugineum [saltwater cress]
ref|XP_010552023.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   5e-67   Tarenaya hassleriana [spider flower]
ref|XP_004973965.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    224   7e-67   
ref|XP_002977259.1|  hypothetical protein SELMODRAFT_443450             224   9e-67   Selaginella moellendorffii
gb|ACJ85592.1|  unknown                                                 223   1e-66   Medicago truncatula
tpg|DAA48149.1|  TPA: hypothetical protein ZEAMMB73_593378              221   1e-66   
gb|AFK48961.1|  unknown                                                 223   1e-66   Medicago truncatula
ref|XP_008244682.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   1e-66   Prunus mume [ume]
gb|KEH22557.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           223   1e-66   Medicago truncatula
ref|XP_006652190.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    224   1e-66   
ref|NP_001149790.1|  LOC100283417                                       223   1e-66   Zea mays [maize]
ref|XP_007200299.1|  hypothetical protein PRUPE_ppa003471mg             224   2e-66   Prunus persica
tpg|DAA48153.1|  TPA: hypothetical protein ZEAMMB73_593378              222   2e-66   
tpg|DAA48152.1|  TPA: hypothetical protein ZEAMMB73_593378              223   2e-66   
gb|EEE57017.1|  hypothetical protein OsJ_06790                          224   3e-66   Oryza sativa Japonica Group [Japonica rice]
gb|EEC73201.1|  hypothetical protein OsI_07270                          224   3e-66   Oryza sativa Indica Group [Indian rice]
dbj|BAB02082.1|  peptidylprolyl isomerase; FK506-binding protein        223   3e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AAB82061.1|  rof1                                                    223   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189160.3|  rotamase FKBP 1                                       223   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001118695.1|  rotamase FKBP 1                                    222   5e-66   Arabidopsis thaliana [mouse-ear cress]
gb|EYU40640.1|  hypothetical protein MIMGU_mgv1a003616mg                222   8e-66   Erythranthe guttata [common monkey flower]
ref|NP_001046873.1|  Os02g0491400                                       224   1e-65   
ref|XP_004952509.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    223   3e-65   Setaria italica
ref|XP_002992143.1|  hypothetical protein SELMODRAFT_134839             220   6e-65   
gb|KHN44911.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              220   7e-65   Glycine soja [wild soybean]
ref|XP_003520990.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    219   8e-65   Glycine max [soybeans]
ref|XP_003547780.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    219   2e-64   Glycine max [soybeans]
ref|XP_003626943.1|  70 kDa peptidyl-prolyl isomerase                   219   2e-64   Medicago truncatula
ref|XP_002453845.1|  hypothetical protein SORBIDRAFT_04g019590          219   4e-64   Sorghum bicolor [broomcorn]
emb|CAA68913.1|  peptidylprolyl isomerase                               217   8e-64   Triticum aestivum [Canadian hard winter wheat]
gb|AFK35673.1|  unknown                                                 217   9e-64   Medicago truncatula
emb|CDY15096.1|  BnaC03g44570D                                          218   2e-63   Brassica napus [oilseed rape]
ref|XP_010685108.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    215   3e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003524915.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    213   2e-62   Glycine max [soybeans]
ref|XP_003574982.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    214   2e-62   Brachypodium distachyon [annual false brome]
ref|XP_008352304.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    213   2e-62   Malus domestica [apple tree]
ref|XP_007153782.1|  hypothetical protein PHAVU_003G064500g             212   4e-62   Phaseolus vulgaris [French bean]
ref|XP_009373610.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    212   4e-62   Pyrus x bretschneideri [bai li]
ref|XP_011084142.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    213   8e-62   Sesamum indicum [beniseed]
gb|AFW71473.2|  peptidyl-prolyl isomerase                               211   3e-61   
ref|NP_001151484.1|  LOC100285117                                       211   6e-61   Zea mays [maize]
gb|ACN30883.1|  unknown                                                 211   6e-61   Zea mays [maize]
ref|XP_006492988.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    208   2e-60   
gb|EMS49100.1|  70 kDa peptidyl-prolyl isomerase                        209   2e-60   Triticum urartu
dbj|BAJ95453.1|  predicted protein                                      207   6e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003532733.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    205   2e-59   Glycine max [soybeans]
gb|KHN12365.1|  Peptidyl-prolyl cis-trans isomerase FKBP65              205   2e-59   Glycine soja [wild soybean]
ref|XP_003574798.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase        204   5e-59   Brachypodium distachyon [annual false brome]
dbj|BAK02378.1|  predicted protein                                      202   2e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT24309.1|  70 kDa peptidyl-prolyl isomerase                        201   1e-57   
pdb|3JYM|A  Chain A, Crystal Structure Of The 3 Fkbp Domains Of W...    192   4e-56   Triticum aestivum [Canadian hard winter wheat]
sp|Q43207.1|FKB70_WHEAT  RecName: Full=70 kDa peptidyl-prolyl iso...    195   1e-55   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002979133.1|  hypothetical protein SELMODRAFT_110584             195   1e-55   
ref|XP_002988507.1|  hypothetical protein SELMODRAFT_183937             194   2e-55   
pdb|3JXV|A  Chain A, Crystal Structure Of The 3 Fkbp Domains Of W...    189   4e-55   Triticum aestivum [Canadian hard winter wheat]
gb|EMT19050.1|  70 kDa peptidyl-prolyl isomerase                        189   7e-53   
ref|XP_001769063.1|  predicted protein                                  186   3e-52   
ref|XP_010244430.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    182   7e-51   Nelumbo nucifera [Indian lotus]
ref|XP_006380967.1|  hypothetical protein POPTR_0006s03190g             181   9e-51   
ref|XP_011040721.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    177   2e-49   Populus euphratica
ref|XP_002982601.1|  hypothetical protein SELMODRAFT_445274             174   5e-48   Selaginella moellendorffii
ref|XP_002993334.1|  hypothetical protein SELMODRAFT_449100             174   5e-48   Selaginella moellendorffii
gb|KDP41599.1|  hypothetical protein JCGZ_16006                         172   3e-47   Jatropha curcas
ref|XP_011079092.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    171   5e-47   
ref|XP_010273188.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    167   4e-46   
ref|XP_009764942.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    169   4e-46   Nicotiana sylvestris
ref|XP_009764944.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    169   4e-46   Nicotiana sylvestris
ref|XP_009596526.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   5e-46   
ref|XP_009764948.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   5e-46   Nicotiana sylvestris
ref|XP_009764943.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    168   5e-46   Nicotiana sylvestris
ref|XP_009764947.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   6e-46   Nicotiana sylvestris
ref|XP_009596524.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    168   6e-46   Nicotiana tomentosiformis
ref|XP_009596525.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    168   7e-46   Nicotiana tomentosiformis
ref|XP_009764945.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    168   8e-46   Nicotiana sylvestris
ref|XP_009764949.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    168   8e-46   Nicotiana sylvestris
ref|XP_010273182.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    169   8e-46   Nelumbo nucifera [Indian lotus]
ref|XP_002499621.1|  fkbp-type peptidyl-prolyl cis-trans isomerase      168   9e-46   Micromonas commoda
emb|CBI32825.3|  unnamed protein product                                165   1e-45   Vitis vinifera
ref|XP_006364803.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    167   2e-45   
gb|EYU20825.1|  hypothetical protein MIMGU_mgv1a004220mg                167   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_002947775.1|  hypothetical protein VOLCADRAFT_103560             167   2e-45   Volvox carteri f. nagariensis
ref|XP_010653645.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    166   2e-45   Vitis vinifera
ref|XP_010061642.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    167   4e-45   Eucalyptus grandis [rose gum]
gb|KJB53362.1|  hypothetical protein B456_009G2211001                   162   1e-44   Gossypium raimondii
gb|KDP24694.1|  hypothetical protein JCGZ_26469                         164   1e-44   Jatropha curcas
ref|XP_003520475.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    164   1e-44   Glycine max [soybeans]
gb|KJB53364.1|  hypothetical protein B456_009G2211001                   162   1e-44   Gossypium raimondii
ref|XP_007018460.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    165   2e-44   
ref|XP_008790247.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    164   3e-44   Phoenix dactylifera
ref|XP_010111217.1|  Peptidyl-prolyl cis-trans isomerase FKBP65         163   4e-44   
ref|XP_002283423.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase        162   1e-43   Vitis vinifera
ref|XP_006482027.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    161   2e-43   Citrus sinensis [apfelsine]
gb|KDD74899.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           161   3e-43   Helicosporidium sp. ATCC 50920
ref|XP_006430496.1|  hypothetical protein CICLE_v10011447mg             161   3e-43   
ref|XP_007162035.1|  hypothetical protein PHAVU_001G118200g             161   4e-43   Phaseolus vulgaris [French bean]
ref|XP_010327744.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    160   4e-43   Solanum lycopersicum
gb|KHG02788.1|  Peptidyl-prolyl cis-trans isomerase FKBP65 -like ...    161   4e-43   Gossypium arboreum [tree cotton]
ref|XP_010936158.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    161   4e-43   
ref|XP_011074339.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    161   4e-43   Sesamum indicum [beniseed]
ref|XP_011397815.1|  Peptidyl-prolyl cis-trans isomerase FKBP62         160   5e-43   Auxenochlorella protothecoides
ref|XP_011074340.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    160   5e-43   Sesamum indicum [beniseed]
ref|XP_010936157.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    160   6e-43   Elaeis guineensis
ref|XP_010327743.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    160   6e-43   
ref|XP_002302401.1|  peptidyl-prolyl cis-trans isomerase FKBP-typ...    160   6e-43   
ref|XP_004493326.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    159   9e-43   Cicer arietinum [garbanzo]
ref|XP_006472323.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    159   1e-42   Citrus sinensis [apfelsine]
gb|KFG33606.1|  peptidyl-prolyl cis-trans isomerase                     157   2e-42   Toxoplasma gondii FOU
ref|XP_003058204.1|  fkbp-type peptidyl-prolyl cis-trans isomerase      159   2e-42   Micromonas pusilla CCMP1545
gb|KDO81460.1|  hypothetical protein CISIN_1g0137552mg                  152   2e-42   Citrus sinensis [apfelsine]
ref|XP_011017099.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    159   2e-42   Populus euphratica
ref|XP_011013750.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    159   3e-42   Populus euphratica
ref|XP_008547908.1|  PREDICTED: FK506-binding protein 59                157   4e-42   Microplitis demolitor
ref|XP_010096077.1|  Peptidyl-prolyl cis-trans isomerase FKBP65         158   5e-42   Morus notabilis
ref|XP_010090815.1|  Peptidyl-prolyl cis-trans isomerase FKBP65         158   5e-42   Morus notabilis
ref|XP_010673091.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    157   9e-42   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP01264.1|  unnamed protein product                                157   1e-41   Coffea canephora [robusta coffee]
ref|XP_010646636.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    146   1e-41   Vitis vinifera
ref|XP_005845726.1|  hypothetical protein CHLNCDRAFT_36304              157   1e-41   Chlorella variabilis
gb|ESS30489.1|  peptidyl-prolyl cis-trans isomerase                     156   1e-41   Toxoplasma gondii VEG
emb|CBY23605.1|  unnamed protein product                                154   1e-41   Oikopleura dioica
emb|CBY35372.1|  unnamed protein product                                154   1e-41   Oikopleura dioica
ref|XP_008888049.1|  peptidyl-prolyl cis-trans isomerase                156   1e-41   
ref|XP_002369134.1|  peptidyl-prolyl isomerase, putative                156   1e-41   
gb|EPT30931.1|  peptidyl-prolyl cis-trans isomerase                     156   1e-41   Toxoplasma gondii ME49
gb|EPR59296.1|  peptidyl-prolyl cis-trans isomerase                     155   2e-41   Toxoplasma gondii GT1
ref|XP_006647293.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    156   2e-41   
ref|XP_002526205.1|  peptidylprolyl isomerase, putative                 155   2e-41   
ref|XP_004925303.1|  PREDICTED: FK506-binding protein 59-like           149   2e-41   
ref|XP_003883131.1|  Peptidylprolyl isomerase D (Cyclophilin D),r...    154   6e-41   Neospora caninum Liverpool
ref|XP_004338843.1|  peptidylprolyl cis-trans isomerase, FKBP-typ...    152   7e-41   Acanthamoeba castellanii str. Neff
ref|XP_002108502.1|  hypothetical protein TRIADDRAFT_51478              152   2e-40   Trichoplax adhaerens
ref|XP_006610563.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    151   2e-40   Apis dorsata [rock honeybee]
ref|XP_006563315.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    151   2e-40   Apis mellifera [bee]
ref|XP_003425066.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    152   2e-40   Nasonia vitripennis
ref|XP_006433656.1|  hypothetical protein CICLE_v10003372mg             153   3e-40   
gb|KCW47938.1|  hypothetical protein EUGRSUZ_K01672                     151   3e-40   
ref|XP_009412296.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    153   3e-40   
ref|XP_011269873.1|  PREDICTED: FK506-binding protein 59                152   3e-40   
gb|KFG63419.1|  peptidyl-prolyl cis-trans isomerase                     144   3e-40   
ref|NP_001036992.1|  FK506-binding protein FKBP59 homologue             151   4e-40   
ref|XP_010038854.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    152   6e-40   
ref|XP_011134873.1|  PREDICTED: FK506-binding protein 59-like iso...    151   6e-40   
ref|XP_008192785.1|  PREDICTED: FK506-binding protein 59                151   6e-40   
ref|XP_395748.2|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    151   6e-40   
ref|XP_006610562.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    151   6e-40   
ref|XP_011134875.1|  PREDICTED: FK506-binding protein 59-like iso...    151   6e-40   
ref|XP_006356849.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    150   2e-39   
gb|ERL93953.1|  hypothetical protein D910_11239                         146   2e-39   
ref|XP_003704657.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    149   2e-39   
gb|ENN71324.1|  hypothetical protein YQE_11984                          147   2e-39   
ref|XP_011335898.1|  PREDICTED: FK506-binding protein 59                149   2e-39   
ref|XP_005091067.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    149   3e-39   
ref|XP_011495235.1|  PREDICTED: FK506-binding protein 59                149   4e-39   
ref|XP_007221858.1|  hypothetical protein PRUPE_ppa019344mg             149   4e-39   
ref|XP_003690671.1|  PREDICTED: FK506-binding protein 59-like           148   6e-39   
ref|XP_005091066.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    148   7e-39   
ref|XP_003402736.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    148   9e-39   
ref|XP_003489581.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   1e-38   
ref|XP_005536149.1|  probable peptidylprolyl isomerase                  149   1e-38   
ref|XP_008220384.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    148   1e-38   
ref|XP_011157100.1|  PREDICTED: FK506-binding protein 59 isoform X1     146   2e-38   
ref|XP_004238080.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   2e-38   
ref|XP_011130643.1|  putative peptidyl-prolyl cis-trans isomerase       143   2e-38   
emb|CEF99577.1|  Peptidyl-prolyl cis-trans isomerase,FKBP-type,do...    147   4e-38   
gb|KEH19113.1|  peptidyl-prolyl cis-trans isomerase, FKBP-type pr...    147   4e-38   
gb|KDR19080.1|  FK506-binding protein 4                                 146   4e-38   
ref|XP_011157101.1|  PREDICTED: FK506-binding protein 59 isoform X2     145   5e-38   
gb|EFZ19736.1|  hypothetical protein SINV_08536                         145   6e-38   
ref|XP_002155592.1|  PREDICTED: 12 kDa FK506-binding protein-like       137   7e-38   
ref|XP_002510075.1|  peptidylprolyl isomerase, putative                 146   9e-38   
gb|EHJ66575.1|  hypothetical protein KGM_01971                          145   1e-37   
ref|XP_007509540.1|  predicted protein                                  146   2e-37   
ref|XP_010698135.1|  peptidylprolyl isomerase-like protein              144   2e-37   
ref|XP_002668164.1|  predicted protein                                  135   3e-37   
ref|XP_003384075.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    144   4e-37   
ref|XP_011436909.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    143   4e-37   
ref|XP_006857116.1|  hypothetical protein AMTR_s00065p00132670          144   4e-37   
ref|XP_001564272.1|  peptidylprolyl isomerase-like protein              142   5e-37   
ref|XP_005703171.1|  FK506-binding protein 4/5                          144   5e-37   
gb|EWM25243.1|  hypothetical protein Naga_101074g2                      137   5e-37   
ref|XP_010553660.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase ...    142   6e-37   
ref|XP_002901163.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    134   6e-37   
ref|XP_010553659.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase ...    143   7e-37   
ref|XP_001465122.1|  peptidylprolyl isomerase-like protein              142   8e-37   
gb|ETI53727.1|  hypothetical protein F443_03378                         134   8e-37   
gb|ETN60901.1|  fk506-binding protein                                   142   9e-37   
ref|XP_005716257.1|  TPR repeat-containing protein                      143   1e-36   
ref|XP_011436901.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    142   1e-36   
ref|XP_001682742.1|  peptidylprolyl isomerase-like protein              141   1e-36   
gb|KFB39023.1|  AGAP009347-PA-like protein                              141   2e-36   
ref|WP_038017242.1|  peptidylprolyl isomerase                           135   2e-36   
ref|WP_015193184.1|  peptidylprolyl isomerase FKBP-type                 135   2e-36   
ref|XP_001654614.1|  AAEL010491-PA                                      140   3e-36   
ref|XP_001443165.1|  hypothetical protein                               132   3e-36   
gb|EDX83889.1|  peptidyl-prolyl cis-trans isomerase, FKBP-type do...    135   3e-36   
ref|XP_008864835.1|  hypothetical protein H310_02921                    140   4e-36   
ref|XP_001865043.1|  FK506-binding protein 59                           140   4e-36   
ref|WP_009630420.1|  FKBP-type peptidyl-prolyl cis-trans isomerase      134   4e-36   
emb|CBI40946.3|  unnamed protein product                                132   4e-36   
ref|XP_009520077.1|  hypothetical protein PHYSODRAFT_539794             132   4e-36   
ref|XP_002680624.1|  predicted protein                                  140   4e-36   
gb|EET00236.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           132   5e-36   
ref|WP_036478811.1|  peptidylprolyl isomerase                           134   6e-36   
ref|XP_001654613.1|  AAEL010491-PB                                      140   7e-36   
emb|CDN15230.1|  FKBP-type peptidyl-prolyl cis-trans isomerase          132   7e-36   
ref|WP_039714223.1|  peptidylprolyl isomerase                           134   7e-36   
ref|XP_559833.2|  AGAP009347-PA                                         140   8e-36   
gb|AAR10205.1|  similar to Drosophila melanogaster FKBP59               134   8e-36   
ref|WP_040897448.1|  peptidylprolyl isomerase                           134   8e-36   
ref|WP_041032423.1|  peptidylprolyl isomerase                           134   9e-36   
ref|WP_044292122.1|  peptidylprolyl isomerase                           133   9e-36   
gb|ELS03528.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           133   1e-35   
ref|WP_008226946.1|  FKBP-type peptidyl-prolyl cis-trans isomerase      133   1e-35   
ref|XP_008352129.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   1e-35   
ref|WP_015155971.1|  FKBP-type peptidylprolyl isomerase                 133   1e-35   
ref|WP_037222729.1|  peptidylprolyl isomerase                           133   1e-35   
gb|AFY56749.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           133   1e-35   
gb|EFO62827.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           131   1e-35   
ref|XP_003874331.1|  peptidylprolyl isomerase-like protein              139   2e-35   
emb|CDP98706.1|  Protein BM-FKB-6, isoform c                            138   2e-35   
ref|XP_011040722.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    139   2e-35   
gb|EJD75818.1|  FK506-binding protein                                   138   2e-35   
ref|XP_008471598.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    139   2e-35   
ref|XP_001902831.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    138   2e-35   
ref|XP_001709141.1|  FKBP-type peptidyl-prolyl cis-trans isomerase      130   2e-35   
ref|NP_958877.1|  peptidyl-prolyl cis-trans isomerase FKBP4             138   2e-35   
gb|AAH71516.1|  FK506 binding protein 4                                 138   2e-35   
ref|XP_005173673.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    138   2e-35   
gb|KDO20890.1|  hypothetical protein SPRG_14121                         138   3e-35   
ref|XP_011304043.1|  PREDICTED: FK506-binding protein 59-like iso...    137   3e-35   
ref|XP_008614859.1|  hypothetical protein SDRG_10636                    138   3e-35   
ref|XP_005778985.1|  FKBP-type peptidyl-prolyl cis-trans isomerase      135   3e-35   
emb|CDP98704.1|  Protein BM-FKB-6, isoform b                            138   3e-35   
ref|WP_008235472.1|  FKBP-type peptidyl-prolyl cis-trans isomerase      132   3e-35   
pdb|2LGO|A  Chain A, Solution Nmr Structure Of A Fkbp-type Peptid...    130   3e-35   
ref|XP_011474896.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   4e-35   
ref|WP_016873814.1|  peptidylprolyl isomerase                           132   4e-35   
pdb|1ROT|A  Chain A, Structure Of Fkbp59-I, The N-Terminal Domain...    131   4e-35   
ref|WP_017746397.1|  peptidylprolyl isomerase                           132   5e-35   
ref|WP_009547666.1|  MULTISPECIES: peptidylprolyl isomerase             132   5e-35   
gb|ETK71084.1|  peptidyl-prolyl cis-trans isomerase                     137   5e-35   
ref|XP_008915460.1|  peptidyl-prolyl cis-trans isomerase                137   5e-35   
gb|ACB52376.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           132   5e-35   
pdb|1N1A|A  Chain A, Crystal Structure Of The N-Terminal Domain O...    130   5e-35   
ref|WP_006634796.1|  peptidylprolyl isomerase                           132   5e-35   
gb|AAF18387.1|AF163664_1  FK506-binding protein FKBP59                  137   6e-35   
pdb|4DRJ|A  Chain A, O-crystal Structure Of The Ppiase Domain Of ...    130   6e-35   
ref|WP_015177223.1|  Peptidylprolyl isomerase                           132   6e-35   
ref|NP_524895.2|  FK506-binding protein FKBP59, isoform A               137   7e-35   
ref|XP_009516060.1|  hypothetical protein PHYSODRAFT_537442             137   7e-35   
ref|XP_011304042.1|  PREDICTED: FK506-binding protein 59-like iso...    137   7e-35   
pdb|1R9H|A  Chain A, Structural Genomics Of C.Elegans: Fkbp-Type ...    130   7e-35   
ref|WP_017308853.1|  peptidylprolyl isomerase                           131   8e-35   
ref|XP_005730200.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   9e-35   
ref|XP_009020007.1|  hypothetical protein HELRODRAFT_185002             137   9e-35   
ref|XP_006633817.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   9e-35   
gb|KFM74608.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               137   9e-35   
ref|XP_001356347.2|  GA18239                                            137   9e-35   
ref|XP_006633816.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   9e-35   
ref|XP_002014469.1|  GL18937                                            136   9e-35   
ref|WP_019506462.1|  hypothetical protein                               131   1e-34   
ref|XP_002906896.1|  peptidyl-prolyl cis-trans isomerase, putative      137   1e-34   
ref|WP_040932077.1|  peptidylprolyl isomerase                           130   1e-34   
ref|XP_004031957.1|  peptidyl-prolyl cis-trans isomerase, putative      136   1e-34   
ref|WP_022608607.1|  FKBP-type peptidyl-prolyl cis-trans isomerase 1    130   1e-34   
gb|ERG78987.1|  peptidyl-prolyl cis-trans isomerase fkbp4               136   1e-34   
gb|AEE61818.1|  unknown                                                 128   1e-34   
ref|XP_008297922.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   1e-34   
ref|XP_003440636.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   1e-34   
ref|WP_044450715.1|  peptidylprolyl isomerase                           130   1e-34   
ref|NP_001040498.1|  FK506-binding protein                              128   2e-34   
gb|EKE24998.1|  Peptidyl-prolyl cis-trans isomerase                     130   2e-34   
ref|XP_006987917.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   2e-34   
ref|XP_006789463.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   2e-34   
ref|XP_008310110.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   2e-34   
gb|ENN74643.1|  hypothetical protein YQE_08762                          128   2e-34   
ref|XP_005785998.1|  FKBP-type peptidyl-prolyl cis-trans isomerase      128   2e-34   
ref|XP_001988683.1|  GH11297                                            135   2e-34   
ref|XP_002088979.1|  FKBP59                                             135   2e-34   
ref|WP_026093503.1|  peptidylprolyl isomerase                           130   3e-34   
ref|XP_003463231.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    135   3e-34   
ref|XP_002064462.1|  GK23813                                            135   3e-34   
ref|XP_007244105.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   3e-34   
ref|XP_002052437.1|  GJ17544                                            135   3e-34   
gb|ACC81365.1|  peptidylprolyl isomerase, FKBP-type                     129   3e-34   
ref|WP_011244059.1|  MULTISPECIES: peptidylprolyl isomerase             129   3e-34   
ref|XP_003796486.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   3e-34   
ref|XP_007899824.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   3e-34   
ref|XP_003737657.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   3e-34   
ref|WP_041565406.1|  peptidylprolyl isomerase                           129   3e-34   
pdb|4TW8|A  Chain A, The Fk1-fk2 Domains Of Fkbp52 In Complex Wit...    131   4e-34   
ref|XP_002036385.1|  GM17712                                            135   4e-34   
ref|XP_011057416.1|  PREDICTED: FK506-binding protein 59 isoform X2     135   4e-34   
ref|WP_015114459.1|  Peptidylprolyl isomerase                           129   4e-34   
ref|XP_010005403.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   4e-34   
gb|AAD01597.1|  peptidyl-prolyl cis-trans isomerase                     134   4e-34   
ref|XP_004226643.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    135   4e-34   
gb|AGK45316.1|  12 kDa FK506-binding protein B                          127   5e-34   
ref|XP_002078821.1|  GD23632                                            134   5e-34   
emb|CCA14206.1|  peptidylprolyl cistrans isomerase putative             135   5e-34   
ref|XP_005829648.1|  hypothetical protein GUITHDRAFT_164072             132   5e-34   
ref|XP_001969353.1|  GG10059                                            134   5e-34   
ref|XP_005387173.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   5e-34   
ref|XP_001033369.1|  peptidyl-prolyl cis-trans isomerase, FKBP-ty...    127   5e-34   
ref|XP_007644424.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   5e-34   
ref|XP_010783544.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   5e-34   
gb|ELS46524.1|  FKBP-type peptidyl-prolyl cis-trans isomerase fam...    129   6e-34   
gb|ERL92308.1|  hypothetical protein D910_09625                         128   6e-34   
dbj|BAE35690.1|  unnamed protein product                                134   6e-34   
gb|EGI63713.1|  FK506-binding protein 59                                134   6e-34   
gb|EYC07283.1|  hypothetical protein Y032_0071g569                      134   6e-34   
gb|EHJ74432.1|  hypothetical protein KGM_05549                          127   6e-34   
ref|WP_036402042.1|  peptidylprolyl isomerase                           129   6e-34   
gb|EYC07281.1|  hypothetical protein Y032_0071g569                      134   6e-34   
ref|XP_008823713.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   6e-34   
ref|XP_007382932.1|  hypothetical protein PUNSTDRAFT_66164              127   6e-34   
ref|XP_004553313.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   6e-34   
ref|WP_017301062.1|  hypothetical protein                               129   6e-34   
ref|NP_001134553.1|  peptidyl-prolyl cis-trans isomerase FKBP5          129   6e-34   
ref|XP_004596393.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   6e-34   
gb|AAH03447.1|  FK506 binding protein 4                                 134   6e-34   
ref|NP_034349.1|  peptidyl-prolyl cis-trans isomerase FKBP4             134   6e-34   
gb|ACO09466.1|  FK506-binding protein 4                                 134   7e-34   
ref|WP_026723067.1|  peptidylprolyl isomerase                           129   7e-34   
gb|KIE11860.1|  peptidylprolyl isomerase                                129   7e-34   
ref|NP_001075779.1|  peptidyl-prolyl cis-trans isomerase FKBP4          134   7e-34   
ref|XP_004778377.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   7e-34   
ref|XP_005084139.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   7e-34   
gb|EYC07284.1|  hypothetical protein Y032_0071g569                      134   7e-34   
ref|XP_011057415.1|  PREDICTED: FK506-binding protein 59 isoform X1     134   7e-34   
gb|KHJ96214.1|  hypothetical protein OESDEN_03825                       133   7e-34   
ref|WP_027846284.1|  peptidylprolyl isomerase                           129   7e-34   
ref|WP_002773862.1|  peptidylprolyl isomerase                           128   7e-34   
gb|KIJ80292.1|  peptidylprolyl isomerase                                129   7e-34   
ref|WP_042790805.1|  peptidylprolyl isomerase                           128   8e-34   
ref|XP_003661977.1|  hypothetical protein MYCTH_2301963                 127   8e-34   
emb|CDS26820.1|  fk506 binding protein                                  126   8e-34   
ref|WP_002794927.1|  peptidylprolyl isomerase                           128   8e-34   
ref|XP_002948840.1|  hypothetical protein VOLCADRAFT_80367              126   8e-34   
ref|WP_026101533.1|  peptidylprolyl isomerase                           128   8e-34   
gb|EYC07282.1|  hypothetical protein Y032_0071g569                      134   8e-34   
ref|XP_004668755.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   8e-34   
gb|EAR86074.2|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    134   8e-34   
ref|WP_002755989.1|  peptidylprolyl isomerase                           128   9e-34   
pdb|4LAV|A  Chain A, Crystal Structure Analysis Of Fkbp52, Crysta...    130   9e-34   
ref|WP_015196245.1|  FKBP-type peptidylprolyl isomerase                 128   9e-34   
dbj|GAL93301.1|  FKBP-type peptidyl-prolyl cis-trans isomerase          128   9e-34   
gb|ELP53930.1|  peptidyl-prolyl cis-trans isomerase domain protein      128   9e-34   
ref|WP_007354898.1|  MULTISPECIES: peptidylprolyl isomerase             129   9e-34   
tpg|DAA29159.1|  TPA: peptidyl-prolyl cis-trans isomerase FKBP4         134   9e-34   
ref|XP_009043659.1|  hypothetical protein LOTGIDRAFT_102242             133   1e-33   
ref|XP_005334048.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   1e-33   
emb|CAC39452.1|  immunophilin FKBP-52                                   134   1e-33   
ref|XP_005834996.1|  FKBP-type peptidyl-prolyl cis-trans isomerase      134   1e-33   
ref|XP_004648210.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   1e-33   



>ref|XP_009602562.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
tomentosiformis]
Length=573

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 136/149 (91%), Positives = 141/149 (95%), Gaps = 3/149 (2%)
 Frame = +3

Query  69   EDFDMPPAE-MD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+PPAE MD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GWETPE GDEVEVH
Sbjct  3    EDFDIPPAEGMDEDMDLPDD-PIMKVGEEKEIGNQGLKKKLVKEGEGWETPEAGDEVEVH  61

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRG PFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGES
Sbjct  62   YTGTLLDGTKFDSSRDRGDPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGES  121

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSWVSVKDICK
Sbjct  122  GSPPTIPPNATLQFDVELLSWVSVKDICK  150


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 70/120 (58%), Gaps = 7/120 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  329
            D+ + KK++KEG G+E P  G  V++   G L DGT F      G      F+F   + Q
Sbjct  268  DKKVVKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFIKKGHDGENEDELFEFKTDEEQ  327

Query  330  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            VI G D+ + TMKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S+V  K+
Sbjct  328  VIDGLDRAVMTMKKGEVALLTIAPEYAFGSSESKQDLAVIPPNSTVHYEVELVSFVKDKE  387


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 62/120 (52%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L +GT    S       +FT+  G     
Sbjct  151  DGGIFKKILAEGEKWENPKDLDEVLVKYEALLENGTVVGKS----DGVEFTVQDGYFCPA  206

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE    T+ P   +GE G P +     +P NATLQ ++EL+SW  V  + 
Sbjct  207  LAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASSDGGAVPSNATLQINLELVSWKIVSSVT  266



>dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum]
Length=573

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 136/149 (91%), Positives = 141/149 (95%), Gaps = 3/149 (2%)
 Frame = +3

Query  69   EDFDMPPAE-MD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+PPAE MD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GWETPE GDEVEVH
Sbjct  3    EDFDIPPAEGMDEDMDLPDD-PIMKVGEEKEIGNQGLKKKLVKEGEGWETPEAGDEVEVH  61

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRG PFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGES
Sbjct  62   YTGTLLDGTKFDSSRDRGDPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGES  121

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSWVSVKDICK
Sbjct  122  GSPPTIPPNATLQFDVELLSWVSVKDICK  150


 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 70/120 (58%), Gaps = 7/120 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  329
            D+ + KK++KEG G+E P  G  V++   G L DGT F      G      F+F   + Q
Sbjct  268  DKKVVKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFIKKGHDGENEDELFEFKTDEEQ  327

Query  330  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            VI G D+ + TMKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S+V  K+
Sbjct  328  VIDGLDRAVMTMKKGEVALLTIAPEYAFGSSESKQDLAVIPPNSTVHYEVELVSFVKDKE  387


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 62/120 (52%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L +GT    S       +FT+  G     
Sbjct  151  DGGIFKKILAEGEKWENPKDFDEVLVKYEALLENGTVVGKS----DGVEFTVQDGYFCPA  206

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE    T+ P   +GE G P +     +P NATLQ ++EL+SW  V  + 
Sbjct  207  LAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASSDGGAVPSNATLQINLELVSWKIVSSVT  266



>ref|XP_009803135.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
sylvestris]
Length=573

 Score =   269 bits (688),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 134/149 (90%), Positives = 139/149 (93%), Gaps = 3/149 (2%)
 Frame = +3

Query  69   EDFDMPPAE-MD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+PPAE MD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GWETPE GDEVEVH
Sbjct  3    EDFDIPPAEGMDEDMDLPDD-PIMKVGEEKEIGNQGLKKKLVKEGEGWETPESGDEVEVH  61

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRG PFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGES
Sbjct  62   YTGTLLDGTKFDSSRDRGDPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGES  121

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPN TLQFDVELLSW SVKDICK
Sbjct  122  GSPPTIPPNTTLQFDVELLSWASVKDICK  150


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 70/120 (58%), Gaps = 7/120 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  329
            D+ + KK++KEG G+E P  G  V++   G L DGT F      G      F+F   + Q
Sbjct  268  DKKVVKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFIKKGHDGENEDELFEFKTDEEQ  327

Query  330  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKD  500
            VI G D+ + TMKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S+V  K+
Sbjct  328  VIDGLDRAVMTMKKGEVALLTIAPEYAFGSSESKQDLVVIPPNSTVHYEVELVSFVKDKE  387


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 63/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L +GT    S       +FT+  G     
Sbjct  151  DGGIFKKILAEGEKWENPKDLDEVLVKYEALLENGTVVGKS----DGVEFTVQDGYFCPA  206

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE    T+ P   +GE G P +     +PPNATLQ ++EL+SW  V  + 
Sbjct  207  LAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASSDGGAVPPNATLQINLELVSWKIVSSVT  266



>gb|KJB08782.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
Length=516

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 3/151 (2%)
 Frame = +3

Query  66   MEDFDMPPAE---MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            MEDFD+P AE    +D+DLPD++P++KVGEEKEIG+QGLKKKLVKEG GWE PE GDEVE
Sbjct  1    MEDFDIPAAEDMMNEDMDLPDESPILKVGEEKEIGNQGLKKKLVKEGEGWEYPEIGDEVE  60

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD+GIKTMKKGE  IFTIPP LAYG
Sbjct  61   VHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPALAYG  120

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  121  ESGSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F     + G   F+F     QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVQVKLIGKLQDGTIFLKKGHNEGEELFEFKTDDEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            +G D+ +  MKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  329  EGLDRAVLNMKKGEVALLTIAPEYAFGSSESKQEFAVVPPNSTVYYEVELVSFVKEKE  386


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++ EG  WE P+  DEV ++Y   L DGT       +    +FT+  G     
Sbjct  152  DGGLFKKILIEGDKWENPKDLDEVLINYEAKLEDGTVVA----KAEGVEFTVKDGLFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW +V ++ 
Sbjct  208  LARAVKTMKKGEKVLLTVKPQYGFGEKGKPATGAEGAVPPNATLLITLELVSWKTVTEVT  267



>ref|XP_004242423.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum 
lycopersicum]
Length=574

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 139/149 (93%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE-MD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            +DF +PP E MD D+DLP+D+  MKVGEEKEIG+QGLKKKLVKEG GWETPEPGDEVEVH
Sbjct  3    DDFGIPPVEGMDEDMDLPEDSSTMKVGEEKEIGNQGLKKKLVKEGEGWETPEPGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRG PFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGDPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSWVSVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWVSVKDICK  151


 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 71/120 (59%), Gaps = 7/120 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  329
            D+ + KK++KEG G+E P  G  V++   G LLDGT F      G      F+F   + Q
Sbjct  269  DKKVVKKILKEGEGYERPNEGAVVKLKLVGKLLDGTVFTKKGHDGESEDNLFEFKTDEEQ  328

Query  330  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS---PPTIPPNATLQFDVELLSWVSVKD  500
            VI G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+S++  K+
Sbjct  329  VIDGLDRAVMTMKKGEAALLTIAPEYAFGSSESKQDSAVVPPNSTVHYEVELVSFLKDKE  388


 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L +GT    S       +FT+  G     
Sbjct  152  DGGIFKKILTEGEKWENPKDLDEVLVKYEAQLENGTVVGKS----DGVEFTVQDGHFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE    T+ P   +GE G P +     +PPNATLQ ++EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASSDGGAVPPNATLQINLELVSWKTVSNVT  267



>gb|KJB08781.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
 gb|KJB08783.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
Length=572

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 3/151 (2%)
 Frame = +3

Query  66   MEDFDMPPAE---MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            MEDFD+P AE    +D+DLPD++P++KVGEEKEIG+QGLKKKLVKEG GWE PE GDEVE
Sbjct  1    MEDFDIPAAEDMMNEDMDLPDESPILKVGEEKEIGNQGLKKKLVKEGEGWEYPEIGDEVE  60

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD+GIKTMKKGE  IFTIPP LAYG
Sbjct  61   VHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPALAYG  120

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  121  ESGSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F     + G   F+F     QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVQVKLIGKLQDGTIFLKKGHNEGEELFEFKTDDEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            +G D+ +  MKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  329  EGLDRAVLNMKKGEVALLTIAPEYAFGSSESKQEFAVVPPNSTVYYEVELVSFVKEKE  386


 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++ EG  WE P+  DEV ++Y   L DGT       +    +FT+  G     
Sbjct  152  DGGLFKKILIEGDKWENPKDLDEVLINYEAKLEDGTVVA----KAEGVEFTVKDGLFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW +V ++ 
Sbjct  208  LARAVKTMKKGEKVLLTVKPQYGFGEKGKPATGAEGAVPPNATLLITLELVSWKTVTEVT  267



>gb|KJB08784.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
Length=568

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 3/151 (2%)
 Frame = +3

Query  66   MEDFDMPPAE---MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            MEDFD+P AE    +D+DLPD++P++KVGEEKEIG+QGLKKKLVKEG GWE PE GDEVE
Sbjct  1    MEDFDIPAAEDMMNEDMDLPDESPILKVGEEKEIGNQGLKKKLVKEGEGWEYPEIGDEVE  60

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD+GIKTMKKGE  IFTIPP LAYG
Sbjct  61   VHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPALAYG  120

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  121  ESGSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F     + G   F+F     QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVQVKLIGKLQDGTIFLKKGHNEGEELFEFKTDDEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            +G D+ +  MKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  329  EGLDRAVLNMKKGEVALLTIAPEYAFGSSESKQEFAVVPPNSTVYYEVELVSFVKEKE  386


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++ EG  WE P+  DEV ++Y   L DGT       +    +FT+  G     
Sbjct  152  DGGLFKKILIEGDKWENPKDLDEVLINYEAKLEDGTVVA----KAEGVEFTVKDGLFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW +V ++ 
Sbjct  208  LARAVKTMKKGEKVLLTVKPQYGFGEKGKPATGAEGAVPPNATLLITLELVSWKTVTEVT  267



>ref|XP_010247135.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Nelumbo nucifera]
Length=571

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 138/149 (93%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFDMPPAE   +D+DLPD++PV+KVGEEKEIG QGLKKKLVKEG GW+TP+ GDEVEVH
Sbjct  3    EDFDMPPAEEMNEDMDLPDESPVLKVGEEKEIGKQGLKKKLVKEGEGWDTPDNGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            Y GTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPPDLAYG S
Sbjct  63   YIGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPDLAYGAS  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWSSVKDICK  151


 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 70/117 (60%), Gaps = 4/117 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  338
            D+ ++KK++KEG G+E P  G  V+V   G L DGT F     D   PF+F     QVI 
Sbjct  269  DKKVQKKILKEGEGYERPNDGTVVKVKLIGKLQDGTIFLKKGHDEEEPFEFKTDDEQVID  328

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            G D+ + TMKKGE  + TI P+  +G S S      +PPN+TL ++VE++S+V  K+
Sbjct  329  GLDRAVMTMKKGEVALVTIAPEYGFGSSESKQQLAVVPPNSTLIYEVEMVSFVKEKE  385


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 62/120 (52%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L  G     S       +FT+  G     
Sbjct  152  DGGIFKKILTEGEKWENPKDPDEVFVKYEAKLEGGAVVSKS----DGVEFTVKTGFFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P  A+GE G P       IPPN+ LQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYAFGEKGRPACGDEGAIPPNSVLQITLELVSWKTVTEIT  267



>ref|XP_010247134.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Nelumbo nucifera]
Length=572

 Score =   267 bits (682),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 138/149 (93%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFDMPPAE   +D+DLPD++PV+KVGEEKEIG QGLKKKLVKEG GW+TP+ GDEVEVH
Sbjct  3    EDFDMPPAEEMNEDMDLPDESPVLKVGEEKEIGKQGLKKKLVKEGEGWDTPDNGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            Y GTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPPDLAYG S
Sbjct  63   YIGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPDLAYGAS  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWSSVKDICK  151


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 70/117 (60%), Gaps = 4/117 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  338
            D+ ++KK++KEG G+E P  G  V+V   G L DGT F     D   PF+F     QVI 
Sbjct  269  DKKVQKKILKEGEGYERPNDGTVVKVKLIGKLQDGTIFLKKGHDEEEPFEFKTDDEQVID  328

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            G D+ + TMKKGE  + TI P+  +G S S      +PPN+TL ++VE++S+V  K+
Sbjct  329  GLDRAVMTMKKGEVALVTIAPEYGFGSSESKQQLAVVPPNSTLIYEVEMVSFVKEKE  385


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 62/120 (52%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L  G     S       +FT+  G     
Sbjct  152  DGGIFKKILTEGEKWENPKDPDEVFVKYEAKLEGGAVVSKS----DGVEFTVKTGFFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P  A+GE G P       IPPN+ LQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYAFGEKGRPACGDEGAIPPNSVLQITLELVSWKTVTEIT  267



>ref|XP_006363451.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Solanum tuberosum]
Length=555

 Score =   266 bits (680),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 139/149 (93%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            +DFD+P AE   DD+DLPD++P+MKVGEEKEIG +GLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    DDFDIPGAEGMDDDMDLPDESPIMKVGEEKEIGKEGLKKKLVKEGEGWDTPEAGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKK E  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKAENAIFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPN+TLQFDVELLSWVSVKDICK
Sbjct  123  GSPPTIPPNSTLQFDVELLSWVSVKDICK  151


 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 69/120 (58%), Gaps = 7/120 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  329
            D+ + KK++KEG G+E P  G  V++   G L DGT F      G      F+F   + Q
Sbjct  269  DKKVIKKILKEGEGFEKPNAGAVVKMKLIGKLQDGTVFIKKGHNGENEDELFEFKTDEEQ  328

Query  330  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKD  500
            VI G D+ + +MKKGE  +  I PD A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  329  VIDGLDRAVMSMKKGEVALLIIAPDYAFGPSESKQDLGVVPPNSTVYYEVELVSFVKEKE  388


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 63/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ +G  WE P   DEV V Y   L DG+    S       +FT+ +G     
Sbjct  152  DGGIFKKILTKGEKWENPMDLDEVLVKYEAQLEDGSLVGKS----DGVEFTVQEGHFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE    T+ P   +GE G P +     +PPNATLQ  +EL++W +V  + 
Sbjct  208  IAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASGDGGAVPPNATLQISLELVTWKTVSSVT  267



>ref|XP_009610546.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
tomentosiformis]
Length=565

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 136/147 (93%), Gaps = 5/147 (3%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  248
            EDFD+P      +DLPD++P+MKVGEEKEIG QGLKKKLVKEG  W+TPEPGDEVEVHYT
Sbjct  3    EDFDIPA-----MDLPDESPIMKVGEEKEIGKQGLKKKLVKEGEKWDTPEPGDEVEVHYT  57

Query  249  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
            GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGESGS
Sbjct  58   GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGESGS  117

Query  429  PPTIPPNATLQFDVELLSWVSVKDICK  509
            PPTIPPNATLQFDVELLSWVSVKDICK
Sbjct  118  PPTIPPNATLQFDVELLSWVSVKDICK  144


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DG+    S       +F + +G     
Sbjct  145  DGGIFKKILTEGDKWENPKDLDEVLVKYEARLEDGSLIGKS----DGVEFAVQEGHFCPA  200

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE    T+ P   +GE G P +     +PPNATLQ ++EL+SW +V  + 
Sbjct  201  IAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASGDGGAVPPNATLQINLELVSWKTVSSVT  260


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 69/120 (58%), Gaps = 8/120 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  329
            D+ + KK++KEG G+E P  G  V++   G L DGT F      G      F+F   + Q
Sbjct  262  DKKVIKKILKEGEGYEKPN-GAVVKLKLIGKLQDGTVFLKKGHDGENEDDLFEFKTDEEQ  320

Query  330  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKD  500
            VI G D+ + +MKKGE  +  I P+ A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  321  VIDGLDRAVMSMKKGEVALLIIAPEYAFGSSESKQDLGVVPPNSTVYYEVELVSFVKEKE  380



>ref|XP_009787495.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
sylvestris]
Length=570

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  248
            E FD+P  + +D+DLPD++P+MKVGEEKEIG +GLKKKLVKEG  W+TPEPGDEVEVHYT
Sbjct  3    EGFDIPAMD-EDMDLPDESPIMKVGEEKEIGKEGLKKKLVKEGEKWDTPEPGDEVEVHYT  61

Query  249  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
            GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGESGS
Sbjct  62   GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGESGS  121

Query  429  PPTIPPNATLQFDVELLSWVSVKDICK  509
            PPTIPPNATLQFDVELLSWVSVKDICK
Sbjct  122  PPTIPPNATLQFDVELLSWVSVKDICK  148


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DG+    S       +F + +G     
Sbjct  149  DGGIFKKILTEGEKWENPKDLDEVLVKYEARLEDGSLIGKS----DGVEFAVQEGHFCPA  204

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE    T+ P   +GE G P +     +PPNATLQ ++EL+SW +V  + 
Sbjct  205  IAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASTDGGAVPPNATLQINLELVSWKTVSSVT  264


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 68/120 (57%), Gaps = 7/120 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  329
            D+ + KK++KEG G+E P  G  V++   G L DGT F      G      F+F   + Q
Sbjct  266  DKKVIKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFLKKGHDGENEDDLFEFKTDEEQ  325

Query  330  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKD  500
            VI G D+ + +MKKGE  +  I  + A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  326  VIDGLDRAVMSMKKGEVALLIIAAEYAFGSSESKQDLGIVPPNSTVYYEVELVSFVKEKE  385



>ref|XP_007049647.1| Rotamase FKBP 1 isoform 2 [Theobroma cacao]
 gb|EOX93804.1| Rotamase FKBP 1 isoform 2 [Theobroma cacao]
Length=475

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 137/150 (91%), Gaps = 3/150 (2%)
 Frame = +3

Query  69   EDFDMPPAE---MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  239
            EDFD+P AE    DD+DLPD++P+ KVGEEKEIG QGLKKKLVKEG GWETP+ GDEVEV
Sbjct  3    EDFDIPAAEDMMNDDMDLPDESPIWKVGEEKEIGKQGLKKKLVKEGEGWETPDNGDEVEV  62

Query  240  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  419
            HYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIK MKKGE  IFTIPP+LAYGE
Sbjct  63   HYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKKMKKGENAIFTIPPELAYGE  122

Query  420  SGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            SGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  SGSPPTIPPNATLQFDVELLSWTSVKDICK  152


 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 68/119 (57%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WETP+  DEV V+Y   L DGT       +    +FT+ +G     
Sbjct  153  DGGIFKKILIEGDKWETPKDLDEVLVNYEAKLEDGTVVA----KADGVEFTVKEGHFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  + T+ P   +GE G P T     +PPNA+LQ  +EL+SW +V ++
Sbjct  209  LARAVKTMKKGEKVLLTVKPQYGFGEKGKPATGAEGAVPPNASLQITLELVSWKTVTEV  267


 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  335
            D+ + KK++KEG G++ P  G +V+V   G L DGT F     + G   F+F   + QVI
Sbjct  270  DKKVIKKILKEGEGYDRPNEGADVQVKLIGKLQDGTVFLKKGHNEGEELFEFKTDEEQVI  329

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKD  500
             G D+ +  MKKGE    TI P+ A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  330  DGLDRAVMKMKKGEVAQLTIAPEYAFGSSESQQDLGLVPPNSTVYYEVELVSFVKEKE  387



>ref|XP_002263566.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 isoform 
X1 [Vitis vinifera]
 emb|CBI29552.3| unnamed protein product [Vitis vinifera]
Length=571

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P AE   DD+DLPD++P++KVGEEKEIG QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAAEEMNDDMDLPDESPILKVGEEKEIGKQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GS  TIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSSTTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V EG  WE P+  DEV V Y   L DGT    S       +FT+ +      
Sbjct  152  DGGIFKKIVTEGDKWENPKDLDEVFVKYEARLEDGTLVAKS----DGVEFTVKEDYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  I T+ P   +GE G P +     +PPNATL+  +EL+SW +V ++ 
Sbjct  208  LSKAVKTMKKGEKVILTVKPQYGFGEKGKPASGEEGAVPPNATLEITLELVSWKTVTEVT  267


 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 67/118 (57%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V++   G L DGT F       G   F+F     QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHGEGEDLFEFKTDDEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             G D+ + TMKKGE  + TI  D A+G S S      +PPN+T+ ++VEL S+V  K+
Sbjct  329  DGLDRAVMTMKKGEVALLTIHSDYAFGSSESSQELAVVPPNSTVYYEVELESFVKDKE  386



>ref|XP_007049646.1| Rotamase FKBP 1 isoform 1 [Theobroma cacao]
 gb|EOX93803.1| Rotamase FKBP 1 isoform 1 [Theobroma cacao]
Length=573

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 137/150 (91%), Gaps = 3/150 (2%)
 Frame = +3

Query  69   EDFDMPPAE---MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  239
            EDFD+P AE    DD+DLPD++P+ KVGEEKEIG QGLKKKLVKEG GWETP+ GDEVEV
Sbjct  3    EDFDIPAAEDMMNDDMDLPDESPIWKVGEEKEIGKQGLKKKLVKEGEGWETPDNGDEVEV  62

Query  240  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  419
            HYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIK MKKGE  IFTIPP+LAYGE
Sbjct  63   HYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKKMKKGENAIFTIPPELAYGE  122

Query  420  SGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            SGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  SGSPPTIPPNATLQFDVELLSWTSVKDICK  152


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 68/120 (57%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WETP+  DEV V+Y   L DGT       +    +FT+ +G     
Sbjct  153  DGGIFKKILIEGDKWETPKDLDEVLVNYEAKLEDGTVVA----KADGVEFTVKEGHFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P T     +PPNA+LQ  +EL+SW +V ++ 
Sbjct  209  LARAVKTMKKGEKVLLTVKPQYGFGEKGKPATGAEGAVPPNASLQITLELVSWKTVTEVT  268


 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  335
            D+ + KK++KEG G++ P  G +V+V   G L DGT F     + G   F+F   + QVI
Sbjct  270  DKKVIKKILKEGEGYDRPNEGADVQVKLIGKLQDGTVFLKKGHNEGEELFEFKTDEEQVI  329

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKD  500
             G D+ +  MKKGE    TI P+ A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  330  DGLDRAVMKMKKGEVAQLTIAPEYAFGSSESQQDLGLVPPNSTVYYEVELVSFVKEKE  387



>gb|KDO40263.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=577

 Score =   264 bits (675),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVV----GKADGVEFTVKDGHFCPT  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>gb|KDO40268.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=492

 Score =   262 bits (669),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVV----GKADGVEFTVKDGHFCPT  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>gb|KDO40265.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=572

 Score =   264 bits (675),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVV----GKADGVEFTVKDGHFCPT  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>ref|XP_006437244.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
 gb|ESR50484.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
Length=559

 Score =   263 bits (673),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVV----GKADGVEFTVKDGHFCPT  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAFVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>ref|XP_006437245.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
 ref|XP_006484806.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Citrus 
sinensis]
 gb|ESR50485.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
Length=572

 Score =   264 bits (674),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVV----GKADGVEFTVKDGHFCPT  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAFVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>gb|KDO40262.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=567

 Score =   264 bits (674),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVV----GKADGVEFTVKDGHFCPT  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>ref|XP_006352668.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum 
tuberosum]
Length=574

 Score =   264 bits (674),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 136/149 (91%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDF +PP E   +D+DLPDD+  +KVGEEKEIG+QGLKKKLVKEG GW+TP PGDEVEVH
Sbjct  3    EDFGIPPVEGMNEDMDLPDDSSTLKVGEEKEIGNQGLKKKLVKEGEGWDTPAPGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRG PFKFTLGQGQVIKGWDQGI TMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGDPFKFTLGQGQVIKGWDQGINTMKKGENAIFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSWVSVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWVSVKDICK  151


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 71/120 (59%), Gaps = 7/120 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRG----TPFKFTLGQGQ  329
            D+ + KK++KEG G+E P  G  V++   G LLDGT F      G      F+F   + Q
Sbjct  269  DKKVLKKILKEGEGYERPNEGAVVKLKLVGKLLDGTVFTKKGHDGENEDNLFEFKTDEEQ  328

Query  330  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            VI G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  329  VIDGLDRAVMTMKKGEAALLTIAPEYAFGSSESKQDLAVVPPNSTVHYEVELVSFVKDKE  388


 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L +GT    S       +FT+  G     
Sbjct  152  DGGIFKKILTEGEKWENPKDLDEVFVKYEAQLENGTVVGKS----DGVEFTVQDGHFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE    T+ P   +GE G P +     +PPNATLQ ++EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASSDGGAVPPNATLQINLELVSWKTVSNVT  267



>gb|KDO40267.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=496

 Score =   262 bits (669),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVV----GKADGVEFTVKDGHFCPT  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEI  266


 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>gb|KDO40264.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=562

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVV----GKADGVEFTVKDGHFCPT  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>gb|KDO40266.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=557

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVV----GKADGVEFTVKDGHFCPT  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>ref|XP_010647328.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 isoform 
X2 [Vitis vinifera]
Length=595

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P AE   DD+DLPD++P++KVGEEKEIG QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAAEEMNDDMDLPDESPILKVGEEKEIGKQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GS  TIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSSTTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V EG  WE P+  DEV V Y   L DGT    S       +FT+ +      
Sbjct  152  DGGIFKKIVTEGDKWENPKDLDEVFVKYEARLEDGTLVAKS----DGVEFTVKEDYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  I T+ P   +GE G P +     +PPNATL+  +EL+SW +V ++
Sbjct  208  LSKAVKTMKKGEKVILTVKPQYGFGEKGKPASGEEGAVPPNATLEITLELVSWKTVTEV  266


 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 67/118 (57%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V++   G L DGT F       G   F+F     QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHGEGEDLFEFKTDDEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             G D+ + TMKKGE  + TI  D A+G S S      +PPN+T+ ++VEL S+V  K+
Sbjct  329  DGLDRAVMTMKKGEVALLTIHSDYAFGSSESSQELAVVPPNSTVYYEVELESFVKDKE  386



>gb|KDP45275.1| hypothetical protein JCGZ_15140 [Jatropha curcas]
Length=572

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 136/150 (91%), Gaps = 3/150 (2%)
 Frame = +3

Query  69   EDFDMPPAE---MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  239
            ED D+P  E   MDD+DL D++PV+KVGEEKEIG QGLKKKLVKEG GW+TP+ GDEVEV
Sbjct  3    EDLDVPAGEEMMMDDIDLADESPVLKVGEEKEIGKQGLKKKLVKEGEGWDTPDNGDEVEV  62

Query  240  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  419
            HYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG 
Sbjct  63   HYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGA  122

Query  420  SGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            SGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  SGSPPTIPPNATLQFDVELLSWSSVKDICK  152


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  153  DGGVFKKILVEGEKWENPKDLDEVLVKYEAQLEDGTVVAKS----DGVEFTVKEGHFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATLQ  +EL+SW +V ++ 
Sbjct  209  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPASGNEAAVPPNATLQITLELVSWKTVSEVT  268


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V++   G L DGT F      +    F+F   + QVI
Sbjct  270  DKKVIKKILKEGEGYERPNDGSVVKLKLMGKLEDGTVFFKKGHDNEDELFEFKTDEEQVI  329

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             G D+ + +MKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  330  DGLDKAVASMKKGEVALVTIAPEYAFGSSESKQELAVVPPNSTVYYEVELVSFVKEKE  387



>ref|XP_004247044.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum 
lycopersicum]
Length=557

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 139/149 (93%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            +DFD+P AE   DD+DLPD++P+MKVG+EK IG +GLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    DDFDIPGAEGMDDDMDLPDESPIMKVGDEKVIGKEGLKKKLVKEGEGWDTPEAGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDG+KFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGSKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPN+TLQFDVELLSWVSVKDICK
Sbjct  123  GSPPTIPPNSTLQFDVELLSWVSVKDICK  151


 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 69/120 (58%), Gaps = 7/120 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  329
            D+ + KK++KEG G+E P  G  V++   G L DGT F      G      F+F + + Q
Sbjct  269  DKKVIKKILKEGEGFEKPNEGAVVKMKLIGKLQDGTVFIKKGHNGENEDELFEFMIDEEQ  328

Query  330  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKD  500
            VI G D+   +MKKGE  +  I PD A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  329  VIDGLDRAAMSMKKGEVALLIIAPDYAFGLSESKQDLGVVPPNSTVYYEVELVSFVKEKE  388


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 62/120 (52%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ +G  WE P+  DEV V Y   L DG+    S       +FT+ +G     
Sbjct  152  DGGIFKKILTKGEKWENPKDLDEVLVKYEAQLEDGSLVGKS----DGVEFTVQEGHFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE    T+ P   +GE G P +     +PPNA LQ  +EL++W  V  + 
Sbjct  208  IAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASGDGGAVPPNAPLQISLELVTWKIVSSVT  267



>gb|KJB42561.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=435

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P  E   DD+DLP D P +KVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVH
Sbjct  3    EDFDIPLVEDVNDDIDLPGDVPTLKVGEEKEIGKQGLKKKLVKEGEGWENPETGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFALGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V V   G L DGT F    +D G   F+F   + QVI
Sbjct  269  DKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             G D+ + TMKKGE  + TI P+ A+G SGS     ++PPN+T+ ++VE++S++  K+
Sbjct  329  DGLDKAVMTMKKGEVALLTIAPEYAFGSSGSKQELASVPPNSTVYYEVEMVSFIKDKE  386


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++  G  WE P+  DEV V+Y   L DGT    +  +    +FT+ +G     
Sbjct  152  DGGLFKKILTGGEKWENPKDPDEVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAAGAEGAVPPNATLQITLELVSWKTVSEVT  267



>gb|KJB42564.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=516

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P  E   DD+DLP D P +KVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVH
Sbjct  3    EDFDIPLVEDVNDDIDLPGDVPTLKVGEEKEIGKQGLKKKLVKEGEGWENPETGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFALGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V V   G L DGT F    +D G   F+F   + QVI
Sbjct  269  DKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             G D+ + TMKKGE  + TI P+ A+G SGS     ++PPN+T+ ++VE++S++  K+
Sbjct  329  DGLDKAVMTMKKGEVALLTIAPEYAFGSSGSKQELASVPPNSTVYYEVEMVSFIKDKE  386


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++  G  WE P+  DEV V+Y   L DGT    +  +    +FT+ +G     
Sbjct  152  DGGLFKKILTGGEKWENPKDPDEVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAAGAEGAVPPNATLQITLELVSWKTVSEVT  267



>gb|KHG19334.1| Peptidyl-prolyl cis-trans isomerase FKBP62 -like protein [Gossypium 
arboreum]
Length=564

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P  E   DD+DLP D P +KVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVH
Sbjct  3    EDFDIPLVEDVNDDIDLPGDVPTLKVGEEKEIGKQGLKKKLVKEGEGWENPETGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFALGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 73/118 (62%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F    +D G   F+F   + QVI
Sbjct  269  DKKVMKKILKEGEGYERPNEGAVVKVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             G D+ + TMKKGE  + TI P+ A+G S S     ++PPN+T+ ++VE++S++  K+
Sbjct  329  DGLDKAVMTMKKGEVALLTIAPEYAFGSSESKQELASVPPNSTVYYEVEMVSFIKDKE  386


 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++  G  WE P+  D+V V+Y   L DGT    +  +    +FT+ +G     
Sbjct  152  DGGLFKKILTGGEKWENPKDPDKVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAGGAEGAVPPNATLQITLELVSWKTVSEVT  267



>gb|KJB42563.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=564

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P  E   DD+DLP D P +KVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVH
Sbjct  3    EDFDIPLVEDVNDDIDLPGDVPTLKVGEEKEIGKQGLKKKLVKEGEGWENPETGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFALGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V V   G L DGT F    +D G   F+F   + QVI
Sbjct  269  DKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             G D+ + TMKKGE  + TI P+ A+G SGS     ++PPN+T+ ++VE++S++  K+
Sbjct  329  DGLDKAVMTMKKGEVALLTIAPEYAFGSSGSKQELASVPPNSTVYYEVEMVSFIKDKE  386


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++  G  WE P+  DEV V+Y   L DGT    +  +    +FT+ +G     
Sbjct  152  DGGLFKKILTGGEKWENPKDPDEVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAAGAEGAVPPNATLQITLELVSWKTVSEVT  267



>gb|KJB42562.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=563

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P  E   DD+DLP D P +KVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVH
Sbjct  3    EDFDIPLVEDVNDDIDLPGDVPTLKVGEEKEIGKQGLKKKLVKEGEGWENPETGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFALGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 73/117 (62%), Gaps = 5/117 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V V   G L DGT F    +D G   F+F   + QVI
Sbjct  269  DKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  497
             G D+ + TMKKGE  + TI P+ A+G SGS     ++PPN+T+ ++VE++S++ VK
Sbjct  329  DGLDKAVMTMKKGEVALLTIAPEYAFGSSGSKQELASVPPNSTVYYEVEMVSFIKVK  385


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++  G  WE P+  DEV V+Y   L DGT    +  +    +FT+ +G     
Sbjct  152  DGGLFKKILTGGEKWENPKDPDEVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAAGAEGAVPPNATLQITLELVSWKTVSEVT  267



>gb|KJB42560.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=422

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P  E   DD+DLP D P +KVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVH
Sbjct  3    EDFDIPLVEDVNDDIDLPGDVPTLKVGEEKEIGKQGLKKKLVKEGEGWENPETGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFALGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 74/121 (61%), Gaps = 6/121 (5%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V V   G L DGT F    +D G   F+F   + QVI
Sbjct  269  DKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK-DI  503
             G D+ + TMKKGE  + TI P+ A+G SGS     ++PPN+T+ ++VE++S++ V   +
Sbjct  329  DGLDKAVMTMKKGEVALLTIAPEYAFGSSGSKQELASVPPNSTVYYEVEMVSFIKVSGSV  388

Query  504  C  506
            C
Sbjct  389  C  389


 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 66/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++  G  WE P+  DEV V+Y   L DGT    +  +    +FT+ +G     
Sbjct  152  DGGLFKKILTGGEKWENPKDPDEVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAAGAEGAVPPNATLQITLELVSWKTVSEV  266



>gb|KJB42559.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=589

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P  E   DD+DLP D P +KVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVH
Sbjct  3    EDFDIPLVEDVNDDIDLPGDVPTLKVGEEKEIGKQGLKKKLVKEGEGWENPETGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFALGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 74/121 (61%), Gaps = 6/121 (5%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V V   G L DGT F    +D G   F+F   + QVI
Sbjct  269  DKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK-DI  503
             G D+ + TMKKGE  + TI P+ A+G SGS     ++PPN+T+ ++VE++S++ V   +
Sbjct  329  DGLDKAVMTMKKGEVALLTIAPEYAFGSSGSKQELASVPPNSTVYYEVEMVSFIKVSGSV  388

Query  504  C  506
            C
Sbjct  389  C  389


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 66/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++  G  WE P+  DEV V+Y   L DGT    +  +    +FT+ +G     
Sbjct  152  DGGLFKKILTGGEKWENPKDPDEVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAAGAEGAVPPNATLQITLELVSWKTVSEV  266



>ref|XP_002535081.1| peptidylprolyl isomerase, putative [Ricinus communis]
 gb|EEF27302.1| peptidylprolyl isomerase, putative [Ricinus communis]
Length=574

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 4/151 (3%)
 Frame = +3

Query  69   EDFDMPPA-EM---DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDFD+P   EM   DD+DL D +P++KVGEEKEIG QGLKKKLVKEG GW+TP+ GDEVE
Sbjct  3    EDFDIPAGDEMMMNDDVDLGDQSPILKVGEEKEIGKQGLKKKLVKEGEGWDTPDNGDEVE  62

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG
Sbjct  63   VHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYG  122

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
             SGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  ASGSPPTIPPNATLQFDVELLSWTSVKDICK  153


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 71/118 (60%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V++   G L DGT F      +    F+FT  + QVI
Sbjct  271  DKKVMKKILKEGEGYERPNDGSLVKLKLIGKLQDGTVFLKKGHDNEEELFEFTTDEEQVI  330

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            +G D+ +  MKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S+V  K+
Sbjct  331  EGLDRAVLAMKKGEVALVTIAPEYAFGASESKQELAVIPPNSTVYYEVELVSFVKEKE  388


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V++   L DGT    S       +F + +G     
Sbjct  154  DGGIFKKILVEGEKWENPKDLDEVLVNFEAQLEDGTVVAKS----DGVEFAVKEGHFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKK E  + T+ P   +GE G P +     +PPNATLQ  +EL+SW +V ++ 
Sbjct  210  LAKAVKTMKKKEKVLLTVKPQYGFGEKGKPASNGEGAVPPNATLQITLELVSWKTVSEVT  269



>ref|XP_009410619.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=549

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAEMDD--LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P  E +   +D PDD P +KVGEEKE+G QGLKKKLVKEG+GWETPE GDEVEVH
Sbjct  4    EDFDIPGGEEEAAMMDPPDDGPALKVGEEKEVGKQGLKKKLVKEGSGWETPEVGDEVEVH  63

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG+S
Sbjct  64   YTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGQS  123

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  124  GSPPTIPPNATLQFDVELLSWCSVKDICK  152


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 72/121 (60%), Gaps = 5/121 (4%)
 Frame = +3

Query  153  EIGD-QGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQG  326
            EIGD + + KK +KEG G++ P  G  V V   G L DGT F     D   PF+F   + 
Sbjct  266  EIGDDRKIIKKTLKEGEGYQKPNEGAVVTVKLIGKLQDGTVFVKKGHDEQEPFEFKSDEE  325

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  497
            QVI+G DQ + +MKKGE  + TIPP+ A+  + S      +P N+T+ ++VEL+S+V  K
Sbjct  326  QVIEGLDQAVMSMKKGEIALVTIPPEYAFSFTESKQELAVVPANSTVIYEVELVSFVKEK  385

Query  498  D  500
            +
Sbjct  386  E  386


 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  153  DGGIFKKILKEGEKWENPKDLDEVLVTYEARLEDGTVISKSEG----VEFTVKNGFFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P  A+G  G P +     +PPNATL  ++EL+SW +V +I
Sbjct  209  LAKAVKTMKKAERVLLTVKPQYAFGGKGRPASGDEGAVPPNATLCIELELISWKTVTEI  267



>ref|XP_010905157.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Elaeis 
guineensis]
Length=573

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 135/151 (89%), Gaps = 4/151 (3%)
 Frame = +3

Query  69   EDFDMPPA-EM---DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            +DFD+P   EM   D +D  D++PV+KVGEEKEIG QGLKKKLVKEG GW+TPE GDEVE
Sbjct  3    DDFDLPAGDEMMNEDAMDFADESPVLKVGEEKEIGKQGLKKKLVKEGEGWDTPEVGDEVE  62

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYG  122

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWSSVKDICK  153


 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 73/121 (60%), Gaps = 5/121 (4%)
 Frame = +3

Query  153  EIGD-QGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQG  326
            EIGD + + KK++KEG G+E P  G  V V   G L DGT F     D   PF+F   + 
Sbjct  267  EIGDDKKILKKVLKEGEGYERPNDGAVVTVKLIGKLQDGTVFVKKGYDDEAPFEFKTDEE  326

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  497
            QVI+G D+ + TMKKGE    TIP + A+G + S      +PPN+T+ ++VEL+S+V  K
Sbjct  327  QVIEGLDRAVITMKKGEVAYITIPHEYAFGSAESKQDLAVVPPNSTVIYEVELVSFVKEK  386

Query  498  D  500
            +
Sbjct  387  E  387


 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 68/119 (57%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+  G     
Sbjct  154  DGGIIKKILKEGEKWENPKDLDEVLVKYEARLEDGTVI--SKSEGV--EFTVKDGFFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P  A+GE G P +     +PPNATL  ++EL+SW +V +I
Sbjct  210  LAKAVKTMKKSEKVLLTVKPQYAFGEKGRPASGDESAVPPNATLNVELELVSWKTVSEI  268



>ref|XP_010905156.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Elaeis 
guineensis]
Length=574

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 135/151 (89%), Gaps = 4/151 (3%)
 Frame = +3

Query  69   EDFDMPPA-EM---DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            +DFD+P   EM   D +D  D++PV+KVGEEKEIG QGLKKKLVKEG GW+TPE GDEVE
Sbjct  3    DDFDLPAGDEMMNEDAMDFADESPVLKVGEEKEIGKQGLKKKLVKEGEGWDTPEVGDEVE  62

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYG  122

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWSSVKDICK  153


 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 73/121 (60%), Gaps = 5/121 (4%)
 Frame = +3

Query  153  EIGD-QGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQG  326
            EIGD + + KK++KEG G+E P  G  V V   G L DGT F     D   PF+F   + 
Sbjct  267  EIGDDKKILKKVLKEGEGYERPNDGAVVTVKLIGKLQDGTVFVKKGYDDEAPFEFKTDEE  326

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  497
            QVI+G D+ + TMKKGE    TIP + A+G + S      +PPN+T+ ++VEL+S+V  K
Sbjct  327  QVIEGLDRAVITMKKGEVAYITIPHEYAFGSAESKQDLAVVPPNSTVIYEVELVSFVKEK  386

Query  498  D  500
            +
Sbjct  387  E  387


 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 68/119 (57%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+  G     
Sbjct  154  DGGIIKKILKEGEKWENPKDLDEVLVKYEARLEDGTVI--SKSEGV--EFTVKDGFFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P  A+GE G P +     +PPNATL  ++EL+SW +V +I
Sbjct  210  LAKAVKTMKKSEKVLLTVKPQYAFGEKGRPASGDESAVPPNATLNVELELVSWKTVSEI  268



>ref|XP_002534361.1| peptidylprolyl isomerase, putative [Ricinus communis]
 gb|EEF28026.1| peptidylprolyl isomerase, putative [Ricinus communis]
Length=583

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 4/151 (3%)
 Frame = +3

Query  69   EDFDMPPA-EM---DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDFD+P   EM   DD+DL D +P++KVGEEKEIG QGLKKKLVKEG GW+TP+ GDEVE
Sbjct  3    EDFDIPAGDEMMMNDDVDLGDQSPILKVGEEKEIGKQGLKKKLVKEGEGWDTPDNGDEVE  62

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG
Sbjct  63   VHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYG  122

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
             SGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  ASGSPPTIPPNATLQFDVELLSWTSVKDICK  153


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 71/118 (60%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V++   G L DGT F      +    F+FT  + QVI
Sbjct  271  DKKVMKKILKEGEGYERPNDGSLVKLKLIGKLQDGTVFLKKGHDNEEELFEFTTDEEQVI  330

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            +G D+ +  MKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S+V  K+
Sbjct  331  EGLDRAVLAMKKGEVALVTIAPEYAFGASESKQELAVIPPNSTVYYEVELVSFVKEKE  388


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V++   L DGT    S       +F + +G     
Sbjct  154  DGGIFKKILVEGEKWENPKDLDEVLVNFEAQLEDGTVVAKS----DGVEFAVKEGHFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P   +GE G P +     +PPNATLQ  +EL+SW +V ++
Sbjct  210  LAKAVKTMKKKEKVLLTVKPQYGFGEKGKPASNGEGAVPPNATLQITLELVSWKTVSEV  268



>ref|XP_008778812.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008779082.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Phoenix 
dactylifera]
Length=578

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 136/152 (89%), Gaps = 5/152 (3%)
 Frame = +3

Query  69   EDFDMPPAEMDDL-DLPDD----NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  233
            EDFD+P  E + + DLP+D    +P++KVGEEKEIG QGLKKKL+KEG GWETPE GDEV
Sbjct  3    EDFDLPAGEEEMMNDLPNDDYEPHPILKVGEEKEIGRQGLKKKLLKEGQGWETPEVGDEV  62

Query  234  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  413
            EVHYTGTLLDG+KFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAY
Sbjct  63   EVHYTGTLLDGSKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAY  122

Query  414  GESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GESGSPPTIPPNATLQFDVELLSWTSVKDICK  154


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  W+ P+  DEV V+Y   L DGT    S       +FT+  G     
Sbjct  155  DGGIFKKILVEGEKWDNPKDRDEVLVNYEARLEDGTVISKS----DGVEFTVKDGYFCPA  210

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  +  + P  A+GE G   +     +PPNATL  ++EL+SW +V +I
Sbjct  211  LSKAVKTMKKGEKVLLAVKPQYAFGEKGRAASGDEGAVPPNATLDVELELISWKTVTEI  269


 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 61/102 (60%), Gaps = 4/102 (4%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  368
            EG G++ P  G  V+V   G L DGT F     D   PF+F   + QVI+G D+ + TMK
Sbjct  282  EGEGYQRPNDGAVVKVKLIGKLEDGTVFVKKGHDEEEPFEFKTDEEQVIEGLDRTVVTMK  341

Query  369  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
            KGE  + TIPP+ A+  + S      +PPN+T+ ++VEL+S+
Sbjct  342  KGELALVTIPPEYAFSSTESKQDLAVVPPNSTVYYEVELVSF  383



>ref|XP_008458076.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis 
melo]
Length=553

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 132/149 (89%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPA--EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P A    DDLDLPD+   +KVGEEKEIG QGLKKKL+KEG GW TPE GDEVEVH
Sbjct  3    EDFDIPAAPDMADDLDLPDETVALKVGEEKEIGSQGLKKKLLKEGEGWVTPENGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKK E  +FTIPPDLAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDLGIKTMKKNEKALFTIPPDLAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPP+ATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPSATLQFDVELLSWTSVKDICK  151


 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DG  F      D   PF+F   + QVI
Sbjct  269  DKKVIKKILKEGEGYEKPNDGAIVKVKLIGKLGDGKIFLRKGHDDGEEPFEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+++
Sbjct  329  DGLDKAVVTMKKGEIALLTIAPEYAFGSSESQQDLAVVPPNSTVYYEVELVAF  381


 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 62/119 (52%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  W+ P+  DEV V++   L DGT       +    +FT+  G     
Sbjct  152  DGGIFKKILTEGDKWDNPKDLDEVLVNFEAKLEDGTLV----AKADGVEFTVADGYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + +KTMK GE  + T+ P   +GE G         +PPNA+L   +EL+SW +V ++
Sbjct  208  LAKAVKTMKLGEKALLTVKPQYGFGEKGKSACGNEGAVPPNASLDITLELVSWKTVSEV  266



>ref|XP_009372201.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Pyrus 
x bretschneideri]
Length=572

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFDMP AE   +D DLP + P +KVGEEKEIG+QGLKKKL+KEG GW+ P+ GDEVEVH
Sbjct  3    EDFDMPAAEEMNEDFDLPGEGPALKVGEEKEIGNQGLKKKLLKEGEGWDNPKNGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD+GI+TMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDEGIRTMKKGEDALFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPP+ATLQFDVELLSW S+ DICK
Sbjct  123  GSPPTIPPSATLQFDVELLSWTSINDICK  151


 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 68/113 (60%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V  TG L DG +F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVKVKLTGKLQDGKEFLKKGHVEGEDLFEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ ++TMKKGE  + TI P+ A+G   S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVRTMKKGEVALLTIAPEYAFGSLESQQELAVVPPNSTVNYEVELVSF  381


 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV +++   L D T     +      +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVIINFEAQLEDKTLVAKYQ----AVEFTVKDGYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   YG+ G P +     +PPN TL   +EL+SW +V ++ 
Sbjct  208  ISKAVKTMKKGEKVLLTVKPQYGYGDKGKPASGSEGAVPPNTTLHITLELVSWRTVSEVT  267



>emb|CDP03935.1| unnamed protein product [Coffea canephora]
Length=575

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 134/152 (88%), Gaps = 6/152 (4%)
 Frame = +3

Query  69   EDFDMPPAEMDDLD-----LPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  233
            EDFDMP AE   +      LP+DN  +KVGEEKEIG +GLKKKLVKEG GW+TPE GDEV
Sbjct  3    EDFDMPSAEGMGMGMDDMDLPEDNS-LKVGEEKEIGKEGLKKKLVKEGEGWDTPENGDEV  61

Query  234  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  413
            EVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  +FTIPP+LAY
Sbjct  62   EVHYTGTLLDGTKFDSSRDRGTPFKFPLGQGQVIKGWDQGIKTMKKGENAVFTIPPELAY  121

Query  414  GESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GESGSPPTIPPNATLQFDVELLSWVSVKDICK
Sbjct  122  GESGSPPTIPPNATLQFDVELLSWVSVKDICK  153


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  154  DGGIFKKILAEGEKWEHPKDLDEVLVKYEARLEDGTIVAKS----VEVEFTVQEGHFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL  ++EL+SW +V ++ 
Sbjct  210  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPVSGDQGAVPPNATLNINLELVSWKTVSNVT  269


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 68/119 (57%), Gaps = 6/119 (5%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS---RDRGTPFKFTLGQGQV  332
            D+ + KK++KEG G+E P  G  V++   G L D T F       D     +F   + QV
Sbjct  271  DKKVIKKILKEGEGYEKPNEGAVVKLKLVGKLQDSTVFVKKGYGDDEDDLLEFKTDEEQV  330

Query  333  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            I+G D+ +  MKKGE  + TI P+ A+G + S      +PPN+T+Q++ EL+S+V  K+
Sbjct  331  IEGLDKAVMAMKKGEVALLTIAPEYAFGSTESQQELAVVPPNSTVQYEAELVSFVKEKE  389



>ref|XP_011089642.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Sesamum 
indicum]
Length=573

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +3

Query  72   DFDMPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHY  245
            DF +PPA    +D+DLP++   MKVGEEKEIG+QGLKKKLVKEG GW+TP+ GDEVEVHY
Sbjct  4    DFGIPPATGLDEDMDLPEETSYMKVGEEKEIGEQGLKKKLVKEGEGWDTPDSGDEVEVHY  63

Query  246  TGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG  425
            TG LLDGTKFDSSRDRG PF FTLGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESG
Sbjct  64   TGILLDGTKFDSSRDRGEPFTFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGESG  123

Query  426  SPPTIPPNATLQFDVELLSWVSVKDICK  509
            SPPTIPPNATLQFDVELLSWVSVKDICK
Sbjct  124  SPPTIPPNATLQFDVELLSWVSVKDICK  151


 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 73/119 (61%), Gaps = 6/119 (5%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQV  332
            D+ + KK++KEG G+E P  G  V++   G L DGT F       D    F+F + + QV
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTIFVKKGHGDDENDLFEFKVDEEQV  328

Query  333  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            I+G D+ +KTMKKGE  + T+ P+ A+G S S      +PPN+TL +DVEL+S+V  K+
Sbjct  329  IEGLDRAVKTMKKGEAALLTVAPEYAFGSSESQQELARVPPNSTLCYDVELVSFVKEKE  387


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L D T    S       +FT+ +G     
Sbjct  152  DGGIFKKILKEGEKWENPKDPDEVLVKYEARLEDETVIAKS----DGVEFTVQEGHFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL   +ELLSW +V ++ 
Sbjct  208  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPASGDEEAVPPNATLNIALELLSWKTVSNVT  267



>ref|XP_009385667.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 135/153 (88%), Gaps = 6/153 (4%)
 Frame = +3

Query  69   EDFDMPPAEMDD-----LDLPDDN-PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            E+FDMP  +M       +DLPDD+ PV+KVGEEKEIG QGLKKKLVKEG GW+TPE GDE
Sbjct  3    EEFDMPTEDMMGDPNGMMDLPDDDAPVLKVGEEKEIGKQGLKKKLVKEGDGWDTPEVGDE  62

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELA  122

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            YGESGSPPTIPPNA LQFDVELLSW S+KDICK
Sbjct  123  YGESGSPPTIPPNAILQFDVELLSWSSIKDICK  155


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 63/107 (59%), Gaps = 4/107 (4%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  368
            EG G+E P  G  V V   G L DGT F     D   PF+F   + QVI G D+ + TMK
Sbjct  283  EGEGYERPNDGAVVRVKLIGKLQDGTVFVKKGHDDQEPFEFKTDEEQVIDGLDRTVTTMK  342

Query  369  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            KGE  + TIPP+ A+  +GS      +PPNAT+ +++EL+S+V  K+
Sbjct  343  KGEIALVTIPPEYAFSSTGSKQDLAVVPPNATVVYEIELVSFVKEKE  389


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  156  DGGIIKKILKEGEKWENPKDLDEVLVKYEARLEDGTVISKS----DGVEFTVKDGFFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P  A+GE G   +     +PPNA+LQ ++EL SW +V +I
Sbjct  212  LAKAVKTMKKAEKVLLTVRPQYAFGEKGRSASGDECAVPPNASLQVELELFSWKTVTEI  270



>ref|XP_008794657.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Phoenix dactylifera]
Length=573

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 133/151 (88%), Gaps = 4/151 (3%)
 Frame = +3

Query  69   EDFDMPPA-EM---DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDFD+    EM   D +D  D++PV+KVGEEKEIG QGLKKKLVKEG  W+TPE GDEVE
Sbjct  3    EDFDLRAGDEMMNEDAMDFADESPVLKVGEEKEIGKQGLKKKLVKEGEVWDTPEVGDEVE  62

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYG  122

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWSSVKDICK  153


 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV   Y   L DGT    S       +FT+  G     
Sbjct  154  DGGIIKKILKEGEKWENPKDLDEVLAKYEARLEDGTVISKSEG----VEFTVKDGFFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P  A+GE G P +     +PPNATL  ++EL+SW +V +I
Sbjct  210  LAKAVKTMKKAEKVLLTVKPQYAFGEKGRPASGDEGAVPPNATLNVELELVSWKTVTEI  268


 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 61/107 (57%), Gaps = 4/107 (4%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  368
            EG G+E P  G  V V   G L DGT F     D   PF+F   + Q I+G D+ + TMK
Sbjct  281  EGEGYERPNEGAVVTVKLIGKLQDGTVFVKKGYDDEAPFEFKTDEEQAIEGLDRAVITMK  340

Query  369  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            KGE    TIPP+ A+  + S      IPPN+T+ ++VEL+S++  K+
Sbjct  341  KGEVACITIPPEYAFSSTESKQDLAVIPPNSTVIYEVELVSFLKEKE  387



>ref|XP_002301809.1| hypothetical protein POPTR_0002s24970g [Populus trichocarpa]
 gb|EEE81082.1| hypothetical protein POPTR_0002s24970g [Populus trichocarpa]
Length=575

 Score =   251 bits (642),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 135/153 (88%), Gaps = 6/153 (4%)
 Frame = +3

Query  69   EDFDMPPA-EM-----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            EDF++P   EM     D LDLPD+ P++KVGEEKEIG+QGLKKKL+KEG GW+TP+ GDE
Sbjct  3    EDFELPTGDEMMMNNGDQLDLPDEGPMLKVGEEKEIGNQGLKKKLLKEGEGWDTPDNGDE  62

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            VEVHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP DLA
Sbjct  63   VEVHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDLGIKTMKKGENALFTIPADLA  122

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            YG SGSPPTIPPNATLQFDVELLSW S+KDICK
Sbjct  123  YGSSGSPPTIPPNATLQFDVELLSWSSIKDICK  155


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 68/112 (61%), Gaps = 4/112 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  338
            D+ + KK++KEG G++ P  G  V+V   G L DGT F    +D    F+F   + QVI 
Sbjct  273  DKKVIKKILKEGDGYDRPNEGAVVKVKLIGKLQDGTVFFKKGQDDSELFEFKTDEEQVID  332

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
            G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ +++EL+S+
Sbjct  333  GLDRAVSTMKKGELALLTIAPEYAFGSSESQQELAVVPPNSTVCYEIELVSF  384


 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 63/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DG    S   R    +FT+  G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVLVRYEAQLEDG----SVIARSDGVEFTVKDGHFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMK GE  + T+ P   +GE G P +     +PPNA +Q  +EL++W +V ++ 
Sbjct  212  LARAVKTMKMGEKVLLTVKPQYGFGEKGKPASGDESAVPPNANIQITLELVAWKTVTEVT  271



>ref|XP_011024591.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Populus euphratica]
Length=526

 Score =   250 bits (638),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 134/153 (88%), Gaps = 6/153 (4%)
 Frame = +3

Query  69   EDFDMPPA-EM-----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            EDF++P   EM     D LDLPD+ P++KVGEEKEIG+QGLKKKL+KEG GW+TP+ GDE
Sbjct  3    EDFELPTGDEMMMNNDDQLDLPDEGPMLKVGEEKEIGNQGLKKKLLKEGEGWDTPDNGDE  62

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            VEVHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP DLA
Sbjct  63   VEVHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDLGIKTMKKGENALFTIPADLA  122

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            YG SGS PTIPPNATLQFDVELLSW S+KDICK
Sbjct  123  YGSSGSAPTIPPNATLQFDVELLSWSSIKDICK  155


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 68/112 (61%), Gaps = 4/112 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F    +D    F+F   + QVI 
Sbjct  224  DKKVIKKILKEGNGYERPNEGAVVKVKLIGKLQDGTVFFKKGQDDSELFEFKTDEEQVID  283

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
            G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ +++EL+S+
Sbjct  284  GLDKAVTTMKKGELALLTIAPEYAFGSSESQQELAVVPPNSTVFYEIELVSF  335


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 5/66 (8%)
 Frame = +3

Query  324  GQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWV  488
            G       + +KTMK+GE  + T+ P   +GE G P +     +PPNA +Q  +EL++W 
Sbjct  157  GHFCPALARAVKTMKEGEKVLLTVKPQYGFGEKGKPASGDESAVPPNANIQITLELVAWK  216

Query  489  SVKDIC  506
            +V ++ 
Sbjct  217  TVTEVT  222



>ref|XP_008372538.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Malus 
domestica]
Length=572

 Score =   251 bits (640),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 132/149 (89%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFDMP AE   +D DLPD+ PV+KVGEEKEIG QGLKKKL+KEG GW+TP  GDEVEVH
Sbjct  3    EDFDMPGAEEMNEDFDLPDEGPVLKVGEEKEIGHQGLKKKLLKEGEGWDTPNNGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRD GTPFKFTLGQGQVIKGWD+GI+TMKKGE  +FTIPP LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDGGTPFKFTLGQGQVIKGWDEGIRTMKKGENALFTIPPALAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPP+ATLQFDVELLSW SV DI K
Sbjct  123  GSPPTIPPSATLQFDVELLSWTSVNDISK  151


 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V++   L D T    S+D     +FT+  G     
Sbjct  152  DGGVIKKILKEGEKWENPKDLDEVIVNFEAQLEDKTLVAKSQD----VEFTIKDGYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +G+ G P +     +PPN TL   +EL+SW +V ++ 
Sbjct  208  ISKAVKTMKKGEKVLLTVKPQYGFGDKGKPASGSEGAVPPNTTLHITLELVSWRTVSEVT  267


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V++   G L DG +F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGKEFLKKGHAEGEDLFEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL S+
Sbjct  329  DGLDRAVLTMKKGEVALLTIAPEYAFGSSESQQELAVVPPNSTVNYEVELASF  381



>ref|XP_006840897.1| hypothetical protein AMTR_s00087p00078190 [Amborella trichopoda]
 gb|ERN02572.1| hypothetical protein AMTR_s00087p00078190 [Amborella trichopoda]
Length=592

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = +3

Query  72   DFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHY  245
            DF +P A EM+ D DL DD+P +KVGEEKEIG +GLKKKLV EG+GWETPE GDEVEVHY
Sbjct  16   DFGIPDAGEMNEDFDLSDDSPALKVGEEKEIGKEGLKKKLVNEGSGWETPENGDEVEVHY  75

Query  246  TGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG  425
            TGTLLDGT+FDSSRDRG PFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG SG
Sbjct  76   TGTLLDGTQFDSSRDRGAPFKFKLGQGQVIKGWDQGIKTMKKGEKAIFTIPPELAYGASG  135

Query  426  SPPTIPPNATLQFDVELLSWVSVKDICK  509
            S PTIPPNATLQFDVELLSW SVKDICK
Sbjct  136  SEPTIPPNATLQFDVELLSWSSVKDICK  163


 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 63/106 (59%), Gaps = 3/106 (3%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKK  371
            EG  +E P  G  V+V +TG LLDGT F        PF+F  G+ QVI+G D+ + +MKK
Sbjct  293  EGERYEKPNDGAVVKVKFTGKLLDGTVFVQKGSDEKPFEFMTGEEQVIEGLDRAVMSMKK  352

Query  372  GECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            GE  + TI P+ A+    +      +P N+T+Q+D+EL+S+   K+
Sbjct  353  GEVALVTISPEYAFSSVNTQQDLAVVPANSTVQYDLELMSFAKEKE  398


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 11/122 (9%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL-DGTKFDSSRDRGTPFKFTLGQGQVIK  338
            D G+ KK++ EG  WE P+  DEV V Y   L  DGT    S+  G   +FT+ +G    
Sbjct  164  DGGIFKKILAEGEKWENPKDLDEVLVKYEVRLEEDGTIV--SKSEGV--EFTVKEGYFCP  219

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP------PTIPPNATLQFDVELLSWVSVKD  500
               + +KTMKKGE  + T+ P   +GE G          +P NATL   +EL+SW +V +
Sbjct  220  ALSKAVKTMKKGEKVLLTVKPQYGFGEKGGEACGEEGAAVPSNATLHVTLELVSWKTVSE  279

Query  501  IC  506
            + 
Sbjct  280  VT  281



>ref|XP_011024590.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Populus euphratica]
Length=575

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 134/153 (88%), Gaps = 6/153 (4%)
 Frame = +3

Query  69   EDFDMPPA-EM-----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            EDF++P   EM     D LDLPD+ P++KVGEEKEIG+QGLKKKL+KEG GW+TP+ GDE
Sbjct  3    EDFELPTGDEMMMNNDDQLDLPDEGPMLKVGEEKEIGNQGLKKKLLKEGEGWDTPDNGDE  62

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            VEVHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP DLA
Sbjct  63   VEVHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDLGIKTMKKGENALFTIPADLA  122

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            YG SGS PTIPPNATLQFDVELLSW S+KDICK
Sbjct  123  YGSSGSAPTIPPNATLQFDVELLSWSSIKDICK  155


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 68/112 (61%), Gaps = 4/112 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F    +D    F+F   + QVI 
Sbjct  273  DKKVIKKILKEGNGYERPNEGAVVKVKLIGKLQDGTVFFKKGQDDSELFEFKTDEEQVID  332

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
            G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ +++EL+S+
Sbjct  333  GLDKAVTTMKKGELALLTIAPEYAFGSSESQQELAVVPPNSTVFYEIELVSF  384


 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 63/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG   E P+  DEV V Y   L DG    S   R    +FT+  G     
Sbjct  156  DGGIFKKILVEGEKLENPKDLDEVLVRYEARLEDG----SVVARSDGVEFTVKNGHFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMK+GE  + T+ P   +GE G P +     +PPNA +Q  +EL++W +V ++ 
Sbjct  212  LARAVKTMKEGEKVLLTVKPQYGFGEKGKPASGDESAVPPNANIQITLELVAWKTVTEVT  271



>gb|EPS59147.1| hypothetical protein M569_15662, partial [Genlisea aurea]
Length=179

 Score =   238 bits (606),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 130/152 (86%), Gaps = 5/152 (3%)
 Frame = +3

Query  69   EDFDMPPAEM-----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  233
            +DFDM  AE      +++D+P+    +KVGEEKEIG +GLKKKLVKEG GW+TPE GDEV
Sbjct  3    DDFDMAQAEEGLGLDEEVDMPEAGNYLKVGEEKEIGKEGLKKKLVKEGEGWDTPENGDEV  62

Query  234  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  413
            EVHYTGTLLDGTKFDSSRDRG PF FTLGQGQVIKGWD GIKTMKKGE  IFTIP  LAY
Sbjct  63   EVHYTGTLLDGTKFDSSRDRGQPFTFTLGQGQVIKGWDVGIKTMKKGENAIFTIPAGLAY  122

Query  414  GESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GESGSPPTIPPNATLQFDVELLSWVSVKDICK
Sbjct  123  GESGSPPTIPPNATLQFDVELLSWVSVKDICK  154



>ref|XP_009349114.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Pyrus 
x bretschneideri]
Length=572

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 131/149 (88%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFDMP  E   +D DLPD+ PV+KVGEEKEIG QGLKKKL+KEG GW+TP  GDEVEVH
Sbjct  3    EDFDMPGVEEMNEDFDLPDEGPVLKVGEEKEIGHQGLKKKLLKEGEGWDTPNNGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRD GTPFKFTLGQGQVIKGWD+GI+TMKKGE  +FTIPP LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDSGTPFKFTLGQGQVIKGWDEGIRTMKKGENALFTIPPALAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPP+ATLQFDVELLSW SV DI K
Sbjct  123  GSPPTIPPSATLQFDVELLSWTSVNDISK  151


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V++   L D T    S+D     +FT+  G     
Sbjct  152  DGGVIKKILKEGEKWENPKDLDEVIVNFEVQLEDKTLVAKSQD----VEFTVKDGYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +G+ G P +     +PPN TL   +EL+SW +V ++ 
Sbjct  208  ISKAVKTMKKGEKVLLTVKPQYGFGDQGKPASGSEGAVPPNTTLHITLELVSWRTVSEVT  267


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 65/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V++   G L DG +F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGKEFLKKGHAEGEDLFEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKKGE  + TI P+ A+G   S      +PPN+T+ ++VEL S+
Sbjct  329  DGLDRAVLTMKKGEVALLTIAPEYAFGSLESHQELAVVPPNSTVNYEVELASF  381



>ref|XP_010036768.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW48406.1| hypothetical protein EUGRSUZ_K02110 [Eucalyptus grandis]
Length=574

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 134/152 (88%), Gaps = 5/152 (3%)
 Frame = +3

Query  69   EDFDMPPA-EMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  233
            EDFD+PPA EM++     D+    PVMK G+EKEIG QGLKKKLVKEG  WETP+ GDEV
Sbjct  4    EDFDIPPADEMNEDFDLPDDDDDAPVMKAGDEKEIGKQGLKKKLVKEGDAWETPDNGDEV  63

Query  234  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  413
            EVHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAY
Sbjct  64   EVHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAY  123

Query  414  GESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GE+GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  124  GEAGSPPTIPPNATLQFDVELLSWTSVKDICK  155


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  VEV   G L DGT F      D    FKF + + QV+
Sbjct  273  DKKVIKKILKEGEGYERPNEGAVVEVKLIGKLQDGTVFVKKGHDDSEELFKFKIDEEQVV  332

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             G D+ +  MKKGE  + T+ P+ A+G S S      +PP++T+ ++VEL+S+V  K+
Sbjct  333  DGLDKAVMNMKKGEVALLTVAPEYAFGSSESKQDLAVVPPSSTVYYEVELVSFVKDKE  390


 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT       R    +FT+ +G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVLVKYEVQLEDGTTIA----RSDGVEFTVKEGHFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATLQ  +EL+SW +V ++ 
Sbjct  212  VAKAVKTMKKGEKVLLTVKPQYGFGEKGKPASGDEGAVPPNATLQITLELVSWKTVSEVT  271



>gb|KJB37905.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=568

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = +3

Query  69   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            +DF+ P A   E D++D+P+D+PV   +KVGEEKEIG  GLKKKLVKEG GWE P  GDE
Sbjct  3    DDFEFPTASNMEEDEMDIPEDDPVSPILKVGEEKEIGKNGLKKKLVKEGEGWENPSSGDE  62

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIP +LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPAELA  122

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            YGESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSVKDICK  155


 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW SV DI 
Sbjct  212  LAKAVKTMKKGEKVLLTVKPQYGFGEDGRPATGGECAVPPNATLHITLELVSWKSVSDIT  271

Query  507  K  509
            K
Sbjct  272  K  272


 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK+VKEG G+E P  G  V+V   G L DGT F        PF+F + + QVI G
Sbjct  273  DKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVIDG  332

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +KTMKKGE  + TI P+ A+G S S      +P N+T+ ++VE++S+V  K+
Sbjct  333  LDKAVKTMKKGENALITIQPEYAFGSSESHQELAVVPANSTVYYEVEMVSFVKEKE  388



>gb|KJB37901.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=567

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = +3

Query  69   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            +DF+ P A   E D++D+P+D+PV   +KVGEEKEIG  GLKKKLVKEG GWE P  GDE
Sbjct  3    DDFEFPTASNMEEDEMDIPEDDPVSPILKVGEEKEIGKNGLKKKLVKEGEGWENPSSGDE  62

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIP +LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPAELA  122

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            YGESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSVKDICK  155


 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW SV DI 
Sbjct  212  LAKAVKTMKKGEKVLLTVKPQYGFGEDGRPATGGECAVPPNATLHITLELVSWKSVSDIT  271

Query  507  K  509
            K
Sbjct  272  K  272


 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK+VKEG G+E P  G  V+V   G L DGT F        PF+F + + QVI G
Sbjct  273  DKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVIDG  332

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +KTMKKGE  + TI P+ A+G S S      +P N+T+ ++VE++S+V  K+
Sbjct  333  LDKAVKTMKKGENALITIQPEYAFGSSESHQELAVVPANSTVYYEVEMVSFVKEKE  388



>ref|XP_010036767.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW48407.1| hypothetical protein EUGRSUZ_K02110 [Eucalyptus grandis]
Length=576

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 134/152 (88%), Gaps = 5/152 (3%)
 Frame = +3

Query  69   EDFDMPPA-EMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  233
            EDFD+PPA EM++     D+    PVMK G+EKEIG QGLKKKLVKEG  WETP+ GDEV
Sbjct  4    EDFDIPPADEMNEDFDLPDDDDDAPVMKAGDEKEIGKQGLKKKLVKEGDAWETPDNGDEV  63

Query  234  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  413
            EVHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAY
Sbjct  64   EVHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAY  123

Query  414  GESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GE+GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  124  GEAGSPPTIPPNATLQFDVELLSWTSVKDICK  155


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  VEV   G L DGT F      D    FKF + + QV+
Sbjct  273  DKKVIKKILKEGEGYERPNEGAVVEVKLIGKLQDGTVFVKKGHDDSEELFKFKIDEEQVV  332

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             G D+ +  MKKGE  + T+ P+ A+G S S      +PP++T+ ++VEL+S+V  K+
Sbjct  333  DGLDKAVMNMKKGEVALLTVAPEYAFGSSESKQDLAVVPPSSTVYYEVELVSFVKDKE  390


 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT       R    +FT+ +G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVLVKYEVQLEDGTTIA----RSDGVEFTVKEGHFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATLQ  +EL+SW +V ++ 
Sbjct  212  VAKAVKTMKKGEKVLLTVKPQYGFGEKGKPASGDEGAVPPNATLQITLELVSWKTVSEVT  271



>gb|KJB37902.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=451

 Score =   246 bits (627),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = +3

Query  69   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            +DF+ P A   E D++D+P+D+PV   +KVGEEKEIG  GLKKKLVKEG GWE P  GDE
Sbjct  3    DDFEFPTASNMEEDEMDIPEDDPVSPILKVGEEKEIGKNGLKKKLVKEGEGWENPSSGDE  62

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIP +LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPAELA  122

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            YGESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSVKDICK  155


 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKSDG----VEFTVGDGYFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW SV DI 
Sbjct  212  LAKAVKTMKKGEKVLLTVKPQYGFGEDGRPATGGECAVPPNATLHITLELVSWKSVSDIT  271

Query  507  K  509
            K
Sbjct  272  K  272


 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK+VKEG G+E P  G  V+V   G L DGT F        PF+F + + QVI G
Sbjct  273  DKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVIDG  332

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +KTMKKGE  + TI P+ A+G S S      +P N+T+ ++VE++S+V  K+
Sbjct  333  LDKAVKTMKKGENALITIQPEYAFGSSESHQELAVVPANSTVYYEVEMVSFVKEKE  388



>gb|KJB37904.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=559

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = +3

Query  69   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            +DF+ P A   E D++D+P+D+PV   +KVGEEKEIG  GLKKKLVKEG GWE P  GDE
Sbjct  3    DDFEFPTASNMEEDEMDIPEDDPVSPILKVGEEKEIGKNGLKKKLVKEGEGWENPSSGDE  62

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIP +LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPAELA  122

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            YGESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSVKDICK  155


 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW SV DI 
Sbjct  212  LAKAVKTMKKGEKVLLTVKPQYGFGEDGRPATGGECAVPPNATLHITLELVSWKSVSDIT  271

Query  507  K  509
            K
Sbjct  272  K  272


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 65/111 (59%), Gaps = 4/111 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK+VKEG G+E P  G  V+V   G L DGT F        PF+F + + QVI G
Sbjct  273  DKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVIDG  332

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             D+ +KTMKKGE  + TI P+ A+G S S      +P N+T+ ++ E  SW
Sbjct  333  LDKAVKTMKKGENALITIQPEYAFGSSESHQELAVVPANSTVYYE-EKESW  382



>gb|KJB37903.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=476

 Score =   246 bits (629),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = +3

Query  69   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            +DF+ P A   E D++D+P+D+PV   +KVGEEKEIG  GLKKKLVKEG GWE P  GDE
Sbjct  3    DDFEFPTASNMEEDEMDIPEDDPVSPILKVGEEKEIGKNGLKKKLVKEGEGWENPSSGDE  62

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIP +LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPAELA  122

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            YGESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSVKDICK  155


 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKSDG----VEFTVGDGYFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW SV DI 
Sbjct  212  LAKAVKTMKKGEKVLLTVKPQYGFGEDGRPATGGECAVPPNATLHITLELVSWKSVSDIT  271

Query  507  K  509
            K
Sbjct  272  K  272


 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK+VKEG G+E P  G  V+V   G L DGT F        PF+F + + QVI G
Sbjct  273  DKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVIDG  332

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +KTMKKGE  + TI P+ A+G S S      +P N+T+ ++VE++S+V  K+
Sbjct  333  LDKAVKTMKKGENALITIQPEYAFGSSESHQELAVVPANSTVYYEVEMVSFVKEKE  388



>gb|KHF97531.1| Peptidyl-prolyl cis-trans isomerase FKBP65 -like protein [Gossypium 
arboreum]
Length=567

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = +3

Query  69   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            +DF+ P A   E D++D+P+D+PV   +KVGEEKEIG  GLKKK+VKEG GWE P  GDE
Sbjct  3    DDFEFPTASNMEEDEMDIPEDDPVSPILKVGEEKEIGKNGLKKKVVKEGEGWENPSSGDE  62

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIP +LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPAELA  122

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            YGESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSVKDICK  155


 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW SV DI 
Sbjct  212  LAKAVKTMKKGEKVLLTVKPQYGFGEDGRPATGGECAVPPNATLHITLELVSWKSVSDIT  271

Query  507  K  509
            K
Sbjct  272  K  272


 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK+VKEG G+E P  G  V+V   G L DG  F        PF+F + + QVI G
Sbjct  273  DKRVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGKIFTKKGYDEEPFEFKIDEEQVIDG  332

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +KTMKKGE  + TI P+ A+G S S      +P N+T+ ++VE++S+V  K+
Sbjct  333  LDKAVKTMKKGENALITIQPEYAFGSSESHQELAVVPANSTVYYEVEMVSFVKEKE  388



>ref|XP_007134161.1| hypothetical protein PHAVU_010G024500g [Phaseolus vulgaris]
 gb|ESW06155.1| hypothetical protein PHAVU_010G024500g [Phaseolus vulgaris]
Length=574

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 131/151 (87%), Gaps = 4/151 (3%)
 Frame = +3

Query  69   EDFDMPPAEM--DDLDLPDD--NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            +DFDMPPA+   DD +   D   PV+KVGEEKEIG QGLKKKL+KEG GW TPE GDEV+
Sbjct  3    DDFDMPPADSMNDDFNFGGDLETPVLKVGEEKEIGQQGLKKKLLKEGEGWNTPEVGDEVQ  62

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGTPF FTLGQGQVIKGWDQGI TMKKGE  +FTIP +LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGTPFGFTLGQGQVIKGWDQGIVTMKKGENALFTIPAELAYG  122

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWTSVKDICK  153


 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK+V EG  WE P+  DEV V+Y   L DGT    S       +FT+  G     
Sbjct  154  DGGLFKKIVTEGEKWENPKDLDEVLVNYEARLEDGTLVAKS----DGVEFTVEDGYFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  I ++ P   +GE G P       +PPNA+L+  +EL+SW +V D+ 
Sbjct  210  LSKAVKTMKKGEKVILSVKPQYGFGEKGKPAHGDEGAVPPNASLEITLELVSWKTVSDVT  269


 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V++   G L DGT F      D G  F+F   + QVI
Sbjct  271  DKKVIKKILKEGEGYERPNEGAVVKLKVIGKLQDGTLFLKKGHDDEGELFEFKTDEEQVI  330

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKKGE  + TI P+  +G S S      +P N+TL ++VEL+S+
Sbjct  331  DGLDRAVLTMKKGEVALLTIAPEYGFGSSESQQELAVVPSNSTLYYEVELVSF  383



>emb|CDP15134.1| unnamed protein product [Coffea canephora]
Length=576

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 132/155 (85%), Gaps = 8/155 (5%)
 Frame = +3

Query  69   EDFDMPPA-----EM---DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            +DFD P A     EM   ++LDLP+ NPV+KVGEEKEIG  GLKKKL+ EG GWE P  G
Sbjct  3    DDFDFPSASNAADEMGMDEELDLPETNPVIKVGEEKEIGKNGLKKKLINEGEGWENPSSG  62

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHY GTLLDGT+FDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+
Sbjct  63   DEVEVHYVGTLLDGTQFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGEKALFTIPPE  122

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            LAYGESGSPPTIPPNATLQF+VELLSW SVKDICK
Sbjct  123  LAYGESGSPPTIPPNATLQFEVELLSWTSVKDICK  157


 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 67/120 (56%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG GW+ P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  158  DGGIFKKVLVEGEGWQNPKDLDEVFVKYEALLEDGTLISKS----DGVEFTVKDGFFCPA  213

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+    A+GE G P      ++PPNA+LQ ++EL+SW +V D+ 
Sbjct  214  LAKAVKTMKKGEKALLTVNSQYAFGEKGRPQVGDEISVPPNASLQINLELVSWKTVSDVT  273


 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 70/117 (60%), Gaps = 3/117 (3%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
             D+ + KK++KEG G+E P  G  V+V  TG L DGT F      G  F+F + + QV +
Sbjct  274  NDKKVLKKILKEGEGYERPNDGTVVKVKLTGKLQDGTVFVKKGHDGEEFEFKVDEEQVTE  333

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            G D+ +KTMK GE  +  + P+ A+G S S      +P ++TL +++E++S+V  K+
Sbjct  334  GLDRAVKTMKNGEMALVIVQPEYAFGPSESQQELAVVPADSTLYYEIEMVSFVKEKE  390



>ref|XP_008792944.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Phoenix dactylifera]
Length=574

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 131/151 (87%), Gaps = 4/151 (3%)
 Frame = +3

Query  69   EDFDMPPAEM----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDFD+P  E     D +D  D++P++KVGEEKEIG QGLKKK+VK+G G +TPE GDEVE
Sbjct  3    EDFDLPAGEEMMNEDAMDFADESPIIKVGEEKEIGKQGLKKKIVKDGEGRDTPEVGDEVE  62

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRG PFKF LGQG VIKGWDQGIKTMKKGE  +FTIPP+LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGAPFKFKLGQGHVIKGWDQGIKTMKKGENAVFTIPPELAYG  122

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWSSVKDICK  153


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 68/119 (57%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+  G     
Sbjct  154  DGGIMKKILKEGEKWENPKDLDEVLVKYEARLEDGTLV--SKAEGV--EFTVKDGFFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P  A+GE G P +     +PPNATL  ++EL+SW +V +I
Sbjct  210  LAKAVKTMKKAERVLLTVKPQYAFGEKGRPASGDEGAVPPNATLSVELELVSWKTVTEI  268


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 62/107 (58%), Gaps = 4/107 (4%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  368
            EG G+E P  G  V V   G L DGT F     D   PF+F   + QVI G DQ + TMK
Sbjct  281  EGEGYERPNDGAVVTVKLIGKLQDGTVFVKKGYDDEVPFEFKTDEEQVIDGLDQAVITMK  340

Query  369  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            KGE  + TIPP+ A+  + S      +PPN+T+ ++VEL+S+V  K+
Sbjct  341  KGEVALITIPPEYAFCSTESKQDLAVVPPNSTVTYEVELVSFVKEKE  387



>ref|XP_004510236.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cicer 
arietinum]
Length=577

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 131/153 (86%), Gaps = 6/153 (4%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLP----DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            EDFD+P  E   DD D      D+N ++KVGEEKEIG QGLKKKL+KEG  WETP+ GDE
Sbjct  3    EDFDIPATEPMNDDFDFAGVGDDENLILKVGEEKEIGKQGLKKKLIKEGEAWETPDVGDE  62

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            V+VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LA
Sbjct  63   VQVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDLGIKTMKKGENALFTIPAELA  122

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            YGESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSVKDICK  155


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 70/119 (59%), Gaps = 6/119 (5%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQV  332
            D+ + KK++KEG G+E P  G  V++   G L DGT F     S D    F+F   + QV
Sbjct  273  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHSDDEADLFEFKTDEEQV  332

Query  333  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            I G D+ + TMKKGE    TI P+ A+G S S      +PPN+TL +++EL+S+V  K+
Sbjct  333  IDGLDRAVMTMKKGEVASLTIAPEYAFGSSESQKELAVVPPNSTLYYELELVSFVKDKE  391


 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++KEG  WE P+  DEV V Y   L DGT    S       +F +  G     
Sbjct  156  DGGLFKKILKEGEKWENPKDPDEVFVKYEACLDDGTLVAKS----DGVEFAVKDGHFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  I T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  212  LSKAVKTMKKGEKVILTVKPQYGFGEKGKPAHGDEGAVPPNATLQIALELVSWKTVSEVT  271



>emb|CDX85348.1| BnaC07g26590D [Brassica napus]
Length=570

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 132/152 (87%), Gaps = 4/152 (3%)
 Frame = +3

Query  63   IMEDFDMP-PAEMDDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            + +DFDM  PAE  DLDL DD   +P +KVGEEKEIG  GLKKKLVKEG  W+TPE GDE
Sbjct  1    MADDFDMEIPAEEMDLDLEDDAESDPSLKVGEEKEIGKSGLKKKLVKEGEKWDTPESGDE  60

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIPP+LA
Sbjct  61   VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDMGIKTMKKGENAVFTIPPELA  120

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDIC  506
            YGE+GSPPTIP NATLQFDVELLSW SVKDIC
Sbjct  121  YGETGSPPTIPANATLQFDVELLSWRSVKDIC  152


 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 66/122 (54%), Gaps = 10/122 (8%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD GL KK++ EG  WE P+  DEV V Y   L DGT       R    +FT+  G    
Sbjct  153  GDGGLFKKIIAEGEKWEKPKDLDEVYVKYEARLEDGTVV----GRSEGVEFTVKDGHFCP  208

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP------PTIPPNATLQFDVELLSWVSVKD  500
               + +KTMK+GE  + T+ P   +GE+G P        IPPN TLQ D+EL+SW ++ +
Sbjct  209  AIAKAVKTMKRGEKVLLTVKPQYGFGETGRPVSDGVQAAIPPNVTLQIDLELVSWKTMVE  268

Query  501  IC  506
            + 
Sbjct  269  VT  270


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V++   G L DGT F      +   PF+F   + QVI
Sbjct  272  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHGEDEEPFEFKTDEEQVI  331

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGS---PPTIPPNATLQFDVELLSWVSVKD  500
            +G ++ +  MKKGE  + TI P+ A+G S S   P  IPP +T+ ++ EL+S++  K+
Sbjct  332  EGLEKAVMGMKKGEVALITISPEYAFGSSESKQEPAVIPPGSTVCYEAELVSFIKEKE  389



>gb|EYU39186.1| hypothetical protein MIMGU_mgv1a003614mg [Erythranthe guttata]
Length=574

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +3

Query  69   EDFDMPPAE--MD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  239
            +DFDMP A   MD D+DLP+ +  MKVG+EKEIG QGLKKKLVKEG GW+TP+ GDEV V
Sbjct  3    DDFDMPAAAEGMDEDMDLPEGSNFMKVGDEKEIGSQGLKKKLVKEGEGWDTPDNGDEVAV  62

Query  240  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  419
            HYTGTL+DGTKFDSSRDRG PF FTLGQGQVIKGWD GIKTMKKGE  IFTIP +LAYGE
Sbjct  63   HYTGTLVDGTKFDSSRDRGEPFTFTLGQGQVIKGWDLGIKTMKKGENAIFTIPAELAYGE  122

Query  420  SGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            SGSPPTIPPNATLQFDVELLSWVSVKDICK
Sbjct  123  SGSPPTIPPNATLQFDVELLSWVSVKDICK  152


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  153  DGGIFKKILKEGEKWENPKDPDEVFVKYEVKLDDGTVVSKS----DGVEFTVEEGHFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL   +EL+SW +V ++ 
Sbjct  209  LSKAVKTMKKGEAVLLTVKPQYGFGEKGKPASDGDGAVPPNATLNITLELVSWKTVSNVT  268


 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 69/119 (58%), Gaps = 6/119 (5%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQV  332
            D+ + KK++KEG G+E P  G  V++   G L DGT F       D    F+F + + QV
Sbjct  270  DKKVVKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFIKKGHGDDENDLFEFKVDEEQV  329

Query  333  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            I+G D+ +  MKKGE  +  I P+ A+G S S      +PPN+T+ ++ EL+S+V  K+
Sbjct  330  IEGLDKAVIAMKKGEVALLKIAPEYAFGSSESKQELAIVPPNSTVYYEAELVSFVKDKE  388



>ref|XP_004492269.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Cicer arietinum]
 ref|XP_004492270.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Cicer arietinum]
Length=545

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 134/151 (89%), Gaps = 6/151 (4%)
 Frame = +3

Query  63   IMEDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            + EDFD+P AE   +D DLP+D    KVGEE+EIGD+GLKKKL+KEG GW+TPE GDEV+
Sbjct  1    MNEDFDIPQAEEFNNDFDLPED----KVGEEREIGDRGLKKKLLKEGEGWDTPEIGDEVQ  56

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDR +PF FTLGQGQVI+GWD+GIKTMKKGE  +FTIPP+LAYG
Sbjct  57   VHYTGTLLDGTKFDSSRDRDSPFSFTLGQGQVIQGWDKGIKTMKKGENALFTIPPELAYG  116

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  117  ESGSPPTIPPNATLQFDVELLSWTSVKDICK  147


 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQV  332
             D+ + KK++KEG G+E P  G  V++   G L D T F +  RD     F+F   + QV
Sbjct  264  SDKKVIKKILKEGEGYEHPNEGAIVKLKLVGKLQDSTVFFEKGRDEEEKLFEFKTDEEQV  323

Query  333  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
            I G D+ + TMKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S+
Sbjct  324  IDGLDKAVMTMKKGEVALLTIAPEYAFGSSESQQELAVIPPNSTVYYEVELVSF  377


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 62/120 (52%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ K+++ EG  WE P+  DEV V Y   L DG     S       +FT+ +G     
Sbjct  148  DGGIFKRILSEGDKWENPKDLDEVLVKYEVCLEDGKVVAKS----DGVEFTVSEGHYCPA  203

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE     + P   +GE G P       +PPNATLQ  +EL+SW +V D+ 
Sbjct  204  LSKTVKTMKKGEKVNLLVKPQYGFGEKGKPADSDEGAVPPNATLQITLELVSWKTVSDVT  263



>emb|CDX86295.1| BnaA06g30120D [Brassica napus]
Length=573

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 132/155 (85%), Gaps = 7/155 (5%)
 Frame = +3

Query  63   IMEDFDMP----PAEMDDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  221
            + +DFDM      AE  DLDL DD   +P +KVGEEKEIG  GLKKKLVKEG  W+TPE 
Sbjct  1    MADDFDMEIPAEEAEEMDLDLEDDAESDPSLKVGEEKEIGKSGLKKKLVKEGEKWDTPES  60

Query  222  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  401
            GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIPP
Sbjct  61   GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDMGIKTMKKGENAVFTIPP  120

Query  402  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  506
            +LAYGE+GSPPTIPPNATLQFDVELLSW SVKDIC
Sbjct  121  ELAYGETGSPPTIPPNATLQFDVELLSWRSVKDIC  155


 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 67/122 (55%), Gaps = 10/122 (8%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD GL KK++ EG  WE P+  DEV V Y   L DGT       R    +FT+  G    
Sbjct  156  GDGGLFKKVIAEGEKWEKPKDLDEVYVKYEARLEDGTVV----GRSDGAEFTVKDGHFCP  211

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  500
               + +KTMK+GE  + T+ P   +GE+G   +      +PPNATLQ D+EL+SW +V +
Sbjct  212  AIAKAVKTMKRGEKVLLTVKPQYGFGETGRAASDGIQAAVPPNATLQMDLELVSWKTVVE  271

Query  501  IC  506
            + 
Sbjct  272  VT  273


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 80/138 (58%), Gaps = 10/138 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--  275
            DL+L     V++V ++K++      KK++KEG G+E P  G  V++   G L DGT F  
Sbjct  260  DLELVSWKTVVEVTDDKKV-----IKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLK  314

Query  276  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPP  446
                +   PF+F   + QVI+G ++ +  MKKGE  + TI  + A+G S S      IPP
Sbjct  315  KGHGEDEEPFEFKTDEEQVIEGLEKAVMGMKKGEVALITISAEYAFGSSESKQELAVIPP  374

Query  447  NATLQFDVELLSWVSVKD  500
            ++T+ ++VEL+S++  K+
Sbjct  375  DSTVCYEVELVSFIKEKE  392



>ref|XP_009151655.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65 [Brassica 
rapa]
Length=573

 Score =   246 bits (627),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 132/155 (85%), Gaps = 7/155 (5%)
 Frame = +3

Query  63   IMEDFDMP----PAEMDDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  221
            + +DFDM      AE  DLDL DD   +P +KVGEEKEIG  GLKKKLVKEG  W+TPE 
Sbjct  1    MADDFDMEIPAEEAEEMDLDLEDDAESDPSLKVGEEKEIGKSGLKKKLVKEGEKWDTPES  60

Query  222  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  401
            GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIPP
Sbjct  61   GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDMGIKTMKKGENAVFTIPP  120

Query  402  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  506
            +LAYGE+GSPPTIPPNATLQFDVELLSW SVKDIC
Sbjct  121  ELAYGETGSPPTIPPNATLQFDVELLSWRSVKDIC  155


 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 67/122 (55%), Gaps = 10/122 (8%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD GL KK++ EG  WE P+  DEV V Y   L DGT       R    KFT+  G    
Sbjct  156  GDGGLFKKVIAEGEKWEKPKDLDEVYVKYEARLEDGTVV----GRSDGAKFTVMDGHFCP  211

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  500
               + +KTMK+GE  + T+ P   +GE+G   +      +PPNATLQ D+EL+SW +V +
Sbjct  212  AIAKAVKTMKRGEKVLLTVKPQYGFGETGRAASDCIQAAVPPNATLQMDLELVSWKTVVE  271

Query  501  IC  506
            + 
Sbjct  272  VT  273


 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 81/138 (59%), Gaps = 10/138 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--  275
            DL+L     V++V ++K++      KK++KEG G+E P  G  V++   G L DGT F  
Sbjct  260  DLELVSWKTVVEVTDDKKV-----IKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFFK  314

Query  276  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPP  446
                +   PF+F   + QVI+G ++ +  MKKGE  + TI P+ A+G S S      IPP
Sbjct  315  KGHGEDEEPFEFKTDEEQVIEGLEKAVMGMKKGEVALITISPEYAFGSSESKQELAVIPP  374

Query  447  NATLQFDVELLSWVSVKD  500
            ++T+ ++VEL+S++  K+
Sbjct  375  DSTVCYEVELVSFIKEKE  392



>ref|XP_010547132.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Tarenaya 
hassleriana]
Length=573

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 133/155 (86%), Gaps = 8/155 (5%)
 Frame = +3

Query  69   EDFDMPPAE-MDDLDLPDDN-------PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            EDFD+P AE M+D ++   +       P MKVGEEKEIG QGLKKKLVKEG GW+TP+ G
Sbjct  3    EDFDLPAAEEMNDEEMDFADDVDADVAPYMKVGEEKEIGKQGLKKKLVKEGEGWDTPDNG  62

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKK E  +FTIPP+
Sbjct  63   DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKRENVVFTIPPE  122

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            LAYGESGSPPTIPPNA LQFDVELLSWVSVKDIC+
Sbjct  123  LAYGESGSPPTIPPNAMLQFDVELLSWVSVKDICR  157


 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 67/120 (56%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V EG  WE P+  DEV V Y   L DGT    S       +FTL +G     
Sbjct  158  DGGIFKKVVVEGEKWENPKDLDEVLVKYEARLEDGTVVGKS----DGVEFTLKEGHFCTA  213

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + ++ P   +GESG P       +PPNATLQ D+EL+SW +V ++ 
Sbjct  214  LGKAVKTMKKGEKVLLSVKPQYGFGESGKPAAVGEAAVPPNATLQIDLELVSWKTVSEVT  273


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G++ P  G  V+V   G L DGT F      +   PF+F   + QVI
Sbjct  275  DKKVIKKILKEGEGYDRPNDGAVVKVKLLGKLQDGTVFLKKGHGEGEEPFEFKTDEEQVI  334

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKD  500
            +G D+ +  MKKGE  + TI P  A+G S S      +PPN+T+ F+VEL+S+V  K+
Sbjct  335  EGLDRAVMNMKKGEVTLLTIAPQYAFGSSESQQELDVVPPNSTVYFEVELVSFVKEKE  392



>ref|XP_008382577.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Malus 
domestica]
Length=567

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 130/149 (87%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFDMP AE   +D DLP + P +KVGEEK IG QGLKKKL+KEG GW+ P+ GDEVEVH
Sbjct  3    EDFDMPAAEEMNEDFDLPGEGPALKVGEEKGIGTQGLKKKLLKEGEGWDNPKNGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD+GI+TMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDEGIRTMKKGEDALFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPP IPP+ATLQFDVELLSW S+ DI K
Sbjct  123  GSPPKIPPSATLQFDVELLSWTSINDISK  151


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V++  TG L DG +F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVKLKLTGKLQDGKEFLKKGHVEGEDLFEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGE---SGSPPTIPPNATLQFDVELLSW  485
             G D+ ++TMKKGE  + TI P+ A+G          +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVQTMKKGEVALLTIAPEYAFGSVEFQQELAVVPPNSTVNYEVELVSF  381


 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V++   L D T     +      +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVIVNFEAQLEDKTLVAKYQ----AVEFTVKDGYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +G+ G P +     +PPN TL   +EL+SW +V ++ 
Sbjct  208  ISKAVKTMKKGEKVLLTVKPQYGFGDKGKPASGSEGAVPPNTTLHITLELVSWRTVSEVT  267



>gb|EMT25795.1| 70 kDa peptidyl-prolyl isomerase [Aegilops tauschii]
Length=587

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 126/143 (88%), Gaps = 5/143 (3%)
 Frame = +3

Query  96   MDDLDLPD----DNPV-MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  260
            MD LD+ +    D+P  MKVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVHYTGTLL
Sbjct  28   MDGLDVDEEEEADSPATMKVGEEKEIGKQGLKKKLVKEGEGWERPETGDEVEVHYTGTLL  87

Query  261  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI  440
            DGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  + TIPPDLAYGE+GSPPTI
Sbjct  88   DGTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAVLTIPPDLAYGEAGSPPTI  147

Query  441  PPNATLQFDVELLSWVSVKDICK  509
            PPNATLQFDVELLSW SVKDICK
Sbjct  148  PPNATLQFDVELLSWASVKDICK  170


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DG+    S       +F +  G     
Sbjct  171  DGGIFKKVLVEGQKWENPKDLDEVTVKYEARLEDGSVVSKSEG----IEFAVKDGYFCPA  226

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  + T+ P   +GE G P +     +PPN+TL  D+EL+SW ++
Sbjct  227  LSKAVKTMKKGEKVLLTVKPQYGFGEQGRPASEVEAAVPPNSTLHIDLELVSWKTI  282


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 74/132 (56%), Gaps = 9/132 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L     +  +G++K I      KK++KEG G+E P  G  V V   G L DGT F  
Sbjct  273  DLELVSWKTITLIGDDKRI-----LKKVLKEGEGYERPNDGAVVRVRLIGKLDDGTVFTK  327

Query  282  SRDRG-TPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
                G  PF+F   + QVI+G D  + TMKKGE     IPP+ A+G + +      +PPN
Sbjct  328  KGHEGDEPFEFKTDEEQVIEGLDTTVLTMKKGEVASARIPPEHAFGSTETKLDIAMVPPN  387

Query  450  ATLQFDVELLSW  485
            +T+ ++V+L+S+
Sbjct  388  STVFYEVDLVSF  399



>ref|XP_008439052.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Cucumis melo]
Length=575

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 134/152 (88%), Gaps = 5/152 (3%)
 Frame = +3

Query  69   EDFDMPPAEM--DDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  233
            +DF+ P A    +++ LP+D   +PV+KVGEEKEIG  GLKKKLVKEG GWETP+ GDEV
Sbjct  3    DDFEFPSASNVDEEMGLPEDEAESPVLKVGEEKEIGKNGLKKKLVKEGEGWETPDTGDEV  62

Query  234  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  413
            EVHYTGTL+DGT+FDSSRDRGTPFKF LG+GQVIKGWD+GI+TMKKGE  IFTIPP+LAY
Sbjct  63   EVHYTGTLIDGTQFDSSRDRGTPFKFKLGEGQVIKGWDEGIRTMKKGENAIFTIPPELAY  122

Query  414  GESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GESGSPPTIPPNATLQFDVELLSW SVKDIC+
Sbjct  123  GESGSPPTIPPNATLQFDVELLSWHSVKDICQ  154


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 67/116 (58%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK  KEG G+E P  G  V+V  TG L DGT F    D   PF+F + + QV++G
Sbjct  272  DKKVLKKTQKEGEGYEQPNEGAVVQVKLTGKLADGTIFTKKGDDEKPFEFKIDEEQVVEG  331

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D  ++ MKKGE    TI P  A+G S S      +P N+ + ++VEL+S+V  K+
Sbjct  332  LDLAVRKMKKGEIASVTIHPQYAFGSSDSSQDLAVVPANSIVHYEVELVSFVKEKE  387


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ +G GWE P+  DEV V Y   L +GT    S       +FT+ +G     
Sbjct  155  DGGILKKILVKGDGWEKPKDLDEVWVRYEARLENGTLISKS----DGVEFTVEKGYFCPA  210

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
                +KTMKKGE  + T+ P   +GESG P       +PPN TLQ  ++L SW +V +I 
Sbjct  211  LATAVKTMKKGEKALLTVRPQYGFGESGRPVDGEEGAVPPNGTLQITLQLDSWKTVTEIT  270

Query  507  K  509
            K
Sbjct  271  K  271



>ref|XP_010482107.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Camelina 
sativa]
Length=578

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 133/159 (84%), Gaps = 13/159 (8%)
 Frame = +3

Query  69   EDFDM-------PPAEMD-DLDLPDDN-----PVMKVGEEKEIGDQGLKKKLVKEGAGWE  209
            +DFDM        P EMD D+DLP+D+     P +K+GEEKEIG  GLKKKLVKEG  W+
Sbjct  3    DDFDMHQFPAEEQPEEMDMDMDLPEDDEADSAPYLKIGEEKEIGKSGLKKKLVKEGEKWD  62

Query  210  TPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIF  389
            TPE GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  +F
Sbjct  63   TPENGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGHVIKGWDIGIKTMKKGENAVF  122

Query  390  TIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  506
            TIPP+LAYGE+GSPPTIPPNATLQFDVEL+SW SVKDIC
Sbjct  123  TIPPELAYGETGSPPTIPPNATLQFDVELISWRSVKDIC  161


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (60%), Gaps = 4/117 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  338
            D+ + KK++KEG G+E P  G  V++   G L DGT F     D   PF+F   + QVI+
Sbjct  281  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHDEEEPFEFKTDEEQVIE  340

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            G+++ +  MKKGE     I P+ A+G S S      IPPN+T+ ++VEL+S++  K+
Sbjct  341  GFEKAVMGMKKGEVAFIMISPEYAFGSSESKQELAVIPPNSTVSYEVELVSFIKEKE  397


 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 66/122 (54%), Gaps = 10/122 (8%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++ EG  WE P+  D V V Y   L DGT    S       +FT+ +G +  
Sbjct  162  GDGGVFKKVIVEGEKWEKPKDLDAVYVKYEARLEDGTIVGKS----DGVEFTVKEGHLCP  217

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP------PTIPPNATLQFDVELLSWVSVKD  500
               + +KTMK+GE  + T+ P   +GE G P        IPPNATLQ D+EL+SW  V +
Sbjct  218  ALAKAVKTMKRGEKVLLTVKPQYGFGEIGRPAFDGFQAAIPPNATLQIDLELVSWKIVVE  277

Query  501  IC  506
            + 
Sbjct  278  VT  279



>ref|XP_010550903.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Tarenaya 
hassleriana]
Length=549

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 132/151 (87%), Gaps = 5/151 (3%)
 Frame = +3

Query  69   EDFDMPPA---EMDDLDLP-DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            +DF MPP      ++LD   DD P++KVGEEKEI +QGLKKKL KEG G+ETPE GDEVE
Sbjct  3    DDFQMPPVGGMNGEELDFGGDDVPILKVGEEKEI-EQGLKKKLAKEGEGYETPENGDEVE  61

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTL+DGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIPP+LAYG
Sbjct  62   VHYTGTLMDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPPELAYG  121

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIP NATLQFDVELLSWVSVKDICK
Sbjct  122  ESGSPPTIPANATLQFDVELLSWVSVKDICK  152


 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 67/120 (56%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKILAEGEKWENPKDPDEVLVKYKARLEDGTVVAKS----DGVEFTVKDGHFCLA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
            + + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ D+EL+SW +V +I 
Sbjct  209  FAKAVKTMKKGEKVLLTVKPQYGFGEKGKPASGDDGAVPPNATLEIDLELVSWKTVSEIT  268


 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V V   G L DGT F      +   PF+F   + QVI
Sbjct  270  DKKVMKKILKEGEGYERPNEGATVRVKLIGKLQDGTVFLKKGHGEDEEPFEFKTDEEQVI  329

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ +  MKKGE  + TI P+ A+G S S      +PPN+T+ ++VELLS+
Sbjct  330  DGLDRAVMKMKKGEVALVTIEPEYAFGSSESKQELAVVPPNSTVYYEVELLSF  382



>emb|CDY15104.1| BnaC03g44650D [Brassica napus]
Length=277

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 129/151 (85%), Gaps = 5/151 (3%)
 Frame = +3

Query  69   EDFDMPPAEM----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDF+MPP       D++D  DD   +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVE
Sbjct  3    EDFEMPPVGGMNGDDEMDFGDDASFLKVGEEKEI-QQGLKKKLLKEGEGFETPENGDEVE  61

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  62   VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPSELAYG  121

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIP NATLQFDVELLSW SVKDICK
Sbjct  122  ESGSPPTIPANATLQFDVELLSWSSVKDICK  152


 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 62/116 (53%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V  G  WETP+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKIVAAGEKWETPKDLDEVLVKYVAKLEDGTVVGKSDG----VEFTVKDGYFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSV  494
              + +KTMKK E  + T+ P   +GE G P +     +PPNATL+ ++EL+SW  V
Sbjct  209  LAKAVKTMKKAEKVLLTVKPQYGFGEKGKPASAGEAAVPPNATLEIELELVSWKGV  264



>ref|XP_004975324.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Setaria 
italica]
Length=594

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 126/148 (85%), Gaps = 3/148 (2%)
 Frame = +3

Query  66   MEDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHY  245
            M+D D    E +D D P     MKVGEEKEIG QGLKKKLVKEG GW+ PE GDEVEVHY
Sbjct  28   MKDLDAGEGEDEDFDFPG---TMKVGEEKEIGKQGLKKKLVKEGEGWDRPETGDEVEVHY  84

Query  246  TGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG  425
            TG+LLDGTKFDSSRDRGTPFKF LGQGQVIKGWD GIKTMKKGE  +FTIPP+LAYGE+G
Sbjct  85   TGSLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDLGIKTMKKGENAVFTIPPELAYGETG  144

Query  426  SPPTIPPNATLQFDVELLSWVSVKDICK  509
            SPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  145  SPPTIPPNATLQFDVELLSWASVKDICK  172


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+VKEG  WE P+  DEV V Y   L DGT    S       +F +  G     
Sbjct  173  DGGIFKKIVKEGEKWENPKDLDEVFVKYEARLEDGTVVSKS----DGVEFAVKDGYFCPA  228

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL  D+EL+SW +V
Sbjct  229  LAKAVKTMKKGEKVLLTVKPQYGFGEQGRPASGDESAVPPNATLHIDLELVSWKTV  284


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 73/132 (55%), Gaps = 9/132 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  278
            DL+L     V  +G+ K I      KK++KEG G+E P  G  V V   G L DGT F  
Sbjct  275  DLELVSWKTVTLIGDRKRI-----LKKVLKEGEGYERPNDGAVVRVRLIGKLEDGTVFVK  329

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
               D   PF+F   + QVI+G D  +  MKKGE  +  IPP+ A+G + +      +PPN
Sbjct  330  KGHDGEEPFEFKTDEEQVIEGLDITVVNMKKGEVALARIPPEHAFGSAETKQDLAVVPPN  389

Query  450  ATLQFDVELLSW  485
            +T+ ++VEL+S+
Sbjct  390  STVFYEVELVSF  401



>gb|KGN57238.1| hypothetical protein Csa_3G172920 [Cucumis sativus]
Length=575

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 133/152 (88%), Gaps = 5/152 (3%)
 Frame = +3

Query  69   EDFDMPPAEM--DDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  233
            +DF+ P A    +++ LP+D   +PV+ VG+EKEIG  GLKKKLVKEG GWETP+ GDEV
Sbjct  3    DDFEFPSASNVDEEMGLPEDEAESPVLNVGQEKEIGKNGLKKKLVKEGEGWETPDTGDEV  62

Query  234  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  413
            EVHYTGTLLDGT+FDSSRDRGTPFKF LG+GQVIKGWD+GI+TMKKGE  +FTIPP+LAY
Sbjct  63   EVHYTGTLLDGTQFDSSRDRGTPFKFKLGEGQVIKGWDEGIRTMKKGENAVFTIPPELAY  122

Query  414  GESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GESGSPPTIPPNATLQFDVELLSW SVKDIC+
Sbjct  123  GESGSPPTIPPNATLQFDVELLSWHSVKDICQ  154


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK  KEG G+E P  G  V+V  TG L DGT F    D    F+F + + QVI+G
Sbjct  272  DKKVLKKTQKEGEGYEQPNEGAVVQVKLTGKLGDGTIFTKKGDDERTFEFKIDEEQVIEG  331

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D  ++ MKKGE  + TI P  A+G S S      +P N+T+ ++VEL+S+V  K+
Sbjct  332  LDLAVRKMKKGEIALVTIHPQYAFGSSDSSQDLAVVPANSTVYYEVELVSFVKEKE  387


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ +G GWE P+  DEV V Y   L +GT    S       +FT+ +G     
Sbjct  155  DGGILKKILVKGDGWEKPKDLDEVLVRYEARLENGTLISKS----DGVEFTVEKGYFCPA  210

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
                +KTMKKGE  + T+ P   +GESG P +     +PPN TLQ  ++L S  +V +I 
Sbjct  211  LATAVKTMKKGEKALLTVRPQYGFGESGRPVSGEEGAVPPNGTLQITLQLDSLKTVTEIT  270

Query  507  K  509
            K
Sbjct  271  K  271



>ref|XP_004160641.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Cucumis 
sativus]
Length=571

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 133/152 (88%), Gaps = 5/152 (3%)
 Frame = +3

Query  69   EDFDMPPAEM--DDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  233
            +DF+ P A    +++ LP+D   +PV+ VG+EKEIG  GLKKKLVKEG GWETP+ GDEV
Sbjct  3    DDFEFPSASNVDEEMGLPEDEAESPVLNVGQEKEIGKNGLKKKLVKEGEGWETPDTGDEV  62

Query  234  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  413
            EVHYTGTLLDGT+FDSSRDRGTPFKF LG+GQVIKGWD+GI+TMKKGE  +FTIPP+LAY
Sbjct  63   EVHYTGTLLDGTQFDSSRDRGTPFKFKLGEGQVIKGWDEGIRTMKKGENAVFTIPPELAY  122

Query  414  GESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GESGSPPTIPPNATLQFDVELLSW SVKDIC+
Sbjct  123  GESGSPPTIPPNATLQFDVELLSWHSVKDICQ  154


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK  KEG G+E P  G  V+V  TG L DGT F    D    F+F + + QVI+G
Sbjct  272  DKKVLKKTQKEGEGYEQPNEGAVVQVKLTGKLGDGTIFTKKGDDERTFEFKIDEEQVIEG  331

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D  ++ MKKGE  + TI P  A+G S S      +P N+T+ ++VEL+S+V  K+
Sbjct  332  LDLAVRKMKKGEIALVTIHPQYAFGSSDSSQDLAVVPANSTVYYEVELVSFVKEKE  387


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ +G GWE P+  DEV V Y   L +GT    S       +FT+ +G     
Sbjct  155  DGGILKKILVKGDGWEKPKDLDEVLVRYEARLENGTLISKS----DGVEFTVEKGYFCPA  210

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
                +KTMKKGE  + T+ P   +GESG P +     +PPN TLQ  ++L S  +V +I 
Sbjct  211  LATAVKTMKKGEKALLTVRPQYGFGESGRPVSGEEGAVPPNGTLQITLQLDSLKTVTEIT  270

Query  507  K  509
            K
Sbjct  271  K  271



>ref|XP_004147650.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Cucumis 
sativus]
Length=571

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 133/152 (88%), Gaps = 5/152 (3%)
 Frame = +3

Query  69   EDFDMPPAEM--DDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  233
            +DF+ P A    +++ LP+D   +PV+ VG+EKEIG  GLKKKLVKEG GWETP+ GDEV
Sbjct  3    DDFEFPSASNVDEEMGLPEDEAESPVLNVGQEKEIGKNGLKKKLVKEGEGWETPDTGDEV  62

Query  234  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  413
            EVHYTGTLLDGT+FDSSRDRGTPFKF LG+GQVIKGWD+GI+TMKKGE  +FTIPP+LAY
Sbjct  63   EVHYTGTLLDGTQFDSSRDRGTPFKFKLGEGQVIKGWDEGIRTMKKGENAVFTIPPELAY  122

Query  414  GESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GESGSPPTIPPNATLQFDVELLSW SVKDIC+
Sbjct  123  GESGSPPTIPPNATLQFDVELLSWHSVKDICQ  154


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK  KEG G+E P  G  V+V  TG L DGT F    D    F+F + + QVI+G
Sbjct  272  DKKVLKKTQKEGEGYEQPNEGAVVQVKLTGKLGDGTIFTKKGDDERTFEFKIDEEQVIEG  331

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D  ++ MKKGE  + TI P  A+G S S      +P N+T+ ++VEL+S+V  K+
Sbjct  332  LDLAVRKMKKGEIALVTIHPQYAFGSSDSSQDLAVVPANSTVYYEVELVSFVKEKE  387


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ +G GWE P+  DEV V Y   L +GT    S       +FT+ +G     
Sbjct  155  DGGILKKILVKGDGWEKPKDLDEVLVRYEARLENGTLISKS----DGVEFTVEKGYFCPA  210

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
                +KTMKKGE  + T+ P   +GESG P +     +PPN TLQ  ++L S  +V +I 
Sbjct  211  LATAVKTMKKGEKALLTVRPQYGFGESGRPVSGEEGAVPPNGTLQITLQLDSLKTVTEIT  270

Query  507  K  509
            K
Sbjct  271  K  271



>ref|XP_002883594.1| peptidylprolyl isomerase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59853.1| peptidylprolyl isomerase [Arabidopsis lyrata subsp. lyrata]
Length=551

 Score =   240 bits (612),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +3

Query  72   DFDMPPAEMDD-LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  248
            DF+MPP   DD +D  D    +KVGEEKEI  QGLKKKLVKEG G+ETPE GDEVEVHYT
Sbjct  4    DFEMPPVGDDDEMDFGDAASFLKVGEEKEI-QQGLKKKLVKEGEGYETPENGDEVEVHYT  62

Query  249  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
            GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYGE+GS
Sbjct  63   GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPSELAYGETGS  122

Query  429  PPTIPPNATLQFDVELLSWVSVKDICK  509
            PPTIP NATLQFDVELL+WVSVKDICK
Sbjct  123  PPTIPANATLQFDVELLTWVSVKDICK  149


 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 71/131 (54%), Gaps = 19/131 (15%)
 Frame = +3

Query  108  DLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DS  281
            ++ DDN VMK              K++KEG G+E P  G  V+V   G L DGT F    
Sbjct  263  EVTDDNKVMK--------------KILKEGEGYERPNEGAAVKVKLIGKLQDGTVFLKKG  308

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  452
              +   PF+F   + QV+ G D+ +  MKKGE  + TI P+ A+G + S      +PPN+
Sbjct  309  HGENEEPFEFKTDEEQVVDGLDRAVMKMKKGEVALVTIDPEYAFGSNESQQELAVVPPNS  368

Query  453  TLQFDVELLSW  485
            T+ ++V+LL++
Sbjct  369  TVTYEVDLLTF  379


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++  G  WE P+  DEV V +   L DGT    S       +FT+  G     
Sbjct  150  DGGVFKKILAVGEKWENPKDLDEVLVKFEAKLEDGTVVGKS----DGVEFTVKDGHFCPA  205

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  206  LTKAVKTMKKGEKVLLTVKPQYGFGEKGKPASAGDGAVPPNATLEINLELVSWKTVSEVT  265



>gb|ABK24451.1| unknown [Picea sitchensis]
Length=578

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 127/148 (86%), Gaps = 4/148 (3%)
 Frame = +3

Query  72   DFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHY  245
            DF++P     M++ DL  +  V KVGEEKEIG QGLKK LVKEG GWETPE GDEVEVHY
Sbjct  4    DFELPEGAGLMENEDL--NETVFKVGEEKEIGKQGLKKLLVKEGEGWETPETGDEVEVHY  61

Query  246  TGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG  425
            TGTLLD TKFDSSRDRGTPFKF LGQGQVIKGWDQGI TMKKGE  +FTIPP++AYGESG
Sbjct  62   TGTLLDSTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIATMKKGETAVFTIPPEMAYGESG  121

Query  426  SPPTIPPNATLQFDVELLSWVSVKDICK  509
            SPPTIPPNATL+FDVELLSW SVKDICK
Sbjct  122  SPPTIPPNATLKFDVELLSWASVKDICK  149


 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 82/150 (55%), Gaps = 9/150 (6%)
 Frame = +3

Query  63   IMEDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            I  D  +PP    M DL+L     V +V ++K++      KK++K+G G+E P  G   +
Sbjct  238  IGNDVAVPPNATLMVDLELVSWKVVDEVTDDKKV-----LKKILKQGEGYERPNDGAVAK  292

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            V YTG L DGT F+       PF+F  G+ QV+ G D+ + TMKKGE  + T+  +  Y 
Sbjct  293  VKYTGKLEDGTVFEKKGSDEEPFEFMTGEEQVVDGLDRAVMTMKKGEVALVTVAAEYGYE  352

Query  417  ESGSP--PTIPPNATLQFDVELLSWVSVKD  500
                     +PP +TL +DVEL+S+V  K+
Sbjct  353  TEIKTDLAVVPPKSTLIYDVELVSFVKEKE  382


 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 63/120 (53%), Gaps = 8/120 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S +     +F +  G     
Sbjct  150  DGGIFKKIIKEGEKWENPKEADEVLVKYEARLEDGTVVSKSEE---GVEFYVKDGYFCPA  206

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
            + + +KTMKKGE  + T+ P   +G  G         +PPNATL  D+EL+SW  V ++ 
Sbjct  207  FAKAVKTMKKGEKVLLTVKPQYGFGHKGRQAIGNDVAVPPNATLMVDLELVSWKVVDEVT  266



>emb|CDY52281.1| BnaA03g57740D [Brassica napus]
Length=558

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 129/151 (85%), Gaps = 5/151 (3%)
 Frame = +3

Query  69   EDFDMPPAEM----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDF+MPP       D++D  DD   +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVE
Sbjct  3    EDFEMPPVGGMNGDDEMDFGDDASFLKVGEEKEI-QQGLKKKLLKEGEGFETPENGDEVE  61

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  62   VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPSELAYG  121

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIP NATLQFDVELLSW SVKDICK
Sbjct  122  ESGSPPTIPANATLQFDVELLSWSSVKDICK  152


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V  G  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKIVAAGEKWEMPKDLDEVLVKYVAKLEDGTVVGKS----DGVEFTVKDGYFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKK E  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  209  LAKAVKTMKKAEKVLLTVKPQYGFGEKGKPASGGEAAVPPNATLEIELELVSWKTVSEVT  268


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D  + KK++KEG G+E P  G  V+V   G L DGT F      +   PF+F   + QVI
Sbjct  270  DNKVIKKILKEGEGYERPNEGAVVKVKLIGKLGDGTVFLKKGHGEGEEPFEFKTDEEQVI  329

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+TL ++V+L+S+
Sbjct  330  DGLDKAVLKMKKGEVALVTIDPEYAFGSTESKQELAVVPPNSTLYYEVDLVSF  382



>dbj|BAK01956.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=589

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  99   DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFD  278
            DD +  D    MKVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVHYTGTLLDGTKFD
Sbjct  35   DDEEEADSPATMKVGEEKEIGKQGLKKKLVKEGEGWEQPETGDEVEVHYTGTLLDGTKFD  94

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATL  458
            SSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  + TIPP+LAYGE+GSPPTIPPNATL
Sbjct  95   SSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAVLTIPPELAYGEAGSPPTIPPNATL  154

Query  459  QFDVELLSWVSVKDICK  509
            +FDVELLSW SVKDICK
Sbjct  155  RFDVELLSWASVKDICK  171


 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 75/132 (57%), Gaps = 9/132 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L     V  +G++K I      KK++KEG G+E P  G  V V   G L +GT F  
Sbjct  274  DLELVSWKTVTLIGDDKRI-----LKKVLKEGEGYERPNDGAVVRVRLIGKLDNGTVFTK  328

Query  282  SRDRG-TPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
                G  PF+F   + QVI+G D  + TMKKGE  +  IPP+ A+G + +      +PPN
Sbjct  329  KGHEGDEPFEFKTDEEQVIEGLDTTVVTMKKGEVALARIPPEHAFGSTETKLDLAVVPPN  388

Query  450  ATLQFDVELLSW  485
            +T+ ++VEL+S+
Sbjct  389  STVFYEVELVSF  400


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 62/116 (53%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DG+    S       +F +  G     
Sbjct  172  DGGIFKKVLVEGQKWENPKDLDEVLVKYEARLEDGSVVSKS----DGIEFAVKDGYFCPA  227

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  + T+ P   +GE G P +     +PPN+TL  D+EL+SW +V
Sbjct  228  LSKAVKTMKKGEKVLLTVKPQYGFGEQGRPASEVEGAVPPNSTLHIDLELVSWKTV  283



>emb|CDY15103.1| BnaC03g44640D [Brassica napus]
Length=558

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 129/151 (85%), Gaps = 5/151 (3%)
 Frame = +3

Query  69   EDFDMPPAEM----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDF+MPP       D++D  DD   +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVE
Sbjct  3    EDFEMPPVGGMNGDDEMDFGDDASFLKVGEEKEI-QQGLKKKLLKEGEGFETPENGDEVE  61

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  62   VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPSELAYG  121

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIP NATLQFDVELLSW SVKDICK
Sbjct  122  ESGSPPTIPANATLQFDVELLSWSSVKDICK  152


 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V  G  WETP+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKIVAAGEKWETPKDLDEVLVKYVAKLEDGTVVGKS----DGVEFTVKDGYFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKK E  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  209  LAKAVKTMKKAEKVLLTVKPQYGFGEKGKPASAGEAAVPPNATLEIELELVSWKTVSEVT  268


 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 65/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D  + KK++KEG G+E P  G  V+V   G L DGT F      +   PF+F   + QVI
Sbjct  270  DNKVIKKILKEGEGYERPNEGAVVKVKLIGKLGDGTVFLKKGHGEGEEPFEFKTDEEQVI  329

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ +  MKKGE  + TI P  A+G + S      +PPN+T+ ++V+L+S+
Sbjct  330  DGLDKALLKMKKGEVALVTIDPVYAFGSTESKQELAVVPPNSTVYYEVDLVSF  382



>ref|XP_009406340.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=578

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 132/151 (87%), Gaps = 4/151 (3%)
 Frame = +3

Query  69   EDFDMPPAE----MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            +DFD+P  E     D +DL DDNP +KVGEEKEIG QGL+KKLVKEG GW+ PE GDEVE
Sbjct  3    DDFDLPVGEETMDEDPMDLDDDNPTLKVGEEKEIGKQGLRKKLVKEGEGWDHPEAGDEVE  62

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDG+KFDSSRDRGTPF+F LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYG
Sbjct  63   VHYTGTLLDGSKFDSSRDRGTPFRFNLGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYG  122

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
             SGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  ASGSPPTIPPNATLQFDVELLSWTSVKDICK  153


 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ +G  W+ P+  DEV V Y   L DGT    S       +FTL  G     
Sbjct  154  DGGIFKKILTDGDKWDNPKDRDEVLVRYEARLEDGTVVSKSEG----VEFTLRDGYFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  + T+ P  A+GE     SG    +PP+ATL  D+EL+SW +V +I
Sbjct  210  LSKAVKTMKKGEKVLLTVMPQYAFGEDGRQASGDEGAVPPSATLHIDLELVSWKTVTEI  268


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 62/107 (58%), Gaps = 4/107 (4%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  368
            EG G+E P  G  V+V   G L DGT F     D   PF+F   + QVI+G DQ + +MK
Sbjct  281  EGEGYERPNDGAVVKVKLIGKLDDGTVFVKKGHDGDEPFEFKTDEEQVIEGLDQAVMSMK  340

Query  369  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            KGE    TIPP+ A+    S      +PPN+T+ +++EL+S+V  K+
Sbjct  341  KGEIAYVTIPPEHAFNRVESKQDLAVVPPNSTVHYEIELVSFVKEKE  387



>ref|XP_010532918.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Tarenaya 
hassleriana]
Length=566

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 132/152 (87%), Gaps = 6/152 (4%)
 Frame = +3

Query  69   EDFDMPPAE-MDDLDLP----DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  233
            +DF+MPP   M+D ++     DD P +KVGEEKEI  QGLKKKLVKEG G+ETPE GDEV
Sbjct  3    DDFEMPPVGGMNDEEMDFGGDDDAPFLKVGEEKEI-KQGLKKKLVKEGEGYETPENGDEV  61

Query  234  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  413
            EVHYTGTL+DGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE   FTIPP+LAY
Sbjct  62   EVHYTGTLMDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAAFTIPPELAY  121

Query  414  GESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GESGSPPTIP NATLQFDVELLSWVSVKDICK
Sbjct  122  GESGSPPTIPANATLQFDVELLSWVSVKDICK  153


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+        
Sbjct  154  DGGVFKKILAEGEKWENPKDPDEVLVKYVARLEDGTVVGKS----DGIEFTVKDDHFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V +I 
Sbjct  210  ISKAVKTMKKGEKVLLTVKPQYGFGEKGKPASGDDSAVPPNATLEINLELVSWKTVSEIT  269


 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 65/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSR--DRGTPFKFTLGQGQVI  335
            D+ + KK +KEG G+E P  G  V V   G L DGT F      +   PF+F   + QV+
Sbjct  271  DKKVMKKTLKEGEGYERPNEGAVVRVKLIGKLQDGTVFLKIGLGEDEEPFEFKTDEEQVV  330

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+T+ ++VELLS+
Sbjct  331  DGLDRAVMKMKKGEVALVTIEPEYAFGSAESKQELAVVPPNSTVCYEVELLSF  383



>ref|XP_002321107.2| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
 gb|EEE99422.2| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
Length=577

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 8/155 (5%)
 Frame = +3

Query  69   EDFDMPPAEMD-------DLDLPD-DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            EDF+ P    +       D+ +PD D  V+KVGEEKEIG  GLKKKLVKEG GW+TP  G
Sbjct  3    EDFEFPTGSNNMELEDEMDMGIPDPDEAVIKVGEEKEIGKNGLKKKLVKEGEGWDTPSAG  62

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHYTGTL+DGT+FDSSR+RGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+
Sbjct  63   DEVEVHYTGTLVDGTQFDSSRERGTPFKFKLGQGQVIKGWDEGIKTMKKGENAVFTIPPE  122

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            LAYGESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  LAYGESGSPPTIPPNATLQFDVELLSWTSVKDICK  157


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 68/110 (62%), Gaps = 4/110 (4%)
 Frame = +3

Query  183  LVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIK  359
            ++KEG G+E P+ G  V+V   G L DGT F     +   PF+F + + QVI G D+ +K
Sbjct  282  ILKEGEGYERPDDGTVVQVKLIGKLEDGTIFVKKGHEEEPPFEFKIDEEQVIDGLDRTVK  341

Query  360  TMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            TMKKGE  + TI P+ A+G S S     T+P NAT+ ++VE++S+   K+
Sbjct  342  TMKKGEVALVTIQPEYAFGRSESQQDLATVPVNATVYYEVEMISFTKEKE  391


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  W+ P+  DEV V Y   L +GT    S       +FT+G+G     
Sbjct  158  DGGIFKKIIVEGEKWDNPKDLDEVFVKYEARLENGTVVSKS----DGVEFTVGEGYFCPA  213

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  + T+ P   +GE+G         +PPNATL+  +ELLSW +V
Sbjct  214  LAKAVKTMKKGEKVLLTVKPQYGFGENGRTAAGDEGAVPPNATLEIMLELLSWKTV  269



>gb|KHN10949.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=544

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 129/147 (88%), Gaps = 6/147 (4%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  248
            EDFD+P  E  ++DL +D    KVGEE+EIG +GLKKKL+KEG GWETPE GDEV+VHY 
Sbjct  3    EDFDIPGGE--EMDLGED----KVGEEREIGSRGLKKKLLKEGQGWETPEVGDEVQVHYM  56

Query  249  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
            GTLLDGTKFDSSRDR +PF FTLGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESGS
Sbjct  57   GTLLDGTKFDSSRDRDSPFSFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGESGS  116

Query  429  PPTIPPNATLQFDVELLSWVSVKDICK  509
            PPTIPPNATLQFDVELLSW SVKDICK
Sbjct  117  PPTIPPNATLQFDVELLSWTSVKDICK  143


 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DG  F      +    F+F   + QV+
Sbjct  261  DKKVIKKILKEGEGYERPNEGAIVKVKLIGKLQDGAAFLKKGHDEEEKLFEFKTDEEQVV  320

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ F+VEL+S+
Sbjct  321  DGLDRAVLTMKKGEVALLTIAPEYAFGSSESQQELAVVPPNSTVYFEVELVSF  373


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V EG  WE P+  DEV V Y   L +G K  +  D     +FT+ +G     
Sbjct  144  DGGIFKKIVTEGDKWENPKDPDEVLVKYEVHLENG-KLVAKSD---GVEFTVREGHYCPA  199

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  200  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPEQGDEGAVPPNATLQITLELVSWKTVSEVT  259



>ref|XP_010442282.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Camelina 
sativa]
Length=576

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 131/157 (83%), Gaps = 13/157 (8%)
 Frame = +3

Query  72   DFDMP-------PAEMDDLDLPDDN-----PVMKVGEEKEIGDQGLKKKLVKEGAGWETP  215
            DFDM        P EMD +DLP+D+     P +K+GEEKEIG  GLKKKLVKEG  W+TP
Sbjct  4    DFDMQQFPAEEQPEEMD-MDLPEDDEADSAPYLKIGEEKEIGKSGLKKKLVKEGEKWDTP  62

Query  216  EPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTI  395
            E GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  +FTI
Sbjct  63   ENGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGHVIKGWDIGIKTMKKGENAVFTI  122

Query  396  PPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  506
            PP+LAYGE+GSPPTIPPNATLQFDVEL+SW SVKDIC
Sbjct  123  PPELAYGETGSPPTIPPNATLQFDVELISWRSVKDIC  159


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 79/137 (58%), Gaps = 9/137 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  278
            DL+L     V++V ++K++      KK++KEG G+E P  G  V++   G L DGT F  
Sbjct  264  DLELVSWKTVVEVTDDKKV-----IKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLK  318

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
               D   PF+F   + QVI+G ++ +  MKKGE     + P+ A+G S S      IPPN
Sbjct  319  KGHDEDEPFEFKTDEEQVIEGLEKAVMGMKKGEVAFIMVSPEYAFGSSESKQELAVIPPN  378

Query  450  ATLQFDVELLSWVSVKD  500
            +T+ ++VEL+S++  K+
Sbjct  379  STVSYEVELVSFIKEKE  395


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 67/122 (55%), Gaps = 10/122 (8%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G +  
Sbjct  160  GDGGVFKKIIVEGEKWEKPKDLDEVYVKYEARLEDGTIVGKS----DGAEFTVKEGHLCP  215

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGE------SGSPPTIPPNATLQFDVELLSWVSVKD  500
               + +KTMK+GE  + T+ P   +GE       G    IPPNATLQ D+EL+SW +V +
Sbjct  216  ALAKAVKTMKRGEKVLLTVKPQYGFGEIGRISFDGCQAAIPPNATLQIDLELVSWKTVVE  275

Query  501  IC  506
            + 
Sbjct  276  VT  277



>ref|XP_011000006.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Populus euphratica]
Length=577

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 8/155 (5%)
 Frame = +3

Query  69   EDFDMPPAEMD-------DLDLPD-DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            EDF+ P    +       D+ +PD D  V+KVGEEKEIG  GLKKKLVKEG GW+TP  G
Sbjct  3    EDFEFPTGSNNMELEDEMDMGVPDPDEAVIKVGEEKEIGKNGLKKKLVKEGEGWDTPSAG  62

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHYTGTL+DGT+FDSSR+RGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+
Sbjct  63   DEVEVHYTGTLVDGTQFDSSRERGTPFKFKLGQGQVIKGWDEGIKTMKKGENAVFTIPPE  122

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            LAYGESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  LAYGESGSPPTIPPNATLQFDVELLSWTSVKDICK  157


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +3

Query  183  LVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIK  359
            ++KEG G+E P+ G  V+V   G L DGT F     +   PF+F L + QVI G D+ +K
Sbjct  282  ILKEGEGYERPDDGTVVQVKLIGKLGDGTIFVKKGHEEEPPFEFKLDEEQVIDGLDRAVK  341

Query  360  TMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            TMKKGE  + TI P+ A+G S S     T+P NAT  ++VE++S+   K+
Sbjct  342  TMKKGEVALVTIQPEYAFGRSESQQDLATVPVNATAYYEVEMISFTKEKE  391


 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  W+ P+  DEV V Y   L +GT    S       +FT+G+G     
Sbjct  158  DGGIFKKIIVEGEKWDNPKDLDEVFVKYEARLENGTVVSKS----DGVEFTVGEGYFCPA  213

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  + T+ P   +GE G         +PPNATL+  +ELLSW +V
Sbjct  214  LAKAVKTMKKGEKVLLTVKPQYGFGEYGRTAAGDEGAVPPNATLEIMLELLSWKTV  269



>gb|KDP32575.1| hypothetical protein JCGZ_13125 [Jatropha curcas]
Length=579

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 134/156 (86%), Gaps = 9/156 (6%)
 Frame = +3

Query  69   EDFDMPPA--EMDD---LDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  221
            +DF+ P A  +M+D   +D+P++     PV+KVGEEKEIG  GLKKKL+KEG GWETP  
Sbjct  3    DDFEFPTANNKMEDDDVMDVPEEEDPVAPVVKVGEEKEIGKNGLKKKLIKEGEGWETPGI  62

Query  222  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  401
            GDEVEVHYTGTLLDGT+FDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP
Sbjct  63   GDEVEVHYTGTLLDGTQFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPP  122

Query  402  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            +LAYGESGSPPTIP NATLQF+VELLSW SVKDICK
Sbjct  123  ELAYGESGSPPTIPANATLQFNVELLSWTSVKDICK  158


 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (60%), Gaps = 4/117 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F     D   P +F + + QVI 
Sbjct  276  DKKVLKKILKEGEGYERPNDGTIVQVKLIGKLHDGTIFVKKGHDEEPPLEFKIDEEQVID  335

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            G D+ +K+MKKGE  +  I P+ A+G+  S     +IP N+TL ++VE++S+   K+
Sbjct  336  GLDKAVKSMKKGEVALVIIQPEYAFGQFESRQELASIPANSTLYYEVEMISFTKEKE  392


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  W+ P+  DEV V Y   L  GT    S       +FT+G G     
Sbjct  159  DGGIFKKILVEGEKWDNPKDLDEVLVKYEARLEHGTVISKS----DGVEFTVGDGYFCPA  214

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE+G P       +PPNATL+  +EL+SW +V D+ 
Sbjct  215  LAKAVKTMKKGEKVLLTVKPQYGFGENGRPALGSEGAVPPNATLEIMLELVSWKTVTDVT  274

Query  507  K  509
            K
Sbjct  275  K  275



>ref|XP_006375512.1| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
 gb|ERP53309.1| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
Length=608

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 8/155 (5%)
 Frame = +3

Query  69   EDFDMPPAEMD-------DLDLPD-DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            EDF+ P    +       D+ +PD D  V+KVGEEKEIG  GLKKKLVKEG GW+TP  G
Sbjct  3    EDFEFPTGSNNMELEDEMDMGIPDPDEAVIKVGEEKEIGKNGLKKKLVKEGEGWDTPSAG  62

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHYTGTL+DGT+FDSSR+RGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+
Sbjct  63   DEVEVHYTGTLVDGTQFDSSRERGTPFKFKLGQGQVIKGWDEGIKTMKKGENAVFTIPPE  122

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            LAYGESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  LAYGESGSPPTIPPNATLQFDVELLSWTSVKDICK  157


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 68/110 (62%), Gaps = 4/110 (4%)
 Frame = +3

Query  183  LVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIK  359
            ++KEG G+E P+ G  V+V   G L DGT F     +   PF+F + + QVI G D+ +K
Sbjct  282  ILKEGEGYERPDDGTVVQVKLIGKLEDGTIFVKKGHEEEPPFEFKIDEEQVIDGLDRTVK  341

Query  360  TMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            TMKKGE  + TI P+ A+G S S     T+P NAT+ ++VE++S+   K+
Sbjct  342  TMKKGEVALVTIQPEYAFGRSESQQDLATVPVNATVYYEVEMISFTKEKE  391


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  W+ P+  DEV V Y   L +GT    S       +FT+G+G     
Sbjct  158  DGGIFKKIIVEGEKWDNPKDLDEVFVKYEARLENGTVVSKS----DGVEFTVGEGYFCPA  213

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  + T+ P   +GE+G         +PPNATL+  +ELLSW +V
Sbjct  214  LAKAVKTMKKGEKVLLTVKPQYGFGENGRTAAGDEGAVPPNATLEIMLELLSWKTV  269



>ref|XP_006297572.1| hypothetical protein CARUB_v10013595mg [Capsella rubella]
 gb|EOA30470.1| hypothetical protein CARUB_v10013595mg [Capsella rubella]
Length=478

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 130/151 (86%), Gaps = 5/151 (3%)
 Frame = +3

Query  69   EDFDMPPA----EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDF+MPP     + +D+D  D    +KVGEEKEI  QGLKKKL+KEG G+ETP+ GDEVE
Sbjct  3    EDFEMPPVGGMNDDEDMDFGDAASFLKVGEEKEI-QQGLKKKLLKEGDGYETPDNGDEVE  61

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  62   VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPSELAYG  121

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIP NATLQFDVELL+WVSVKDICK
Sbjct  122  ESGSPPTIPANATLQFDVELLTWVSVKDICK  152


 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 79/140 (56%), Gaps = 11/140 (8%)
 Frame = +3

Query  84   PPAEMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  260
            P A ++ +L+L   N V +V +     D  + KK++KEG G+E P  G  V+V   G L 
Sbjct  248  PNATLEINLELVSWNTVSEVTD-----DNKVMKKILKEGEGYERPNEGATVKVKLIGKLE  302

Query  261  DGTKF--DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP-  431
            DGT F      + G  F+F   + QV+ G D+ +  MKKGE  + T+ P+ A+G + S  
Sbjct  303  DGTVFLKKGHGEDGELFEFKTDEEQVVDGLDRAVMKMKKGEVALVTVAPEYAFGSNESQQ  362

Query  432  --PTIPPNATLQFDVELLSW  485
                +PPN+T+ ++V+L+++
Sbjct  363  ELAVVPPNSTVYYEVDLVTF  382


 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++  G  WE P+  DEV V +   L +GT    S       +FT+  G     
Sbjct  153  DGGVFKKILAVGEKWENPKDLDEVFVKFEAKLDNGTVVGKS----DGVEFTVKDGHFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  209  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPASAGEGAVPPNATLEINLELVSWNTVSEVT  268



>ref|XP_003552100.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Glycine 
max]
Length=544

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 129/147 (88%), Gaps = 6/147 (4%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  248
            EDFD+P  E  ++DL +D    +VGEE+EIG  GLKKKL+KEG GWETPE GDEV+VHYT
Sbjct  3    EDFDIPGGE--EMDLGED----EVGEEREIGSGGLKKKLLKEGQGWETPEVGDEVQVHYT  56

Query  249  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
            GTLLDGTKFDSSRDR +PF FTLGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESGS
Sbjct  57   GTLLDGTKFDSSRDRDSPFSFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGESGS  116

Query  429  PPTIPPNATLQFDVELLSWVSVKDICK  509
            PPTIPPNATLQFDVELLSW SVKDICK
Sbjct  117  PPTIPPNATLQFDVELLSWTSVKDICK  143


 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QV+
Sbjct  261  DKKVIKKILKEGEGYERPNEGAIVKVKLIGKLQDGTAFLKKGHDEEEKLFEFKTDEEQVV  320

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKKGE  + TI PD A+G S S      +PPN+T+ F+VEL+S+
Sbjct  321  DGLDRAVLTMKKGEVALLTIAPDYAFGTSESQQELAVVPPNSTVYFEVELVSF  373


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L +G     S       +FT+ +G     
Sbjct  144  DGGIFKKIITEGEKWENPKDPDEVLVKYEVHLENGKLLAKSDGE----EFTVREGHYCPA  199

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  200  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPEQGDEGAVPPNATLQITLELVSWKTVSEVT  259



>ref|XP_011000005.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Populus euphratica]
Length=608

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 8/155 (5%)
 Frame = +3

Query  69   EDFDMPPAEMD-------DLDLPD-DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            EDF+ P    +       D+ +PD D  V+KVGEEKEIG  GLKKKLVKEG GW+TP  G
Sbjct  3    EDFEFPTGSNNMELEDEMDMGVPDPDEAVIKVGEEKEIGKNGLKKKLVKEGEGWDTPSAG  62

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHYTGTL+DGT+FDSSR+RGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+
Sbjct  63   DEVEVHYTGTLVDGTQFDSSRERGTPFKFKLGQGQVIKGWDEGIKTMKKGENAVFTIPPE  122

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            LAYGESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  LAYGESGSPPTIPPNATLQFDVELLSWTSVKDICK  157


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +3

Query  183  LVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIK  359
            ++KEG G+E P+ G  V+V   G L DGT F     +   PF+F L + QVI G D+ +K
Sbjct  282  ILKEGEGYERPDDGTVVQVKLIGKLGDGTIFVKKGHEEEPPFEFKLDEEQVIDGLDRAVK  341

Query  360  TMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            TMKKGE  + TI P+ A+G S S     T+P NAT  ++VE++S+   K+
Sbjct  342  TMKKGEVALVTIQPEYAFGRSESQQDLATVPVNATAYYEVEMISFTKEKE  391


 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  W+ P+  DEV V Y   L +GT    S       +FT+G+G     
Sbjct  158  DGGIFKKIIVEGEKWDNPKDLDEVFVKYEARLENGTVVSKS----DGVEFTVGEGYFCPA  213

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  + T+ P   +GE G         +PPNATL+  +ELLSW +V
Sbjct  214  LAKAVKTMKKGEKVLLTVKPQYGFGEYGRTAAGDEGAVPPNATLEIMLELLSWKTV  269



>ref|XP_004149324.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis 
sativus]
 ref|XP_004164600.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis 
sativus]
 gb|KGN44652.1| hypothetical protein Csa_7G363060 [Cucumis sativus]
Length=553

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDDNPV--MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFD+P A     DL   +    +KVGEEKEIG+QGLKKKL+KEG GW TPE GDEVEVH
Sbjct  3    EDFDIPAAPDMPDDLDLPDQTVPLKVGEEKEIGNQGLKKKLLKEGEGWVTPESGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKK E  +FTIPPDLAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDLGIKTMKKNEKALFTIPPDLAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPP+ATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPSATLQFDVELLSWTSVKDICK  151


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DG  F      D   P++F   + QVI
Sbjct  269  DKKVIKKILKEGEGYEKPNDGAIVKVKLIGKLGDGKIFLRKGHEDGEEPYEFKTDEEQVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+++
Sbjct  329  DGLDKAVVTMKKGEIALLTIAPEYAFGSSESQQDLAVVPPNSTVYYEVELVAF  381


 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 62/120 (52%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V++   L DGT       +    +FT+  G     
Sbjct  152  DGGIFKKILTEGDKWENPKDLDEVLVNFEAKLEDGTLI----AKADGVEFTVADGYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMK GE  + T+ P   +GE G         +PPNA+L   +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKLGEKALLTVKPQYGFGEKGKSARGNEGAVPPNASLDITLELVSWKTVSEVT  267



>gb|ABK95085.1| unknown [Populus trichocarpa]
Length=608

 Score =   239 bits (609),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 130/155 (84%), Gaps = 8/155 (5%)
 Frame = +3

Query  69   EDFDMPPAEMD-------DLDLPD-DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            EDF+ P    +       D+ +PD D  V+KVGEEKEIG  GLKKKLVKEG GW+TP  G
Sbjct  3    EDFEFPTGSNNMELEDEMDMGIPDPDEAVIKVGEEKEIGKNGLKKKLVKEGEGWDTPSAG  62

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHYTGTL+DGT+FDSSR+RGTPFKF LGQGQVIKGWD+GIKTMK+GE  +FTIPP+
Sbjct  63   DEVEVHYTGTLVDGTQFDSSRERGTPFKFKLGQGQVIKGWDEGIKTMKRGENAVFTIPPE  122

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            LAYGESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  LAYGESGSPPTIPPNATLQFDVELLSWTSVKDICK  157


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 68/110 (62%), Gaps = 4/110 (4%)
 Frame = +3

Query  183  LVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIK  359
            ++KEG G+E P+ G  V+V   G L DGT F     +   PF+F + + QVI G D+ +K
Sbjct  282  ILKEGEGYERPDDGTVVQVKLIGKLEDGTIFVKKGHEEEPPFEFKIDEEQVIDGLDRTVK  341

Query  360  TMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            TMKKGE  + TI P+ A+G S S     T+P NAT+ ++VE++S+   K+
Sbjct  342  TMKKGEVALVTIQPEYAFGRSESQQDLATVPVNATVYYEVEMISFTKEKE  391


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  W+ P+  DEV V Y   L +GT    S       +FT+G+G     
Sbjct  158  DGGIFKKIIVEGEKWDNPKDLDEVFVKYEARLENGTVVSKS----DGVEFTVGEGYFCPA  213

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  + T+ P   +GE+G         +PPNATL+  +ELLSW +V
Sbjct  214  LAKAVKTMKKGEKVLLTVKPQYGFGENGRTAAGDEGAVPPNATLEIMLELLSWKTV  269



>gb|EMS57053.1| 70 kDa peptidyl-prolyl isomerase [Triticum urartu]
Length=582

 Score =   238 bits (607),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  96   MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF  275
            MDD +       MKVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVHYTGTLLDG KF
Sbjct  28   MDDEEEAHSPATMKVGEEKEIGKQGLKKKLVKEGEGWERPETGDEVEVHYTGTLLDGAKF  87

Query  276  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNAT  455
            DSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  + TIPPDLAYGE+GSPP IPPNAT
Sbjct  88   DSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAVLTIPPDLAYGEAGSPPPIPPNAT  147

Query  456  LQFDVELLSWVSVKDICK  509
            L+FDVELLSW SVKDICK
Sbjct  148  LRFDVELLSWASVKDICK  165


 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 75/132 (57%), Gaps = 9/132 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L     V  +GE+K I      KK++KEGAG+E P  G  V V   G L DGT F  
Sbjct  268  DLELVSWKTVTLIGEDKRI-----LKKVLKEGAGYERPNDGAVVRVRLIGKLDDGTVFTK  322

Query  282  SRDRG-TPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
                G  PF+F   + QVI+G D  + TMKKGE     IPP+ A+G + +      +PPN
Sbjct  323  KGHEGDEPFEFRTDEEQVIEGLDTTVLTMKKGEVASARIPPEHAFGSTETKLDLAVVPPN  382

Query  450  ATLQFDVELLSW  485
            +T+ ++VEL+S+
Sbjct  383  STVFYEVELVSF  394


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 62/116 (53%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DG+    S       +F +  G     
Sbjct  166  DGGIFKKVLVEGQKWENPKDLDEVTVKYEARLEDGSVVSKSEG----IEFAVKDGYFCPA  221

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  + T+ P   +GE G P +     +PPN+TL  D+EL+SW +V
Sbjct  222  LSKAVKTMKKGEKVLLTVKPQYGFGEQGRPASEVEGAVPPNSTLHIDLELVSWKTV  277



>ref|XP_008222791.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Prunus mume]
Length=578

 Score =   238 bits (606),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 130/156 (83%), Gaps = 9/156 (6%)
 Frame = +3

Query  69   EDFDMPPAEMD----DLDLPD-----DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  221
            +DF+ P A  +    D+DLPD      +P  KVGEEKEIG  GLKKKLVKEG GW+TP  
Sbjct  3    DDFEFPAATNNLNDADMDLPDVEDDAISPSPKVGEEKEIGKNGLKKKLVKEGEGWDTPGS  62

Query  222  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  401
            GDEVEVHYTGTL+DGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP
Sbjct  63   GDEVEVHYTGTLVDGTKFDSSRDRGTPFKFNLGQGQVIKGWDEGIKTMKKGENAIFTIPP  122

Query  402  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            +LAYGESGSPPTIPPNATLQFDVELLSW SV+DI K
Sbjct  123  ELAYGESGSPPTIPPNATLQFDVELLSWTSVRDILK  158


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK +KEG G+E P  G  V+V   G L DGT F        P++F + + QVI G
Sbjct  276  DKKVLKKTLKEGEGYERPNDGSVVQVKLVGKLHDGTIFTKKGHDDEPYEFRIDEEQVIDG  335

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +K MKKGE  + TI P+ A+G S S      +P N+T+ ++VELLS+V  K+
Sbjct  336  LDRAVKNMKKGEVALVTIQPEYAFGSSESAQDLAVVPANSTVYYEVELLSFVKEKE  391


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 9/123 (7%)
 Frame = +3

Query  156  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  335
            + D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G   
Sbjct  157  LKDGGVIKKILTEGEKWENPKDLDEVFVKYEARLEDGTLVSKS----DGVEFTVQDGFFC  212

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKD  500
                + +KTMKKGE  +  + P   +GE G         +PPNA+L+  +EL+SW +V D
Sbjct  213  PALAKAVKTMKKGEKVLLNVKPQYGFGEVGRQAVGDEVAVPPNASLEITLELVSWKTVSD  272

Query  501  ICK  509
            + K
Sbjct  273  VTK  275



>gb|KHG01160.1| Peptidyl-prolyl cis-trans isomerase FKBP65 -like protein [Gossypium 
arboreum]
Length=606

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 130/153 (85%), Gaps = 6/153 (4%)
 Frame = +3

Query  69   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            +DFD P A   E D++ +  D+PV   ++VGEEKEIG  GLKKKLVK+G GWETP  GDE
Sbjct  3    DDFDFPTANNVEEDEMGILGDDPVNSLLEVGEEKEIGKNGLKKKLVKQGEGWETPSNGDE  62

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LG GQVIKGWD+GIKTMKKGE  IFTIPP+LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGLGQVIKGWDEGIKTMKKGENAIFTIPPELA  122

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            YGESGSPPTIPPNATLQFDVELLSW S KDICK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSFKDICK  155


 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISQS----GGLEFTVGDGYFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P  A+GE G P       +PPNATL   +EL+SW SV D+ 
Sbjct  212  LAKAVKTMKKGEKVLLIVKPQYAFGEDGRPALGSEGAVPPNATLHVTLELVSWKSVSDVT  271

Query  507  K  509
            K
Sbjct  272  K  272


 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 68/111 (61%), Gaps = 3/111 (3%)
 Frame = +3

Query  177  KKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGI  356
            KK++KEG G++ P+ G  V+V + G L DG  F         F+F + + QVI G DQ +
Sbjct  278  KKILKEGEGYKRPDDGTIVQVKFIGKLEDGKIFVKKGHDDELFEFKIDEEQVIDGLDQAV  337

Query  357  KTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            KTMKKGE  + TI P+ A+G S S      +P N+T+ +++E++S+V  K+
Sbjct  338  KTMKKGELALITIQPEYAFGSSESQQELAVVPANSTVYYELEMVSFVKEKE  388



>ref|XP_004975323.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Setaria 
italica]
Length=709

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 126/148 (85%), Gaps = 3/148 (2%)
 Frame = +3

Query  66   MEDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHY  245
            M+D D    E +D D P     MKVGEEKEIG QGLKKKLVKEG GW+ PE GDEVEVHY
Sbjct  28   MKDLDAGEGEDEDFDFPG---TMKVGEEKEIGKQGLKKKLVKEGEGWDRPETGDEVEVHY  84

Query  246  TGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG  425
            TG+LLDGTKFDSSRDRGTPFKF LGQGQVIKGWD GIKTMKKGE  +FTIPP+LAYGE+G
Sbjct  85   TGSLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDLGIKTMKKGENAVFTIPPELAYGETG  144

Query  426  SPPTIPPNATLQFDVELLSWVSVKDICK  509
            SPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  145  SPPTIPPNATLQFDVELLSWASVKDICK  172


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 64/119 (54%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+VKEG  WE P+  DEV V Y   L DGT    S       +F +  G     
Sbjct  173  DGGIFKKIVKEGEKWENPKDLDEVFVKYEARLEDGTVVSKS----DGVEFAVKDGYFCPA  228

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL  D+EL+SW +V  I
Sbjct  229  LAKAVKTMKKGEKVLLTVKPQYGFGEQGRPASGDESAVPPNATLHIDLELVSWKTVTLI  287


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 73/132 (55%), Gaps = 9/132 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  278
            DL+L     V  +G+ K I      KK++KEG G+E P  G  V V   G L DGT F  
Sbjct  275  DLELVSWKTVTLIGDRKRI-----LKKVLKEGEGYERPNDGAVVRVRLIGKLEDGTVFVK  329

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
               D   PF+F   + QVI+G D  +  MKKGE  +  IPP+ A+G + +      +PPN
Sbjct  330  KGHDGEEPFEFKTDEEQVIEGLDITVVNMKKGEVALARIPPEHAFGSAETKQDLAVVPPN  389

Query  450  ATLQFDVELLSW  485
            +T+ ++VEL+S+
Sbjct  390  STVFYEVELVSF  401



>gb|KHN21278.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=418

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 6/147 (4%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  248
            EDFD+P  E  ++DL +D    +VGEE+EIG  GLKKKL+KEG GWETPE GDEV+VHYT
Sbjct  3    EDFDIPGGE--EMDLGED----EVGEEREIGSGGLKKKLLKEGQGWETPEVGDEVQVHYT  56

Query  249  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
            GTLLDG KFDSSRDR +PF FTLGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESGS
Sbjct  57   GTLLDGIKFDSSRDRDSPFSFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGESGS  116

Query  429  PPTIPPNATLQFDVELLSWVSVKDICK  509
            PPTIPPNATLQFDVELLSW SVKDICK
Sbjct  117  PPTIPPNATLQFDVELLSWTSVKDICK  143


 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QV+
Sbjct  261  DKKVIKKILKEGEGYERPNEGAIVKVKLIGKLQDGTAFLKKGHDEEEKLFEFKTDEEQVV  320

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKKGE  + TI PD A+G S S      +PPN+T+ F+VEL+S+
Sbjct  321  DGLDRAVLTMKKGEVALLTIAPDYAFGTSESQQELAVVPPNSTVYFEVELVSF  373


 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L +G     S       +FT+ +G     
Sbjct  144  DGGIFKKIITEGEKWENPKDPDEVLVKYEVHLENGKLLAKSDGE----EFTVREGHYCPA  199

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  200  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPEQGDEGAVPPNATLQITLELVSWKTVSEVT  259



>ref|XP_007222365.1| hypothetical protein PRUPE_ppa003399mg [Prunus persica]
 gb|EMJ23564.1| hypothetical protein PRUPE_ppa003399mg [Prunus persica]
Length=578

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 130/156 (83%), Gaps = 9/156 (6%)
 Frame = +3

Query  69   EDFDMPPAEMD----DLDLPD-----DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  221
            +DF+ P A  +    D+DLPD      +P  KVGEEKEIG  GLKKKLVKEG GW+TP  
Sbjct  3    DDFEFPAATNNLNDADMDLPDVEDDAISPSPKVGEEKEIGKNGLKKKLVKEGEGWDTPGS  62

Query  222  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  401
            GDEVEVHYTGTL+DGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP
Sbjct  63   GDEVEVHYTGTLVDGTKFDSSRDRGTPFKFNLGQGQVIKGWDEGIKTMKKGENAIFTIPP  122

Query  402  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            +LAYGESGSPPTIPPNATLQFDVELLSW SV+DI K
Sbjct  123  ELAYGESGSPPTIPPNATLQFDVELLSWTSVRDILK  158


 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK +KEG G+E P  G  V+V   G L DGT F        PF+F + + QVI G
Sbjct  276  DKKVLKKTLKEGEGYERPNDGSVVQVKLVGKLHDGTIFTKKGHDDEPFEFRIDEEQVIDG  335

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +K MKKGE  + TI P+ A+G S S      +P N+T+ ++VELLS+V  K+
Sbjct  336  LDRAVKNMKKGEVALVTIQPEYAFGSSESAQDLAVVPANSTVYYEVELLSFVKEKE  391


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 65/123 (53%), Gaps = 9/123 (7%)
 Frame = +3

Query  156  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  335
            + D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G   
Sbjct  157  LKDGGVIKKILTEGEKWENPKDLDEVFVKYEARLEDGTLVSKS----DGVEFTVQDGFFC  212

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKD  500
                + +KTMKKGE  +  + P   +GE G P       +PPNA+L+  +EL+SW +V D
Sbjct  213  PALAKAVKTMKKGEKVLLNVKPQYGFGEVGRPSVGDEGAVPPNASLEITLELVSWKTVSD  272

Query  501  ICK  509
            + K
Sbjct  273  VTK  275



>ref|XP_006659596.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Oryza brachyantha]
Length=579

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 131/157 (83%), Gaps = 10/157 (6%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDDN----------PVMKVGEEKEIGDQGLKKKLVKEGAGWETPE  218
            +DFDMP    +D+ + +D           PV+KVGEEKEIG QGL+KKL+KEG GWETPE
Sbjct  3    DDFDMPLPGAEDMMMGEDGMGDFGGGDDGPVLKVGEEKEIGKQGLRKKLLKEGEGWETPE  62

Query  219  PGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIP  398
             GDEVEVHYTGTL+DGTKFDSSRDRGTPFKF LGQGQVIKGWD GIKTMKKGE  +FTIP
Sbjct  63   VGDEVEVHYTGTLVDGTKFDSSRDRGTPFKFKLGQGQVIKGWDLGIKTMKKGENALFTIP  122

Query  399  PDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
             DLAYGE+GSPPTIPP+ATLQFDVELLSW SVKDICK
Sbjct  123  ADLAYGETGSPPTIPPSATLQFDVELLSWTSVKDICK  159


 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (60%), Gaps = 9/137 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L     V ++G++K+I      KK++KEG G+E P  G  V+V  TG L DGT F  
Sbjct  262  DLELVSWKTVTEIGDDKKI-----LKKVLKEGEGYERPNEGAVVKVKITGKLQDGTVFSK  316

Query  282  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
               D   PF+F   + +VI G D+ +  MKKGE  + TIPP+ A+G + S      +PPN
Sbjct  317  KGHDELEPFEFKTDEEEVIDGLDRAVLNMKKGEVALVTIPPEYAFGSAESKQDIAVVPPN  376

Query  450  ATLQFDVELLSWVSVKD  500
            +T+ ++VEL+S+V  K+
Sbjct  377  STVIYEVELVSFVKDKE  393


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 67/119 (56%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+  G     
Sbjct  160  DGGLFKKILKEGEKWENPKDLDEVFVKYEARLEDGTVV--SKSEGA--EFTVKDGLFCPA  215

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P   +GESG P       +PPNATL  D+EL+SW +V +I
Sbjct  216  LAKAVKTMKKAEKVLLTVKPQYGFGESGRPAAGEEGAVPPNATLLVDLELVSWKTVTEI  274



>gb|AGT17361.1| peptidylprolyl isomerase [Saccharum hybrid cultivar R570]
Length=590

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = +3

Query  66   MEDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHY  245
            MED D    + D+   P   P MKVGEEKEIG +GLKKKLVKEG GW+ PE GDEVEVHY
Sbjct  26   MEDLDDAGVDADEDYFP---PTMKVGEEKEIGKEGLKKKLVKEGEGWDRPETGDEVEVHY  82

Query  246  TGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG  425
            TGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD GIKTMKKGE  IFTIPP LAYGE+ 
Sbjct  83   TGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDLGIKTMKKGENAIFTIPPGLAYGETS  142

Query  426  SPPTIPPNATLQFDVELLSWVSVKDICK  509
            SPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  143  SPPTIPPNATLQFDVELLSWTSVKDICK  170


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 72/132 (55%), Gaps = 9/132 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  278
            DL+L     V  +G+ K I      KK++KEG G+E P  G  V V   G L DGT F  
Sbjct  273  DLELVSWKTVTLIGDRKRI-----LKKVLKEGEGYERPNDGAVVRVRLIGKLEDGTVFVK  327

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
               D   PF+F   + QVI+G D  +  MKKGE  +  +PP+ A+G   +      +PPN
Sbjct  328  KGHDGEEPFEFKTDEEQVIEGLDITVVNMKKGEVALVRVPPEHAFGSVETKQDLAIVPPN  387

Query  450  ATLQFDVELLSW  485
            +T+ ++VEL+S+
Sbjct  388  STVFYEVELVSF  399


 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 60/116 (52%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L  GT    S       +F +  G     
Sbjct  171  DGGIFKKILVEGEKWENPKDLDEVFVKYEARLEGGTVVSKS----DGVEFAVKDGYFCPA  226

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  + T+ P   +GE G P +     +PPNA L  D+EL+SW +V
Sbjct  227  LSKAVKTMKKGEKVLLTVKPQYGFGEQGKPASGDEHAVPPNAVLHIDLELVSWKTV  282



>ref|XP_007140683.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
 ref|XP_007140684.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
 gb|ESW12677.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
 gb|ESW12678.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
Length=544

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 129/147 (88%), Gaps = 6/147 (4%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  248
            EDF++P  E  ++DL +    +KVGEE+EIG  GLKKKL+KEG GWETPE GDEV+VHYT
Sbjct  3    EDFNIPGGE--EMDLGE----VKVGEEREIGSNGLKKKLLKEGQGWETPEVGDEVKVHYT  56

Query  249  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
            GTLLDGTKFDS+RDR +PF FTLGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESGS
Sbjct  57   GTLLDGTKFDSNRDRDSPFSFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGESGS  116

Query  429  PPTIPPNATLQFDVELLSWVSVKDICK  509
            PPTIPPNATLQFDVELLSW SVKDICK
Sbjct  117  PPTIPPNATLQFDVELLSWTSVKDICK  143


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DG     S       +FT+ +G     
Sbjct  144  DGGIFKKILTEGEKWENPKDPDEVLVKYEAHLEDGKLVGKS----DGVEFTVREGHYCPA  199

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P       +PPNA+L+  +EL+SW +V ++ 
Sbjct  200  LSKAVKTMKKGEKVVLTVKPQYGFGEKGKPAQGEEGAVPPNASLEITLELVSWKTVSEVT  259


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 59/103 (57%), Gaps = 5/103 (5%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP--FKFTLGQGQVIKGWDQGIKTM  365
            EG G+E P  G  V+V   G L DGT F S    G    F+F   + QV+ G D+ + TM
Sbjct  271  EGEGYERPNEGASVKVKLIGKLQDGTAFLSKGHDGEEKLFEFKTDEEQVVDGLDRAVLTM  330

Query  366  KKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
            KKGE  + TI P+ A+G S S      +P N+T+ F+VEL+S+
Sbjct  331  KKGEVALLTIEPEYAFGSSESQQDLAVVPSNSTVYFEVELVSF  373



>ref|XP_009136108.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Brassica 
rapa]
Length=550

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 128/151 (85%), Gaps = 5/151 (3%)
 Frame = +3

Query  69   EDFDMPPAEM----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDF+MPP       D++D  DD   +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVE
Sbjct  3    EDFEMPPVGGMNGDDEMDFGDDASFLKVGEEKEI-QQGLKKKLLKEGQGFETPENGDEVE  61

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSS DRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  62   VHYTGTLLDGTKFDSSLDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPSELAYG  121

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIP NATLQFDVELLSW SVKDICK
Sbjct  122  ESGSPPTIPANATLQFDVELLSWSSVKDICK  152


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D  + KK++KEG G+E P  G  V+V   G L DGT F      D   PF+F   + QVI
Sbjct  270  DNKVIKKILKEGEGYERPNEGAVVKVKLIGKLGDGTVFLKKGHGDGEEPFEFKTDEEQVI  329

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+TL ++V+L+S+
Sbjct  330  DGLDKALLKMKKGEVALVTIDPEYAFGSTESKQELAVVPPNSTLYYEVDLVSF  382


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V  G  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKIVAAGEKWEMPKDLDEVLVKYVAKLEDGTVVGKS----DGVEFTVKDGYFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKK E  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  209  LAKAVKTMKKAEKVLLTVKPQYGFGEKGKPASGGEAAVPPNATLEIELELVSWKTVSEVT  268



>ref|XP_010493687.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65 [Camelina 
sativa]
Length=575

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 130/157 (83%), Gaps = 12/157 (8%)
 Frame = +3

Query  69   EDFDMP------PAEMDDLDLPDDN-----PVMKVGEEKEIGDQGLKKKLVKEGAGWETP  215
            +DFDM       P EMD +DLPD +     P +K+GEEKEIG  GLKKKLVKEG  W+TP
Sbjct  3    DDFDMQQFPAEEPEEMD-MDLPDGDEADSAPYLKIGEEKEIGKSGLKKKLVKEGEKWDTP  61

Query  216  EPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTI  395
            E GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLG G VIKGWD GIKTMKKGE  +FTI
Sbjct  62   ENGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGHGHVIKGWDIGIKTMKKGENAVFTI  121

Query  396  PPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  506
            PP+LAYGE+GSPPTIPPNATLQFDVEL+SW SVKD+C
Sbjct  122  PPELAYGETGSPPTIPPNATLQFDVELISWRSVKDVC  158


 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 68/122 (56%), Gaps = 10/122 (8%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK + EG  WE P+  DEV V Y   L DGT    S       +FT+ +G +  
Sbjct  159  GDGGVFKKTILEGEKWEKPKDLDEVYVKYEARLEDGTIVGKSDGA----EFTVKEGYLCP  214

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  500
               + +KTMK+GE  + T+ P   +GE G P +      IPPNATL+ D+EL+SW +V +
Sbjct  215  ALAKAVKTMKRGEKVLLTVKPQYGFGEIGRPASDGCQAAIPPNATLEIDLELVSWKTVVE  274

Query  501  IC  506
            + 
Sbjct  275  VT  276


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 79/137 (58%), Gaps = 9/137 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  278
            DL+L     V++V ++K++      KK++KEG G+E P  G  V++   G L DGT F  
Sbjct  263  DLELVSWKTVVEVTDDKKV-----IKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLK  317

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
               +   PF+F   + QVI+G ++ +  MKKGE     IPP+ A+G S S      IPPN
Sbjct  318  KGHEEEEPFEFKTDEEQVIEGLEKAVMGMKKGEVAFIMIPPEYAFGSSESKQELAVIPPN  377

Query  450  ATLQFDVELLSWVSVKD  500
            +T+ ++VEL+ ++  K+
Sbjct  378  STVSYEVELVFFIKEKE  394



>ref|NP_001062292.1| Os08g0525600 [Oryza sativa Japonica Group]
 dbj|BAD11570.1| putative 70 kDa peptidylprolyl isomerase [Oryza sativa Japonica 
Group]
 dbj|BAF24206.1| Os08g0525600 [Oryza sativa Japonica Group]
 dbj|BAG95934.1| unnamed protein product [Oryza sativa Japonica Group]
Length=580

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 129/158 (82%), Gaps = 12/158 (8%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLP-----------DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETP  215
            +DF+MPP   DD DL             D P +KVGEEKEIG QGL+KKL+KEG GWETP
Sbjct  3    DDFEMPPPGADD-DLMMGEDGMGDFGGADGPPLKVGEEKEIGKQGLRKKLLKEGEGWETP  61

Query  216  EPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTI  395
            E GDEVEVHYTGTLLDG KFDSSRDRGTPFKF LGQGQVIKGWD GIKTMKKGE  +FTI
Sbjct  62   EVGDEVEVHYTGTLLDGKKFDSSRDRGTPFKFKLGQGQVIKGWDLGIKTMKKGENAVFTI  121

Query  396  PPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            PPDLAYGESGSPPTIP +ATLQFDVELLSW SVKDIC+
Sbjct  122  PPDLAYGESGSPPTIPASATLQFDVELLSWTSVKDICQ  159


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 73/121 (60%), Gaps = 5/121 (4%)
 Frame = +3

Query  153  EIGD-QGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQG  326
            EIGD + + KK++ EG G+E P  G  V+V  TG L DGT F     D   PF+F   + 
Sbjct  273  EIGDDKKILKKVLTEGTGYERPNEGAVVKVKITGKLQDGTIFTKKGHDEPEPFEFKTDEE  332

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  497
            +VI G D+ +  MK GE  + TIPP+ A+G + S      +PPN+T+ ++VEL+S+V  K
Sbjct  333  EVIDGIDRAVLNMKNGEVALVTIPPEYAFGSTESKQDLAVVPPNSTVIYEVELVSFVKDK  392

Query  498  D  500
            +
Sbjct  393  E  393


 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 67/119 (56%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+  G     
Sbjct  160  DGGIFKKILKEGEKWENPKDLDEVFVKYEARLEDGTVI--SKSEGA--EFTVKDGFFCPA  215

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P   +GE+G P       +PPNATL  ++EL+SW +V +I
Sbjct  216  LAKAVKTMKKAEKVLLTVKPQYGFGENGRPAAGEEGAVPPNATLLVNLELVSWKTVTEI  274



>gb|KJB71964.1| hypothetical protein B456_011G150600 [Gossypium raimondii]
Length=606

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 130/153 (85%), Gaps = 6/153 (4%)
 Frame = +3

Query  69   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            +DFD P A   E D++ +P+D+PV   ++VGEEKEIG  GLKKKLVK+G GW+TP  GDE
Sbjct  3    DDFDFPTANNVEEDEMGIPEDDPVNSLLEVGEEKEIGKNGLKKKLVKQGEGWDTPSNGDE  62

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            VEVHYTGTL DGTKFDSSRDRGTPFKF LG GQVIKGWD+GIKTMKKGE   FTIPP+LA
Sbjct  63   VEVHYTGTLHDGTKFDSSRDRGTPFKFKLGLGQVIKGWDEGIKTMKKGENAFFTIPPELA  122

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            YGESGSPPTIPPNATLQFDVELLSW S KDICK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSFKDICK  155


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLVSQS----GGLEFTVGDGYFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P  A+GE G P       +PPNATL   +EL+SW SV D+ 
Sbjct  212  LAKAVKTMKKGEKVLLIVKPQYAFGEDGRPALGSEGAVPPNATLHVTLELVSWKSVSDVT  271

Query  507  K  509
            K
Sbjct  272  K  272


 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 67/111 (60%), Gaps = 3/111 (3%)
 Frame = +3

Query  177  KKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGI  356
            KK++KEG G+E P  G  V+V + G L DG  F         F+F + + QVI G D+ +
Sbjct  278  KKILKEGEGYERPHDGTIVQVKFIGKLEDGKIFVKKGHDDELFEFKIDEEQVIDGLDKTV  337

Query  357  KTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            KTMKKGE  + TI P+ A+G S S      +P N+T+ ++VE++S+V  K+
Sbjct  338  KTMKKGELALITIQPEYAFGSSESQQELAVVPANSTVYYEVEMVSFVKEKE  388



>gb|KJB71963.1| hypothetical protein B456_011G150600 [Gossypium raimondii]
Length=607

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 130/153 (85%), Gaps = 6/153 (4%)
 Frame = +3

Query  69   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  230
            +DFD P A   E D++ +P+D+PV   ++VGEEKEIG  GLKKKLVK+G GW+TP  GDE
Sbjct  3    DDFDFPTANNVEEDEMGIPEDDPVNSLLEVGEEKEIGKNGLKKKLVKQGEGWDTPSNGDE  62

Query  231  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  410
            VEVHYTGTL DGTKFDSSRDRGTPFKF LG GQVIKGWD+GIKTMKKGE   FTIPP+LA
Sbjct  63   VEVHYTGTLHDGTKFDSSRDRGTPFKFKLGLGQVIKGWDEGIKTMKKGENAFFTIPPELA  122

Query  411  YGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            YGESGSPPTIPPNATLQFDVELLSW S KDICK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSFKDICK  155


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLVSQS----GGLEFTVGDGYFCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P  A+GE G P       +PPNATL   +EL+SW SV D+ 
Sbjct  212  LAKAVKTMKKGEKVLLIVKPQYAFGEDGRPALGSEGAVPPNATLHVTLELVSWKSVSDVT  271

Query  507  K  509
            K
Sbjct  272  K  272


 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 67/111 (60%), Gaps = 3/111 (3%)
 Frame = +3

Query  177  KKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGI  356
            KK++KEG G+E P  G  V+V + G L DG  F         F+F + + QVI G D+ +
Sbjct  278  KKILKEGEGYERPHDGTIVQVKFIGKLEDGKIFVKKGHDDELFEFKIDEEQVIDGLDKTV  337

Query  357  KTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            KTMKKGE  + TI P+ A+G S S      +P N+T+ ++VE++S+V  K+
Sbjct  338  KTMKKGELALITIQPEYAFGSSESQQELAVVPANSTVYYEVEMVSFVKEKE  388



>ref|XP_004296967.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Fragaria 
vesca subsp. vesca]
Length=566

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 9/156 (6%)
 Frame = +3

Query  69   EDFDMPPA---EMDDLDLPD--DNPV----MKVGEEKEIGDQGLKKKLVKEGAGWETPEP  221
            +DFD P     E  D+D+P+  D+ +    +KVG+EKE+G  GLKKKL+K+G GWETP  
Sbjct  3    DDFDFPTGPNPEDVDMDIPEEEDDAISPGPIKVGDEKELGKNGLKKKLIKQGEGWETPGS  62

Query  222  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  401
            GDEV+VHYTGTLLDGTKFDSSRDRGTPFKF+LGQGQVIKGWD+GIKTMKKGE  IFTIPP
Sbjct  63   GDEVQVHYTGTLLDGTKFDSSRDRGTPFKFSLGQGQVIKGWDEGIKTMKKGENAIFTIPP  122

Query  402  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            +LAYGESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  ELAYGESGSPPTIPPNATLQFDVELLSWTSVKDICK  158


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK +KEG G+E P  G  V+V   G L DGT F        PF+F + + QVI G
Sbjct  276  DKKVLKKALKEGEGYERPNDGAVVQVKMVGKLHDGTIFTKKGHDNEPFEFKIDEDQVIDG  335

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +K+MKKGE  + TI P+ A+G S S      +P N+T+ ++VEL+S+V  K+
Sbjct  336  LDRAVKSMKKGEVALVTIQPEYAFGSSESTQELAIVPANSTVYYEVELVSFVKEKE  391


 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G +   
Sbjct  159  DGGVIKKILTEGEKWENPKDLDEVFVKYEARLEDGTLVSKS----DGVEFTVEDGYLCPA  214

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE    T+ P   +GE+G P       +PPNATL   +EL+SW +V D+ 
Sbjct  215  LAKAVKTMKKGEKVHLTVKPQYGFGEAGRPAAGDEGAVPPNATLSISLELISWKTVSDVT  274

Query  507  K  509
            K
Sbjct  275  K  275



>ref|XP_004504385.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Cicer 
arietinum]
Length=571

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 130/151 (86%), Gaps = 6/151 (4%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDD----NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDF+ P +   D+++P++    +P+ KVGEEKEIG+ GLKKKLVKEG GWETP  GD+VE
Sbjct  3    EDFEFPTS--GDVEMPEEDEIVSPIHKVGEEKEIGNNGLKKKLVKEGEGWETPNTGDQVE  60

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDR T FKF LG+GQVIKGWD+GIKTMKKGE  IFTIPP+LAYG
Sbjct  61   VHYTGTLLDGTKFDSSRDRDTTFKFKLGEGQVIKGWDEGIKTMKKGENAIFTIPPELAYG  120

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVELLSW SVKDI K
Sbjct  121  ESGSPPTIPPNATLQFDVELLSWTSVKDISK  151


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 72/117 (62%), Gaps = 4/117 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  338
            D+ + KK +KEG G+E P  G  V+V   G L DGT F     D   PF+F + + QVI 
Sbjct  269  DRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFLKKGHDDDQPFEFKIDEEQVID  328

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            G D+ +K MKKGE  +  I P+ A+G SGSP    T+P N+TL ++VEL+S+V  K+
Sbjct  329  GLDRAVKNMKKGETALVIIQPEYAFGPSGSPQELATVPHNSTLYYEVELISFVKEKE  385


 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 68/121 (56%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ K ++ EG  W+ P+  DEV V Y   L DG     S       +FT+ +G     
Sbjct  152  DGGILKNIITEGEKWDNPKDLDEVFVKYEARLEDGAIISKS----DGVEFTVEEGYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P+ A+GE+G P +     +PPNA+LQ D+EL+SW +V DI 
Sbjct  208  LAKAVKTMKKGEKVLLNVKPEYAFGENGKPSSGDDGVVPPNASLQIDLELVSWKTVSDIT  267

Query  507  K  509
            K
Sbjct  268  K  268



>gb|EEC83911.1| hypothetical protein OsI_29964 [Oryza sativa Indica Group]
 gb|EEE69029.1| hypothetical protein OsJ_28006 [Oryza sativa Japonica Group]
Length=583

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 129/158 (82%), Gaps = 12/158 (8%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLP-----------DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETP  215
            +DF+MPP   DD DL             D P +KVGEEKEIG QGL+KKL+KEG GWETP
Sbjct  3    DDFEMPPPGADD-DLMMGEDGMGDFGGADGPPLKVGEEKEIGKQGLRKKLLKEGEGWETP  61

Query  216  EPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTI  395
            E GDEVEVHYTGTLLDG KFDSSRDRGTPFKF LGQGQVIKGWD GIKTMKKGE  +FTI
Sbjct  62   EVGDEVEVHYTGTLLDGKKFDSSRDRGTPFKFKLGQGQVIKGWDLGIKTMKKGENAVFTI  121

Query  396  PPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            PPDLAYGESGSPPTIP +ATLQFDVELLSW SVKDIC+
Sbjct  122  PPDLAYGESGSPPTIPASATLQFDVELLSWTSVKDICQ  159


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 73/121 (60%), Gaps = 5/121 (4%)
 Frame = +3

Query  153  EIGD-QGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQG  326
            EIGD + + KK++ EG G+E P  G  V+V  TG L DGT F     D   PF+F   + 
Sbjct  273  EIGDDKKILKKVLTEGTGYERPNEGAVVKVKITGKLQDGTIFTKKGHDEPEPFEFKTDEE  332

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  497
            +VI G D+ +  MK GE  + TIPP+ A+G + S      +PPN+T+ ++VEL+S+V  K
Sbjct  333  EVIDGIDRAVLNMKNGEVALVTIPPEYAFGSTESKQDLAVVPPNSTVIYEVELVSFVKDK  392

Query  498  D  500
            +
Sbjct  393  E  393


 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 67/119 (56%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+  G     
Sbjct  160  DGGIFKKILKEGEKWENPKDLDEVFVKYEARLEDGTVI--SKSEGA--EFTVKDGFFCPA  215

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P   +GE+G P       +PPNATL  ++EL+SW +V +I
Sbjct  216  LAKAVKTMKKAEKVLLTVKPQYGFGENGRPAAGEEGAVPPNATLLVNLELVSWKTVTEI  274



>ref|XP_004504386.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Cicer 
arietinum]
Length=570

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 130/151 (86%), Gaps = 6/151 (4%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDD----NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDF+ P +   D+++P++    +P+ KVGEEKEIG+ GLKKKLVKEG GWETP  GD+VE
Sbjct  3    EDFEFPTS--GDVEMPEEDEIVSPIHKVGEEKEIGNNGLKKKLVKEGEGWETPNTGDQVE  60

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDR T FKF LG+GQVIKGWD+GIKTMKKGE  IFTIPP+LAYG
Sbjct  61   VHYTGTLLDGTKFDSSRDRDTTFKFKLGEGQVIKGWDEGIKTMKKGENAIFTIPPELAYG  120

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVELLSW SVKDI K
Sbjct  121  ESGSPPTIPPNATLQFDVELLSWTSVKDISK  151


 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 72/117 (62%), Gaps = 4/117 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  338
            D+ + KK +KEG G+E P  G  V+V   G L DGT F     D   PF+F + + QVI 
Sbjct  269  DRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFLKKGHDDDQPFEFKIDEEQVID  328

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            G D+ +K MKKGE  +  I P+ A+G SGSP    T+P N+TL ++VEL+S+V  K+
Sbjct  329  GLDRAVKNMKKGETALVIIQPEYAFGPSGSPQELATVPHNSTLYYEVELISFVKEKE  385


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 68/121 (56%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ K ++ EG  W+ P+  DEV V Y   L DG     S       +FT+ +G     
Sbjct  152  DGGILKNIITEGEKWDNPKDLDEVFVKYEARLEDGAIISKS----DGVEFTVEEGYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P+ A+GE+G P +     +PPNA+LQ D+EL+SW +V DI 
Sbjct  208  LAKAVKTMKKGEKVLLNVKPEYAFGENGKPSSGDDGVVPPNASLQIDLELVSWKTVSDIT  267

Query  507  K  509
            K
Sbjct  268  K  268



>ref|XP_010023594.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW59903.1| hypothetical protein EUGRSUZ_H02629 [Eucalyptus grandis]
Length=587

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +3

Query  129  VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  308
            V+KVGEE+EIG  G KKKLVKEG GWETP  GDEVEVHYTGTLLDGTKFDSSRDRGTPFK
Sbjct  42   VLKVGEEREIGKAGFKKKLVKEGEGWETPSSGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  101

Query  309  FTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWV  488
            F LG+GQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESGSPPTIPPNATLQFDVELLSW 
Sbjct  102  FKLGRGQVIKGWDEGIKTMKKGENAIFTIPPELAYGESGSPPTIPPNATLQFDVELLSWS  161

Query  489  SVKDICK  509
            SVKDICK
Sbjct  162  SVKDICK  168


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 4/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK +KEG G+E P  G  V+V   G L DGT F   +D   PF+F + + QVI G
Sbjct  286  DKKVLKKTLKEGEGYERPNDGAAVQVRLCGKLQDGTVF-VKKDDEEPFEFKIDEEQVIDG  344

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +K MKKGE  + TI P+ A+G + S      +P N+T+ ++VELLS+V  K+
Sbjct  345  LDRAVKNMKKGEVALVTIQPEYAFGPTESQQDLAVVPANSTVYYEVELLSFVKEKE  400


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 70/121 (58%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  W+ P+  DEV V Y  +L DGT    S       +FT+G G     
Sbjct  169  DGGILKKVLVEGEKWDNPKDLDEVFVKYEASLEDGTLISKS----DGVEFTVGDGYFCAA  224

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P  A+GE+G P +     +PP+A+LQ  +EL+SW +V D+ 
Sbjct  225  LAKAVKTMKKGEKVLLTVMPQYAFGETGRPASGDEAAVPPDASLQIMLELVSWKTVSDVT  284

Query  507  K  509
            K
Sbjct  285  K  285



>ref|XP_010023593.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW59904.1| hypothetical protein EUGRSUZ_H02629 [Eucalyptus grandis]
Length=617

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +3

Query  129  VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  308
            V+KVGEE+EIG  G KKKLVKEG GWETP  GDEVEVHYTGTLLDGTKFDSSRDRGTPFK
Sbjct  42   VLKVGEEREIGKAGFKKKLVKEGEGWETPSSGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  101

Query  309  FTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWV  488
            F LG+GQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESGSPPTIPPNATLQFDVELLSW 
Sbjct  102  FKLGRGQVIKGWDEGIKTMKKGENAIFTIPPELAYGESGSPPTIPPNATLQFDVELLSWS  161

Query  489  SVKDICK  509
            SVKDICK
Sbjct  162  SVKDICK  168


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 4/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK +KEG G+E P  G  V+V   G L DGT F   +D   PF+F + + QVI G
Sbjct  286  DKKVLKKTLKEGEGYERPNDGAAVQVRLCGKLQDGTVF-VKKDDEEPFEFKIDEEQVIDG  344

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +K MKKGE  + TI P+ A+G + S      +P N+T+ ++VELLS+V  K+
Sbjct  345  LDRAVKNMKKGEVALVTIQPEYAFGPTESQQDLAVVPANSTVYYEVELLSFVKEKE  400


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 70/121 (58%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  W+ P+  DEV V Y  +L DGT    S       +FT+G G     
Sbjct  169  DGGILKKVLVEGEKWDNPKDLDEVFVKYEASLEDGTLISKS----DGVEFTVGDGYFCAA  224

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P  A+GE+G P +     +PP+A+LQ  +EL+SW +V D+ 
Sbjct  225  LAKAVKTMKKGEKVLLTVMPQYAFGETGRPASGDEAAVPPDASLQIMLELVSWKTVSDVT  284

Query  507  K  509
            K
Sbjct  285  K  285



>ref|XP_006280236.1| hypothetical protein CARUB_v10026151mg [Capsella rubella]
 gb|EOA13134.1| hypothetical protein CARUB_v10026151mg [Capsella rubella]
Length=575

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 129/156 (83%), Gaps = 11/156 (7%)
 Frame = +3

Query  69   EDFDMP------PAEMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPE  218
            +DFDM       P EMD +DLP+D     P +K+GEEKEIG  GLKKKLVKEG  W+TPE
Sbjct  3    DDFDMQQFPADEPEEMD-MDLPEDEADSAPYLKIGEEKEIGGLGLKKKLVKEGEKWDTPE  61

Query  219  PGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIP  398
             GDEVEVHY GTLLDGTKFDSSRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  +FTIP
Sbjct  62   NGDEVEVHYIGTLLDGTKFDSSRDRGTPFKFTLGQGHVIKGWDIGIKTMKKGEHAVFTIP  121

Query  399  PDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  506
             +LAYGE+GSPPTIPPNATLQFDVEL+SW SVKDIC
Sbjct  122  SELAYGETGSPPTIPPNATLQFDVELISWRSVKDIC  157


 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 68/122 (56%), Gaps = 10/122 (8%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G    
Sbjct  158  GDGGVYKKIIVEGEKWEKPKDLDEVCVKYEARLEDGTIVGKSDGA----EFTVKEGHFCP  213

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  500
               + +KTMK+GE  I T+ P   +GE G P +      IPPNATLQ D+EL+SW +V +
Sbjct  214  ALAKAVKTMKRGEKVILTVKPQYGFGEIGRPASDGFQAAIPPNATLQIDLELVSWKTVVE  273

Query  501  IC  506
            + 
Sbjct  274  VT  275


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 79/138 (57%), Gaps = 10/138 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--  275
            DL+L     V++V ++K++      KK++KEG G+E P  G  V++   G L DGT F  
Sbjct  262  DLELVSWKTVVEVTDDKKV-----IKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLK  316

Query  276  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPP  446
                +   PF+F   + QVI+G ++ +  MKKGE     I P+ A+G S S      IPP
Sbjct  317  KGHEEEEEPFEFKTDEEQVIEGLEKAVMGMKKGEVAFIMISPEYAFGSSESKQELAVIPP  376

Query  447  NATLQFDVELLSWVSVKD  500
            N+T+ ++VEL+S++  K+
Sbjct  377  NSTVSYEVELVSFIKEKE  394



>ref|XP_002865651.1| hypothetical protein ARALYDRAFT_494919 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41910.1| hypothetical protein ARALYDRAFT_494919 [Arabidopsis lyrata subsp. 
lyrata]
Length=570

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  96   MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF  275
            + D D  D  P +K+GEEKEIG  GLKKKLVKEG  W+TPE GDEVEVHYTGTLLDGTKF
Sbjct  22   LADDDEADSAPNLKIGEEKEIGKSGLKKKLVKEGEKWDTPENGDEVEVHYTGTLLDGTKF  81

Query  276  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNAT  455
            DSSRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  IFTIPP+LAYGE+GSPPTIPPNAT
Sbjct  82   DSSRDRGTPFKFTLGQGHVIKGWDLGIKTMKKGENAIFTIPPELAYGETGSPPTIPPNAT  141

Query  456  LQFDVELLSWVSVKDIC  506
            LQFDVEL+SW SVKDIC
Sbjct  142  LQFDVELISWRSVKDIC  158


 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 69/122 (57%), Gaps = 10/122 (8%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++ EG  WE P+  DEV V Y   L DGT       R    +FT+ +G    
Sbjct  159  GDGGVFKKIIVEGEKWEKPKDLDEVFVKYEARLEDGTIV----GRSDGAEFTVKEGHFCP  214

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  500
               + +KTMK+GE  + T+ P   +GE+G P +      IPPNATLQ D+EL+SW +V +
Sbjct  215  ALAKAVKTMKRGEKVLLTVKPQYGFGETGIPASDGLQAAIPPNATLQIDLELVSWKTVVE  274

Query  501  IC  506
            + 
Sbjct  275  VT  276


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 81/138 (59%), Gaps = 10/138 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--  275
            DL+L     V++V ++K++      KK++KEG G+E P  G  V++   G L DGT F  
Sbjct  263  DLELVSWKTVVEVTDDKKV-----IKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFMK  317

Query  276  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPP  446
                +   PF+F   + QVI+G ++ +  MKKGE  + TI P+ A+G S S      IPP
Sbjct  318  KGYEEDEEPFEFKTDEEQVIEGLEKAVMGMKKGEVALITISPEYAFGSSESKQELAVIPP  377

Query  447  NATLQFDVELLSWVSVKD  500
            N+T+ ++VE++S++  K+
Sbjct  378  NSTVFYEVEMVSFIKEKE  395



>gb|AFK48238.1| unknown [Lotus japonicus]
Length=547

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 128/149 (86%), Gaps = 6/149 (4%)
 Frame = +3

Query  69   EDFDMPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            E  D+PP E   +D DLP+D    +VGEE+EIG+ GL+KKL+KEG GWETPE GDEV+VH
Sbjct  3    EVMDIPPMEAMNEDFDLPED----EVGEEREIGNSGLRKKLLKEGQGWETPEVGDEVQVH  58

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDG+KFDSSRDR  PF FTLGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYGES
Sbjct  59   YTGTLLDGSKFDSSRDRDAPFSFTLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYGES  118

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW S+KDI K
Sbjct  119  GSPPTIPPNATLQFDVELLSWTSLKDISK  147


 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 63/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DG K  +  D     +FT+ +G     
Sbjct  148  DGGIYKKILTEGEKWENPKDLDEVLVKYEVHLEDG-KLVAKSD---GVEFTVREGHYCPA  203

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  I  +     +G  G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  204  LSKAVKTMKKGEKVILKVKAQYGFGVKGQPAHGDEGAVPPNATLQITLELVSWKTVSEVT  263


 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 67/113 (59%), Gaps = 4/113 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVI  335
            GD+ + KK++K+G G+E P  G  V++   G L DGT F     D    F+F   + QVI
Sbjct  264  GDKKIIKKILKDGEGFERPNEGAIVKLKLIGKLQDGTVFLKKGHDEEELFEFKTDEEQVI  323

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKK E  + TI P+ A+G S S      IPPN+T+ ++VEL+S+
Sbjct  324  DGLDRAVMTMKKSEVALLTIAPEYAFGISESQQELAVIPPNSTVYYEVELVSF  376



>ref|XP_008669632.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Zea mays]
 tpg|DAA38461.1| TPA: hypothetical protein ZEAMMB73_460939 [Zea mays]
Length=588

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 134/170 (79%), Gaps = 6/170 (4%)
 Frame = +3

Query  9    SDDAN*NPQFSDSSLCFWIMEDFDMPPAE--MDDLD-LPDDNPVMKVGEEKEIGDQGLKK  179
            +DD+   P  S+  +   + ED  M   E  MDD D LP   P MKVGEEKEIG++GLKK
Sbjct  2    ADDSFDLPSASEEDVMGGLDEDEAMKDLETGMDDEDYLP---PTMKVGEEKEIGNEGLKK  58

Query  180  KLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIK  359
            KLVKEG GW+ PE GDEVEVHYTGTLLDGTKFDSSRDRGTPF+F LGQGQVIKGWD  IK
Sbjct  59   KLVKEGEGWDRPEFGDEVEVHYTGTLLDGTKFDSSRDRGTPFRFKLGQGQVIKGWDLAIK  118

Query  360  TMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            TMKKGE  IFTIPP LAYGE GSPPTIPPNATLQF VELLSW SVKDICK
Sbjct  119  TMKKGENAIFTIPPGLAYGEMGSPPTIPPNATLQFHVELLSWASVKDICK  168


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 75/132 (57%), Gaps = 9/132 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  278
            DL+L     VM +G+ K I      KK++KE  G+E P  G  V+V + G L DGT F  
Sbjct  271  DLELVSWKTVMLIGDHKRI-----LKKVLKESEGYEGPNDGAVVKVRFIGKLEDGTVFVK  325

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
               D   PF+F   + QVI+G D  +  MKKGE  +  +PP+ A+G   +     T+PPN
Sbjct  326  KGHDGEEPFEFKTDEEQVIEGLDITVVNMKKGEVALARVPPEQAFGSVETNQDLATVPPN  385

Query  450  ATLQFDVELLSW  485
            +T+ ++VEL+S+
Sbjct  386  STVLYEVELVSF  397


 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 59/116 (51%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +F +  G     
Sbjct  169  DGGIFKKIIVEGEKWENPKDLDEVFVKYEVRLEDGTVVSKS----DGVEFAVRDGYFCPA  224

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  +  + P   + E G P +     +PPNA L  D+EL+SW +V
Sbjct  225  LSKAVKTMKKGEKVLLNVKPQYGFREEGKPASRDEAAVPPNAVLHIDLELVSWKTV  280



>ref|XP_006358774.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Solanum 
tuberosum]
Length=580

 Score =   233 bits (594),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 124/146 (85%), Gaps = 3/146 (2%)
 Frame = +3

Query  72   DFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTG  251
            D DM    MDD   PD  P+MKV EEKEIG  G+KKKL+KEG GWE P  GDEVEVHY G
Sbjct  21   DIDMGMG-MDDFSEPD--PIMKVDEEKEIGKTGIKKKLLKEGEGWEHPSKGDEVEVHYVG  77

Query  252  TLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP  431
            TLLDGT+FDSSRDRGTPFKF LG+GQVIKGWD+GIKTMKKGE  + TIPPD+AYGESGSP
Sbjct  78   TLLDGTQFDSSRDRGTPFKFKLGEGQVIKGWDEGIKTMKKGEKALLTIPPDMAYGESGSP  137

Query  432  PTIPPNATLQFDVELLSWVSVKDICK  509
            PTIPPNATLQF+VELLSW+SVKDICK
Sbjct  138  PTIPPNATLQFEVELLSWISVKDICK  163


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 67/120 (56%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG GW+ P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  164  DGGIFKKILVEGEGWQNPKNLDEVFVKYEARLEDGTVVSKS----DGVEFTVQDGYFCPA  219

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P  A+GE+G   +     +PPNATLQ ++EL+SW  V ++ 
Sbjct  220  LSKAVKTMKKGEKVLLTVQPQYAFGETGKVASRDEGGVPPNATLQINLELISWKIVSEVT  279


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 70/118 (59%), Gaps = 4/118 (3%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVI  335
             D+ + K+++KEG G+E P  G  V+V   G L DGT F     D   PF+F + + +V+
Sbjct  280  NDKKVLKRILKEGEGYEHPNDGALVKVKLIGKLQDGTVFVKKGHDEEEPFEFKIDEEKVV  339

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             G D+ +K MKKGE  + T+ P+ A+G   SP     +P N+ + ++VEL+S+V  K+
Sbjct  340  DGLDKAVKKMKKGEIALITMQPEYAFGAFDSPQELAVVPGNSIVYYEVELVSFVKEKE  397



>ref|XP_007034164.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 3 [Theobroma cacao]
 gb|EOY05090.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 3 [Theobroma cacao]
Length=574

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 9/156 (6%)
 Frame = +3

Query  69   EDFDMPPA------EMDDL-DLPDD--NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  221
            +DF++P A      EM++L + P D  +P++KVGEEKEIG  GLKKKLVKEG GWETP+ 
Sbjct  3    DDFEVPTASDMEEDEMNNLENEPVDPIDPILKVGEEKEIGKNGLKKKLVKEGEGWETPDN  62

Query  222  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  401
            GDEVEVHYTGTLLDGTKFDSSRD+G+ FKF LG GQVIKGWD+GIKTMKKGE  IFTIP 
Sbjct  63   GDEVEVHYTGTLLDGTKFDSSRDKGSTFKFKLGLGQVIKGWDEGIKTMKKGENAIFTIPS  122

Query  402  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            +LAYGESGSPPTIPPNATLQFDVEL+SW SVKDICK
Sbjct  123  ELAYGESGSPPTIPPNATLQFDVELVSWNSVKDICK  158


 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  159  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  214

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P  A+GE G P       +PPNATL   +E++SW +V D+ 
Sbjct  215  LAKAVKTMKKGEKVLLTVKPQYAFGEDGRPAVANEGAVPPNATLHITLEVVSWKNVSDVT  274

Query  507  K  509
            K
Sbjct  275  K  275


 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 68/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK++KEG G++ P  G  V V   G L DG  F        PF+F + + QVI G
Sbjct  276  DRKVMKKILKEGEGYDQPNDGTVVHVKLIGKLQDGKIFVKKGHDEEPFEFKIDEEQVIDG  335

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +K MKKGE  + TI P+ A+G S S      +P NAT+ ++VE++S+V  K+
Sbjct  336  LDRAVKMMKKGEHALITIQPEYAFGSSESQQELAVVPANATVYYEVEMVSFVKEKE  391



>ref|XP_007034165.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 4 [Theobroma cacao]
 gb|EOY05091.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 4 [Theobroma cacao]
Length=533

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 9/156 (6%)
 Frame = +3

Query  69   EDFDMPPA------EMDDL-DLPDD--NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  221
            +DF++P A      EM++L + P D  +P++KVGEEKEIG  GLKKKLVKEG GWETP+ 
Sbjct  3    DDFEVPTASDMEEDEMNNLENEPVDPIDPILKVGEEKEIGKNGLKKKLVKEGEGWETPDN  62

Query  222  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  401
            GDEVEVHYTGTLLDGTKFDSSRD+G+ FKF LG GQVIKGWD+GIKTMKKGE  IFTIP 
Sbjct  63   GDEVEVHYTGTLLDGTKFDSSRDKGSTFKFKLGLGQVIKGWDEGIKTMKKGENAIFTIPS  122

Query  402  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            +LAYGESGSPPTIPPNATLQFDVEL+SW SVKDICK
Sbjct  123  ELAYGESGSPPTIPPNATLQFDVELVSWNSVKDICK  158


 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  159  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  214

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P  A+GE G P       +PPNATL   +E++SW +V D+ 
Sbjct  215  LAKAVKTMKKGEKVLLTVKPQYAFGEDGRPAVANEGAVPPNATLHITLEVVSWKNVSDVT  274

Query  507  K  509
            K
Sbjct  275  K  275


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 68/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK++KEG G++ P  G  V V   G L DG  F        PF+F + + QVI G
Sbjct  276  DRKVMKKILKEGEGYDQPNDGTVVHVKLIGKLQDGKIFVKKGHDEEPFEFKIDEEQVIDG  335

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +K MKKGE  + TI P+ A+G S S      +P NAT+ ++VE++S+V  K+
Sbjct  336  LDRAVKMMKKGEHALITIQPEYAFGSSESQQELAVVPANATVYYEVEMVSFVKEKE  391



>ref|XP_006418643.1| hypothetical protein EUTSA_v10002468mg [Eutrema salsugineum]
 gb|ESQ37079.1| hypothetical protein EUTSA_v10002468mg [Eutrema salsugineum]
Length=550

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 126/151 (83%), Gaps = 5/151 (3%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDF+MPP    + D   D       +KVGEEKEI  QGLKKKLVKEG G+ETPE GDEVE
Sbjct  3    EDFEMPPVGGMNDDDDMDFGDAASFLKVGEEKEI-QQGLKKKLVKEGEGFETPENGDEVE  61

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  62   VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYG  121

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIP NATLQFDVELLSW SVKDICK
Sbjct  122  ESGSPPTIPANATLQFDVELLSWSSVKDICK  152


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++  G  WETP+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKILSVGEKWETPKDLDEVLVKYEARLEDGTVVGKS----DGVEFTVKDGHFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKK E  + T+ P   +GE G P +     +PPNATL+  +EL+SW +V ++ 
Sbjct  209  LTKAVKTMKKAEKVLLTVKPQYGFGEKGKPASGGEGAVPPNATLEITLELVSWKTVSEVT  268


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D  + KK++KEG G+E P  G  V+V   G L DGT F      +   PF+F   + QVI
Sbjct  270  DNKVIKKILKEGEGYERPNEGAVVKVKLIGKLQDGTVFLKKGHGEGEEPFEFKTDEEQVI  329

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+TL ++++L+++
Sbjct  330  DGLDRAVMKMKKGEVALVTIEPEYAFGSTESKQELAVVPPNSTLYYEIDLVAF  382



>gb|KEH20636.1| peptidyl-prolyl cis-trans isomerase FKBP62-like protein [Medicago 
truncatula]
Length=570

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 122/149 (82%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPA--EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDF+ P A       +    +P  KVGEEKEIG  GLKKKLVKEG GWETP+ GD+VEVH
Sbjct  3    EDFEFPTAGNMEMPEEEEVMSPTQKVGEEKEIGKNGLKKKLVKEGEGWETPDNGDQVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTG LLDGTKFDSSRDRGT FKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGILLDGTKFDSSRDRGTTFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNA LQFDVELLSW SVKDI K
Sbjct  123  GSPPTIPPNAALQFDVELLSWTSVKDITK  151


 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 75/117 (64%), Gaps = 4/117 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  338
            D+ + KK +KEG G+E P  G  V+V  TG L DGT F     D   PF+F + + QVI 
Sbjct  269  DRKVLKKTLKEGEGYERPNDGAVVQVKLTGKLQDGTVFFKKGHDGDQPFEFRIDEEQVID  328

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            G D+ +K MKKGE  +  I P+ A+G SGSP    T+PPN+T+ ++VELLS+V+ K+
Sbjct  329  GLDRAVKNMKKGEIALVIIQPEYAFGSSGSPQELTTVPPNSTVYYEVELLSFVNEKE  385


 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 69/121 (57%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ K ++ EG  W+ P+  DEV V Y   L +GT    S       +FT+ +G     
Sbjct  152  DGGILKNIITEGEKWDNPKDPDEVFVKYEARLEEGTIVSKS----DGVEFTVEEGFFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P+ A+GESG P +     IPPNA+LQ D+EL+SW +V DI 
Sbjct  208  LAKAVKTMKKGEKVLLNVKPEYAFGESGKPSSGNNGAIPPNASLQIDLELVSWKTVSDIT  267

Query  507  K  509
            K
Sbjct  268  K  268



>ref|XP_007034162.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY05088.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 1 [Theobroma cacao]
Length=609

 Score =   231 bits (590),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 9/156 (6%)
 Frame = +3

Query  69   EDFDMPPA------EMDDL-DLPDD--NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  221
            +DF++P A      EM++L + P D  +P++KVGEEKEIG  GLKKKLVKEG GWETP+ 
Sbjct  3    DDFEVPTASDMEEDEMNNLENEPVDPIDPILKVGEEKEIGKNGLKKKLVKEGEGWETPDN  62

Query  222  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  401
            GDEVEVHYTGTLLDGTKFDSSRD+G+ FKF LG GQVIKGWD+GIKTMKKGE  IFTIP 
Sbjct  63   GDEVEVHYTGTLLDGTKFDSSRDKGSTFKFKLGLGQVIKGWDEGIKTMKKGENAIFTIPS  122

Query  402  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            +LAYGESGSPPTIPPNATLQFDVEL+SW SVKDICK
Sbjct  123  ELAYGESGSPPTIPPNATLQFDVELVSWNSVKDICK  158


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  159  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  214

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P  A+GE G P       +PPNATL   +E++SW +V D+ 
Sbjct  215  LAKAVKTMKKGEKVLLTVKPQYAFGEDGRPAVANEGAVPPNATLHITLEVVSWKNVSDVT  274

Query  507  K  509
            K
Sbjct  275  K  275


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 68/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK++KEG G++ P  G  V V   G L DG  F        PF+F + + QVI G
Sbjct  276  DRKVMKKILKEGEGYDQPNDGTVVHVKLIGKLQDGKIFVKKGHDEEPFEFKIDEEQVIDG  335

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +K MKKGE  + TI P+ A+G S S      +P NAT+ ++VE++S+V  K+
Sbjct  336  LDRAVKMMKKGEHALITIQPEYAFGSSESQQELAVVPANATVYYEVEMVSFVKEKE  391



>ref|XP_007034163.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 2 [Theobroma cacao]
 gb|EOY05089.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 2 [Theobroma cacao]
Length=609

 Score =   231 bits (590),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 9/156 (6%)
 Frame = +3

Query  69   EDFDMPPA------EMDDL-DLPDD--NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  221
            +DF++P A      EM++L + P D  +P++KVGEEKEIG  GLKKKLVKEG GWETP+ 
Sbjct  3    DDFEVPTASDMEEDEMNNLENEPVDPIDPILKVGEEKEIGKNGLKKKLVKEGEGWETPDN  62

Query  222  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  401
            GDEVEVHYTGTLLDGTKFDSSRD+G+ FKF LG GQVIKGWD+GIKTMKKGE  IFTIP 
Sbjct  63   GDEVEVHYTGTLLDGTKFDSSRDKGSTFKFKLGLGQVIKGWDEGIKTMKKGENAIFTIPS  122

Query  402  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            +LAYGESGSPPTIPPNATLQFDVEL+SW SVKDICK
Sbjct  123  ELAYGESGSPPTIPPNATLQFDVELVSWNSVKDICK  158


 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  159  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  214

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P  A+GE G P       +PPNATL   +E++SW +V D+ 
Sbjct  215  LAKAVKTMKKGEKVLLTVKPQYAFGEDGRPAVANEGAVPPNATLHITLEVVSWKNVSDVT  274

Query  507  K  509
            K
Sbjct  275  K  275


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 68/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK++KEG G++ P  G  V V   G L DG  F        PF+F + + QVI G
Sbjct  276  DRKVMKKILKEGEGYDQPNDGTVVHVKLIGKLQDGKIFVKKGHDEEPFEFKIDEEQVIDG  335

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +K MKKGE  + TI P+ A+G S S      +P NAT+ ++VE++S+V  K+
Sbjct  336  LDRAVKMMKKGEHALITIQPEYAFGSSESQQELAVVPANATVYYEVEMVSFVKEKE  391



>ref|NP_001052535.1| Os04g0352400 [Oryza sativa Japonica Group]
 gb|AAD29708.2|AF140495_1 FK506-binding protein [Oryza sativa Japonica Group]
 emb|CAE05842.2| OSJNBa0091C07.4 [Oryza sativa Japonica Group]
 dbj|BAF14449.1| Os04g0352400 [Oryza sativa Japonica Group]
 gb|EAZ30344.1| hypothetical protein OsJ_14391 [Oryza sativa Japonica Group]
 dbj|BAG94794.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77072.1| hypothetical protein OsI_15470 [Oryza sativa Indica Group]
Length=585

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 3/140 (2%)
 Frame = +3

Query  99   DDLDLPDDN--PV-MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGT  269
            D+LD   D+  PV MKVGEEKEIG QGL+K+L+KEG GW+ PE GDEV+VHYTGTLLDGT
Sbjct  24   DELDEEGDSSSPVAMKVGEEKEIGKQGLRKRLLKEGEGWDRPESGDEVQVHYTGTLLDGT  83

Query  270  KFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPN  449
            KFDSSRDRGTPFKF+LGQG+VIKGWD+GIKTMKKGE  +FT+PP+LAYGE+GSPP IPPN
Sbjct  84   KFDSSRDRGTPFKFSLGQGEVIKGWDEGIKTMKKGEQAVFTVPPELAYGEAGSPPAIPPN  143

Query  450  ATLQFDVELLSWVSVKDICK  509
            ATL+FDVELLSW SVKDICK
Sbjct  144  ATLRFDVELLSWASVKDICK  163


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 75/132 (57%), Gaps = 9/132 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L     V  +G++K I      KK++KEG G+E P  G  V V + G L DGT F  
Sbjct  266  DLELLSWKTVTLIGDDKRI-----LKKVLKEGEGYERPNDGAVVRVRFIGKLEDGTVFSK  320

Query  282  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
               D   PF+F   + QVI+G D+ + TMKKGE  +  +PP  A+G + +      +P N
Sbjct  321  KGHDGDEPFEFRTDEEQVIEGLDRTVVTMKKGEVALVRLPPQHAFGSTETKQDLAVVPAN  380

Query  450  ATLQFDVELLSW  485
            +T+ ++VEL+S+
Sbjct  381  STVWYEVELVSF  392


 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 62/116 (53%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +F +  G     
Sbjct  164  DGGIFKKVLAEGHKWENPKDLDEVLVKYEARLEDGTVVSKS----DGVEFAVKDGYFCPA  219

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL  D+ELLSW +V
Sbjct  220  LSKAVKTMKKGEKVLLTVKPQYGFGEQGKPASGAEAAVPPNATLYVDLELLSWKTV  275



>dbj|BAH19789.1| AT5G48570 [Arabidopsis thaliana]
Length=453

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            D D  D  P +K+GEE EIG  GLKKKLVKE   W+TPE GDEVEVHYTGTLLDGTKFDS
Sbjct  25   DNDEADSAPYLKIGEEMEIGKSGLKKKLVKECEKWDTPENGDEVEVHYTGTLLDGTKFDS  84

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQ  461
            SRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  IFTIPP+LAYGE+GSPPTIPPNATLQ
Sbjct  85   SRDRGTPFKFTLGQGHVIKGWDLGIKTMKKGENAIFTIPPELAYGETGSPPTIPPNATLQ  144

Query  462  FDVELLSWVSVKDIC  506
            FDVEL++W SVKDIC
Sbjct  145  FDVELIAWRSVKDIC  159


 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 68/122 (56%), Gaps = 10/122 (8%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G    
Sbjct  160  GDGGVSKKIIVEGEKWEKPKDLDEVYVKYEARLEDGTIVGKS----DGVEFTVKEGHFCP  215

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  500
               + +KTMK+GE  + T+ P   +GE G P +      IPPNATLQ D+EL+SW +V +
Sbjct  216  ALSKAVKTMKRGEKVLLTVKPQYGFGEFGRPASDGLQAAIPPNATLQIDLELVSWKTVVE  275

Query  501  IC  506
            + 
Sbjct  276  VT  277


 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 80/139 (58%), Gaps = 11/139 (8%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--  275
            DL+L     V++V +     D+ + KK++KEG G+E P  G  V++   G L DGT    
Sbjct  264  DLELVSWKTVVEVTD-----DRKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTTVFV  318

Query  276  -DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIP  443
                 +   PF+F + + QVI+G ++ +  MKKGE  + TI P+ A+G S S      IP
Sbjct  319  KKGHEEDEEPFEFKIDEEQVIEGLEKAVMGMKKGEVALITISPEYAFGSSESKQELAVIP  378

Query  444  PNATLQFDVELLSWVSVKD  500
            PN+T+ ++VEL+S++  K+
Sbjct  379  PNSTVYYEVELVSFIKEKE  397



>ref|NP_199668.1| peptidyl-prolyl cis-trans isomerase FKBP65 [Arabidopsis thaliana]
 sp|Q9FJL3.1|FKB65_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP65; Short=PPIase 
FKBP65; AltName: Full=70 kDa peptidyl-prolyl isomerase; 
AltName: Full=FK506-binding protein 65; Short=AtFKBP65; 
AltName: Full=Immunophilin FKBP65; AltName: Full=Peptidyl-prolyl 
isomerase ROF2; AltName: Full=Protein ROTAMASE FKBP 2; 
AltName: Full=Rotamase [Arabidopsis thaliana]
 dbj|BAB10690.1| peptidylprolyl isomerase [Arabidopsis thaliana]
 gb|AED95689.1| peptidyl-prolyl cis-trans isomerase FKBP65 [Arabidopsis thaliana]
Length=578

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            D D  D  P +K+GEE EIG  GLKKKLVKE   W+TPE GDEVEVHYTGTLLDGTKFDS
Sbjct  25   DNDEADSAPYLKIGEEMEIGKSGLKKKLVKECEKWDTPENGDEVEVHYTGTLLDGTKFDS  84

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQ  461
            SRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  IFTIPP+LAYGE+GSPPTIPPNATLQ
Sbjct  85   SRDRGTPFKFTLGQGHVIKGWDLGIKTMKKGENAIFTIPPELAYGETGSPPTIPPNATLQ  144

Query  462  FDVELLSWVSVKDIC  506
            FDVEL++W SVKDIC
Sbjct  145  FDVELIAWRSVKDIC  159


 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 68/122 (56%), Gaps = 10/122 (8%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G    
Sbjct  160  GDGGVSKKIIVEGEKWEKPKDLDEVYVKYEARLEDGTIVGKS----DGVEFTVKEGHFCP  215

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  500
               + +KTMK+GE  + T+ P   +GE G P +      IPPNATLQ D+EL+SW +V +
Sbjct  216  ALSKAVKTMKRGEKVLLTVKPQYGFGEFGRPASDGLQAAIPPNATLQIDLELVSWKTVVE  275

Query  501  IC  506
            + 
Sbjct  276  VT  277


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 71/119 (60%), Gaps = 6/119 (5%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQV  332
            D+ + KK++KEG G+E P  G  V++   G L DGT         +   PF+F + + QV
Sbjct  279  DRKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTTVFVKKGHEEDEEPFEFKIDEEQV  338

Query  333  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            I+G ++ +  MKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S++  K+
Sbjct  339  IEGLEKAVMGMKKGEVALITISPEYAFGSSESKQELAVIPPNSTVYYEVELVSFIKEKE  397



>dbj|BAE99990.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=578

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            D D  D  P +K+GEE EIG  GLKKKLVKE   W+TPE GDEVEVHYTGTLLDGTKFDS
Sbjct  25   DNDEADSAPYLKIGEEMEIGKSGLKKKLVKECEKWDTPENGDEVEVHYTGTLLDGTKFDS  84

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQ  461
            SRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  IFTIPP+LAYGE+GSPPTIPPNATLQ
Sbjct  85   SRDRGTPFKFTLGQGHVIKGWDLGIKTMKKGENAIFTIPPELAYGETGSPPTIPPNATLQ  144

Query  462  FDVELLSWVSVKDIC  506
            FDVEL++W SVKDIC
Sbjct  145  FDVELIAWRSVKDIC  159


 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 68/122 (56%), Gaps = 10/122 (8%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++ EG  WE P+  DEV V Y   L DGT    S   G    FT+ +G    
Sbjct  160  GDGGVSKKIIVEGEKWEKPKDLDEVYVKYEARLEDGTIVGKSDGVG----FTVKEGHFCP  215

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  500
               + +KTMK+GE  + T+ P   +GE G P +      IPPNATLQ D+EL+SW +V +
Sbjct  216  ALSKAVKTMKRGEKVLLTVKPQYGFGEFGRPASDGLQAAIPPNATLQIDLELVSWKTVVE  275

Query  501  IC  506
            + 
Sbjct  276  VT  277


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 71/119 (60%), Gaps = 6/119 (5%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQV  332
            D+ + KK++KEG G+E P  G  V++   G L DGT         +   PF+F + + QV
Sbjct  279  DRKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTTVFVKKGHEEDEEPFEFKIDEEQV  338

Query  333  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            I+G ++ +  MKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S++  K+
Sbjct  339  IEGLEKAVMGMKKGEVALITISPEYAFGSSESKQELAVIPPNSTVYYEVELVSFIKEKE  397



>ref|XP_003579568.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Brachypodium 
distachyon]
Length=596

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +3

Query  129  VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  308
             MKVGEEKEIG QGLKKKLVKEG GW+ PE GDEVEVHYTGTLL+G KFDSSRDRGTPFK
Sbjct  50   AMKVGEEKEIGKQGLKKKLVKEGEGWDRPETGDEVEVHYTGTLLNGEKFDSSRDRGTPFK  109

Query  309  FTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWV  488
            F LGQG+VIKGWDQGIKTMKKGE  I TIPP+LAYGE+GSPP IPPNATLQFDVELLSW 
Sbjct  110  FKLGQGEVIKGWDQGIKTMKKGENAILTIPPELAYGETGSPPKIPPNATLQFDVELLSWA  169

Query  489  SVKDICK  509
            SV DICK
Sbjct  170  SVNDICK  176


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  D V V Y   L DGT    S+  G   +F +  G     
Sbjct  177  DGGIFKKVLVEGQKWENPKDLDLVLVKYEARLEDGTVI--SKSDGA--EFAVKDGHFCPA  232

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL  D+EL+SW +V
Sbjct  233  LSRAVKTMKKGEKVLLTVKPQYGFGEQGRPASGVEGAVPPNATLHIDLELVSWKTV  288


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 9/132 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L     V  +G++K+I      K ++KEG G+E P  G  V V   G L DGT F  
Sbjct  279  DLELVSWKTVTLIGDDKKI-----LKTVLKEGEGYERPNDGAVVRVRLVGKLEDGTVFTK  333

Query  282  SRDRG-TPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
                G  PF+F   + QVI+G D  + TMKKGE  +  IPP+ A+G + +      +P N
Sbjct  334  KGHEGDEPFEFKTDEEQVIEGLDITVVTMKKGEVALARIPPERAFGSTETKLDLAVVPAN  393

Query  450  ATLQFDVELLSW  485
            + + ++VEL+S+
Sbjct  394  SRVYYEVELVSF  405



>ref|XP_010466944.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Camelina 
sativa]
Length=562

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 127/151 (84%), Gaps = 6/151 (4%)
 Frame = +3

Query  72   DFDMPPA-----EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            D++MPP      +  D+D  D    +KVGEEKEI  QGLKKKLVKEG G+ETPE GDEVE
Sbjct  4    DYEMPPVGGMNDDDIDMDFGDAAAYLKVGEEKEI-QQGLKKKLVKEGEGYETPENGDEVE  62

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDR TPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYG  122

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIP NATLQFDVELL+WVSVKDICK
Sbjct  123  ESGSPPTIPANATLQFDVELLTWVSVKDICK  153


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++  G  WE P+  DEV V +   L DGT    S       +FT+  G     
Sbjct  154  DGGVFKKILAVGEKWENPKDLDEVLVKFEAKLDDGTIVGKS----DGVEFTVKDGNFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  210  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPASSGEGAVPPNATLEINLELVSWKTVSEVT  269


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 19/131 (15%)
 Frame = +3

Query  108  DLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DS  281
            ++ DDN VMK              K++KEG G+E P  G   +V   G L DGT F    
Sbjct  267  EVTDDNKVMK--------------KILKEGEGYERPNEGAVAKVKLIGKLQDGTVFLKKG  312

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  452
              +    F+F   + QV+ G D+ +  MKKGE  + T+ P+ A+G + S      +PPN+
Sbjct  313  HGENEELFEFKTDEEQVVDGLDRAVMKMKKGEVALVTVEPEYAFGSNESKQELAVVPPNS  372

Query  453  TLQFDVELLSW  485
            T+ ++V+L+++
Sbjct  373  TVYYEVDLVTF  383



>ref|XP_010488634.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Camelina 
sativa]
Length=561

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 125/150 (83%), Gaps = 5/150 (3%)
 Frame = +3

Query  72   DFDMPPAEMDDLDLPDDNP----VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  239
            DF+MPP    + D   D       +KVGEEKEI  QGLKKKLVKEG G+ETPE GDEVEV
Sbjct  4    DFEMPPVGGMNDDDDMDFGDAAAYLKVGEEKEI-QQGLKKKLVKEGEGYETPENGDEVEV  62

Query  240  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  419
            HYTGTLL+GTKFDSSRDR TPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYGE
Sbjct  63   HYTGTLLNGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYGE  122

Query  420  SGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            SGSPPTIP NATLQFDVELL+WVSVKDICK
Sbjct  123  SGSPPTIPANATLQFDVELLTWVSVKDICK  152


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++  G  WE P+  DEV V +   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKILAVGEKWENPKDLDEVLVKFEAKLDDGTIVGKS----NGVEFTVKDGHFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  209  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPASAGEGAVPPNATLEINLELVSWKTVSEVT  268


 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 19/131 (15%)
 Frame = +3

Query  108  DLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DS  281
            ++ DDN VMK              K++KEG G+E P  G  V+V   G L DGT F    
Sbjct  266  EVTDDNKVMK--------------KILKEGEGYERPNEGAVVKVKLIGKLQDGTVFLKKG  311

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  452
              +    F+F   + QV+ G D+ +  MKKGE  + T+ P+ A+G + S      +PP +
Sbjct  312  HGENEELFEFKTDEEQVVDGLDRAVMKMKKGEVALVTVEPEYAFGSNESKQELAVVPPKS  371

Query  453  TLQFDVELLSW  485
            T+ ++V+L+++
Sbjct  372  TVYYEVDLVTF  382



>ref|XP_002436973.1| hypothetical protein SORBIDRAFT_10g012970 [Sorghum bicolor]
 gb|EER88340.1| hypothetical protein SORBIDRAFT_10g012970 [Sorghum bicolor]
Length=592

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +3

Query  126  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  305
            P MK GEE+EIG +GLKKKLVKEG GW+ PE GDEVEVHYTGTLLDGTKFDSSRDRGTPF
Sbjct  45   PTMKAGEEREIGKEGLKKKLVKEGQGWDRPETGDEVEVHYTGTLLDGTKFDSSRDRGTPF  104

Query  306  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  485
            KF LGQGQVIKGWD GIKTMKKGE  IFTIPP LAYGE+GS  TIPPNATLQFDVELLSW
Sbjct  105  KFKLGQGQVIKGWDLGIKTMKKGENAIFTIPPGLAYGETGSSCTIPPNATLQFDVELLSW  164

Query  486  VSVKDICK  509
             SVKDICK
Sbjct  165  ASVKDICK  172


 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 76/141 (54%), Gaps = 11/141 (8%)
 Frame = +3

Query  81   MPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGT  254
            +PP  M   DL+L     V  +G+ K I      KK++KEG G+E P  G  V V   G 
Sbjct  266  VPPNAMLHIDLELVTWKTVTLIGDRKRI-----LKKVLKEGEGYERPNDGAVVGVRLIGK  320

Query  255  LLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP  431
            L DGT F     D   PF+F   + QVI+G D  +  MKKGE  +  +PP+ A+G   + 
Sbjct  321  LEDGTVFVRKGHDGEEPFEFKTDEEQVIEGLDITVVNMKKGEVALVRVPPEHAFGSVETK  380

Query  432  ---PTIPPNATLQFDVELLSW  485
                 +PPN+T+ ++VEL+S+
Sbjct  381  QDLAIVPPNSTVFYEVELVSF  401


 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 60/116 (52%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +F +  G     
Sbjct  173  DGGIFKKILVEGEKWENPKDLDEVFVKYEARLEDGTVVSKS----DGVEFAVKDGYFCPA  228

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  + T+ P   +GE     SG    +PPNA L  D+EL++W +V
Sbjct  229  LAKAVKTMKKGEKVLLTVKPQYGFGEQGKQASGDEAAVPPNAMLHIDLELVTWKTV  284



>gb|KJB28026.1| hypothetical protein B456_005G022600, partial [Gossypium raimondii]
Length=493

 Score =   225 bits (574),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +3

Query  123  NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP  302
            NP++K GEEK+IG+ GLKKKLVKEG GWETP+ G +VEVHYTG L+DGTKFDSS DRGTP
Sbjct  5    NPILKAGEEKDIGNDGLKKKLVKEGEGWETPKNGYDVEVHYTGALIDGTKFDSSLDRGTP  64

Query  303  FKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLS  482
            FKF LG GQVIKGWD+GIKTMKKGE  IFT+PP+LAYGESGSPPTIPPNATLQFDVEL+S
Sbjct  65   FKFKLGLGQVIKGWDEGIKTMKKGENAIFTVPPELAYGESGSPPTIPPNATLQFDVELIS  124

Query  483  WVSVKDICK  509
            W SVKDIC+
Sbjct  125  WTSVKDICQ  133


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 65/107 (61%), Gaps = 5/107 (5%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  368
            EG G++ P  G  V+V   G L DG  F     D G+ F+F + +GQVI G ++ +KTMK
Sbjct  205  EGEGYDRPYNGTMVQVKLIGKLEDGMIFVKKGHDEGS-FEFKVDEGQVIDGLEKTVKTMK  263

Query  369  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            KGE  + TI P+ A+G S S      +P N+T+ ++VEL+S+V  K+
Sbjct  264  KGEHALTTIQPEYAFGSSESQQELAVVPANSTVYYEVELVSFVKEKE  310



>ref|XP_004290160.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Fragaria 
vesca subsp. vesca]
Length=565

 Score =   227 bits (578),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +3

Query  69   EDFDM--PPAEM-DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  239
            +DFDM  P  EM DD DLPDD PV+KVGEEKEIG QGLKKKL+K G  WETP+ GDEVEV
Sbjct  3    DDFDMAAPGGEMMDDFDLPDDGPVLKVGEEKEIGKQGLKKKLLKAGESWETPKSGDEVEV  62

Query  240  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  419
            HYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD+GIKTMKKGE  +FTIPP++AYG 
Sbjct  63   HYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDEGIKTMKKGENALFTIPPEMAYGA  122

Query  420  SGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            SGSPPTIPPNATLQFDVELLSW SV DI K
Sbjct  123  SGSPPTIPPNATLQFDVELLSWTSVNDITK  152


 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V V   G L DGT F      +   PF+F   + QVI
Sbjct  270  DKKVIKKILKEGEGYERPNEGAVVTVKLIGKLQDGTVFLKKGHGEGEEPFEFKTDEEQVI  329

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            +G D+ + TMKKGE  +  I P+ A+G S S      +PPN+TL +++EL+S+V  K+
Sbjct  330  EGLDKAVVTMKKGEIALVIIAPEYAFGVSESKQELAVVPPNSTLYYEIELVSFVKDKE  387


 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 63/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V +   L D T    S       +FT+ +G     
Sbjct  153  DGGIIKKVLKEGEKWENPKDLDEVIVKFEAYLEDKTLIAKS----DTVEFTVKEGYFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P   +G+ G   +     +PPNATL   +EL+SW +V ++ 
Sbjct  209  LSKAVKTMKKGEKVLLAVKPQYGFGDKGKAASGDEGAVPPNATLHITLELVSWRTVSELT  268



>ref|XP_010100792.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Morus notabilis]
 gb|EXB84490.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Morus notabilis]
Length=547

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 136/151 (90%), Gaps = 4/151 (3%)
 Frame = +3

Query  69   EDFDM---PPAEMDD-LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            ED ++   PP  MD+  DL D++P++KVGEEKEIG QGLKKKL+K+G GW+TPE GDEVE
Sbjct  3    EDINLNAPPPEGMDEGFDLLDESPMLKVGEEKEIGKQGLKKKLLKQGEGWDTPETGDEVE  62

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYG
Sbjct  63   VHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYG  122

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWTSVKDICK  153


 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 67/120 (56%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V +   L DGT    S       +FT+ +G     
Sbjct  154  DGGVFKKILTEGEKWENPKDPDEVLVKFEARLEDGTVVAKS----DGVEFTVKEGYFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +G++G P T     +PPNATL+  +ELLSW +V ++ 
Sbjct  210  LSKAVKTMKKGEKVLLTVKPQYGFGDTGKPATAGEGAVPPNATLEITLELLSWKTVTEVT  269


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 18/118 (15%)
 Frame = +3

Query  153  EIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQG  326
            E+ D  + KK++KEG G+E P  G  V++   G L DGT F     + G   F+F   + 
Sbjct  267  EVTDDKVVKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHEEGEELFEFKTEEE  326

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKD  500
            QVI G D  + TMKKGE        +LA         +PPN+T+ +++EL S+V  K+
Sbjct  327  QVIDGLDTAVLTMKKGE--------ELA--------VVPPNSTVYYEIELESFVKEKE  368



>ref|XP_004247908.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Solanum lycopersicum]
Length=581

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  111  LPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRD  290
            +P+ +PVMKV EEKEIG  G+KKKL+KEG GWE P  GD++EVHY GTLLDGT+FDSS D
Sbjct  32   VPEPDPVMKVDEEKEIGKSGIKKKLLKEGEGWEHPSQGDDIEVHYVGTLLDGTQFDSSCD  91

Query  291  RGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDV  470
            RGTPFKF LG+GQVIKGWD+GIKTMKKGE  +FTIPPD+AYGESGSPPTIPPNATLQF+V
Sbjct  92   RGTPFKFKLGEGQVIKGWDEGIKTMKKGEKALFTIPPDMAYGESGSPPTIPPNATLQFEV  151

Query  471  ELLSWVSVKDICK  509
            ELLSW+SVKDICK
Sbjct  152  ELLSWISVKDICK  164


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 70/118 (59%), Gaps = 4/118 (3%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVI  335
             D+ + K+++KEG G+E P     V+V   G L DGT F     + G PF+F + + QV+
Sbjct  281  NDKKVLKRILKEGEGYERPNDSALVKVKLIGKLQDGTVFVKKGHNEGEPFEFKIDEEQVV  340

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             G D+ +K MKKGE  + TI P+ A+G   SP     +P N+ + ++VEL+S+V  K+
Sbjct  341  DGLDKAVKKMKKGEIALITIQPEYAFGAFDSPQDLAVVPGNSVVYYEVELVSFVKEKE  398


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 67/120 (56%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG GW+ P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  165  DGGIFKKILIEGEGWQNPKDLDEVFVKYEARLEDGTVVSKS----DGVEFTVEDGYCCPA  220

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  I T+ P  A+G++G   +     +PPNATLQ ++EL+SW  V ++ 
Sbjct  221  LSKAVKTMKKGEKVILTVKPQYAFGQTGKVGSGEDGGVPPNATLQINLELISWKIVSEVT  280



>ref|XP_010514063.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Camelina 
sativa]
Length=562

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 125/151 (83%), Gaps = 6/151 (4%)
 Frame = +3

Query  72   DFDMPPAEMDDLDLPDDN-----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            DF+MPP    + D  D +       +KVGEEKEI  QGLKKKLVKEG G+ETPE GDEVE
Sbjct  4    DFEMPPVGGMNDDDMDMDFGDAAAYLKVGEEKEI-QQGLKKKLVKEGEGYETPENGDEVE  62

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDR  PFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRAAPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYG  122

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIP NATL+FDVELL+WVSVKDICK
Sbjct  123  ESGSPPTIPANATLRFDVELLTWVSVKDICK  153


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++  G  WE P+  DEV V +   L DGT    S   G    FT+  G     
Sbjct  154  DGGVFKKILAVGEKWENPKDLDEVLVKFEAKLDDGTIVGKSDGVG----FTVKDGHFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  210  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPASAGEGAVPPNATLEINLELVSWKTVSEVT  269


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 19/131 (15%)
 Frame = +3

Query  108  DLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DS  281
            ++ DDN VMK              K++KEG G+E P  G   +V   G L DGT F    
Sbjct  267  EVTDDNKVMK--------------KILKEGEGYERPNEGAVAKVKLIGKLQDGTVFLKKG  312

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  452
              +    F+F   + QV+ G D+ +  MKKGE  + T+ P+ A+G + S      +PPN+
Sbjct  313  HGENEELFEFKTDEEQVVDGLDRAVMKMKKGEVALVTVEPEYAFGSNESKQELAVVPPNS  372

Query  453  TLQFDVELLSW  485
            T+ ++V+L+++
Sbjct  373  TVYYEVDLVTF  383



>ref|XP_009420312.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=562

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 133/151 (88%), Gaps = 4/151 (3%)
 Frame = +3

Query  69   EDFDMPPAE--MDD--LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDFD+P +E   DD  +D PD++P  ++GEEKEIG QGLKKKLVK+G GW+ PE GDEVE
Sbjct  4    EDFDLPGSEEAADDGLMDPPDEDPSFEIGEEKEIGKQGLKKKLVKKGDGWDVPEAGDEVE  63

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG
Sbjct  64   VHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYG  123

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            E GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  124  EHGSPPTIPPNATLQFDVELLSWCSVKDICK  154


 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+  G     
Sbjct  155  DGGIFKKILKEGEKWENPKDLDEVLVKYEARLEDGTVI--SKSEGV--EFTVTDGLFCPA  210

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMK+ E  + T+ P  A+GE G P +     +PPNA L  ++EL+SW +V  I
Sbjct  211  LAKAVKTMKRAEKVLLTVKPQYAFGEKGRPASGDEGAVPPNANLYVELELVSWKTVTQI  269


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 77/137 (56%), Gaps = 9/137 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  278
            +L+L     V ++G++K+I      K ++KEG G++ P  G  V V   G L DGT F  
Sbjct  257  ELELVSWKTVTQIGDDKKI-----IKMILKEGEGYDHPNEGAVVTVKLIGKLQDGTIFVK  311

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
               D    F+F   + +VI+G DQ + TM KGE  + TIPP+ A+  + S      +P N
Sbjct  312  KGHDEQESFEFKTAEEKVIEGLDQAVMTMNKGEIALVTIPPEYAFLSTESKQDLAVVPAN  371

Query  450  ATLQFDVELLSWVSVKD  500
            +T+ ++VEL+S+V  K+
Sbjct  372  STVIYEVELVSFVKEKE  388



>ref|XP_006395163.1| hypothetical protein EUTSA_v10003906mg [Eutrema salsugineum]
 gb|ESQ32449.1| hypothetical protein EUTSA_v10003906mg [Eutrema salsugineum]
Length=573

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 132/154 (86%), Gaps = 9/154 (6%)
 Frame = +3

Query  69   EDFDMP-----PAEMDDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            +DFDM      P EMD LDL DD   +P+MKVGEEKEIG  GLKKKLVKEG  W+TPE G
Sbjct  3    DDFDMQLPAEEPEEMD-LDLADDAESDPIMKVGEEKEIGKLGLKKKLVKEGEKWDTPENG  61

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  IFTIPP+
Sbjct  62   DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGHVIKGWDIGIKTMKKGENAIFTIPPE  121

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  506
            LAYGE+GSPPTIPPNATLQFDVELLSW SVKDIC
Sbjct  122  LAYGETGSPPTIPPNATLQFDVELLSWRSVKDIC  155


 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 68/122 (56%), Gaps = 10/122 (8%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD GL KK++ EG  WE P+  DEV V Y   L DGT       R    +FT+ +G    
Sbjct  156  GDGGLFKKIIVEGEKWEKPKDLDEVFVKYEARLEDGTIV----GRSDGAEFTVKEGHFCP  211

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGE------SGSPPTIPPNATLQFDVELLSWVSVKD  500
               + +KTMK+GE  + T+ P   +GE      +GS   IPPNATLQ D++L+SW +V +
Sbjct  212  ALAKAVKTMKRGEKVLLTVKPQYGFGEIGRPADAGSHAAIPPNATLQIDLQLVSWKTVLE  271

Query  501  IC  506
            + 
Sbjct  272  VT  273


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 81/138 (59%), Gaps = 10/138 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--  275
            DL L     V++V ++K++      KK++KEG G++ P  G  V++   G L +G  F  
Sbjct  260  DLQLVSWKTVLEVTDDKKV-----IKKILKEGEGYDRPNEGALVKLKLIGRLQNGIVFLK  314

Query  276  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPP  446
                +   PF+F   + QVI+G ++G+ +MKKGE  + TI P+ A+G S S      IPP
Sbjct  315  KGHAEDDEPFEFKTDEEQVIEGLERGVMSMKKGEVALITICPEYAFGSSESKQELALIPP  374

Query  447  NATLQFDVELLSWVSVKD  500
            ++T+ F+VEL+S++  K+
Sbjct  375  SSTVCFEVELVSFIKEKE  392



>ref|XP_010552023.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Tarenaya 
hassleriana]
Length=548

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 119/147 (81%), Gaps = 9/147 (6%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  248
            EDFDMP A     D  D  P MK     EIG QGLKKKLVKEG G ETPE GDEVEVHYT
Sbjct  3    EDFDMPAAH----DGADVAPSMK-----EIGKQGLKKKLVKEGEGRETPETGDEVEVHYT  53

Query  249  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
            GTLL GTKFDSSRDRGTPFKFTLGQG VI+GWD GIKTMKKGE  I TIPP+LAYGESGS
Sbjct  54   GTLLAGTKFDSSRDRGTPFKFTLGQGNVIEGWDIGIKTMKKGENAILTIPPELAYGESGS  113

Query  429  PPTIPPNATLQFDVELLSWVSVKDICK  509
            PPTIPPNA LQFDVELLSWVS KDIC+
Sbjct  114  PPTIPPNAMLQFDVELLSWVSGKDICR  140


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 73/119 (61%), Gaps = 7/119 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGT---PFKFTLGQGQV  332
            D+ + KK++KEG G++ P  G  V+V+  G L DGT F  ++  G    PF+F   + QV
Sbjct  258  DKKVIKKILKEGEGYDRPNEGAIVKVNLIGKLQDGTVF-LNKGHGEIEGPFEFKTDEEQV  316

Query  333  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            I+G D  + +MKKGE    TI P+ A+G S S      +PPN+T+ ++VELLS+V  K+
Sbjct  317  IEGVDMAVMSMKKGEVAFVTISPEYAFGSSESQQELAVVPPNSTVYYEVELLSFVKEKE  375


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 61/119 (51%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ K +V EG   E P+  DEV V Y   L DGT    S        FT+ +G     
Sbjct  141  DGGIFKNIVVEGDKREKPKDLDEVLVKYEARLEDGTVVGKS----AGVDFTVKEGHFCPA  196

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGS-----PPTIPPNATLQFDVELLSWVSVKDI  503
            +   +KTMKK E  +  + P   +GESG         +PPNATLQ D+EL+SW +V ++
Sbjct  197  FALAVKTMKKREKVLLIVKPQYGFGESGKLACDGQSAVPPNATLQIDLELVSWKTVSEV  255



>ref|XP_004973965.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Setaria 
italica]
 ref|XP_004973966.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Setaria 
italica]
Length=553

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 133/156 (85%), Gaps = 10/156 (6%)
 Frame = +3

Query  69   EDFDMPPA---------EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  221
            EDF+MPPA         EMDD    D+ PVMKVGEEKE+G QGLKKKL+KEG GWETPE 
Sbjct  3    EDFEMPPAGAEGMMGDDEMDDFG-GDEGPVMKVGEEKEVGKQGLKKKLLKEGEGWETPEV  61

Query  222  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  401
            GDEVEVHYTGTLLDGTKFDSSRDRG PFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP
Sbjct  62   GDEVEVHYTGTLLDGTKFDSSRDRGDPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPP  121

Query  402  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            +LAYGESGSPP IPPNATLQFDVELLSW SV+DICK
Sbjct  122  ELAYGESGSPPKIPPNATLQFDVELLSWTSVRDICK  157


 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 81/136 (60%), Gaps = 8/136 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L     V ++G++K+I      KK++KEG G+E P     V+V  TG LLDGT F  
Sbjct  260  DLELVSWKTVTEIGDDKKI-----LKKVLKEGEGYERPNESAVVKVKITGKLLDGTVFTK  314

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  452
                  PF+F   + +VI G D+ +  MKKGE  + TIPP+ A+G + S      +PPN+
Sbjct  315  KGHDEEPFEFKTDEEEVIDGLDRAVLNMKKGEVALVTIPPEYAFGSTESKQDLAVVPPNS  374

Query  453  TLQFDVELLSWVSVKD  500
            T+ ++VEL+S+V  K+
Sbjct  375  TVVYEVELVSFVKDKE  390


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 64/119 (54%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  158  DGGIFKKILKEGEKWENPKDPDEVLVKYEARLEDGTVVSKSEG----VEFTVKDGYFCPA  213

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P   +GE G P       +PPNATL  D+EL+SW +V +I
Sbjct  214  LAKAVKTMKKAEKVLLTVKPQYGFGEKGRPAAGEEGAVPPNATLLVDLELVSWKTVTEI  272



>ref|XP_002977259.1| hypothetical protein SELMODRAFT_443450 [Selaginella moellendorffii]
 gb|EFJ21868.1| hypothetical protein SELMODRAFT_443450 [Selaginella moellendorffii]
Length=567

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 125/152 (82%), Gaps = 4/152 (3%)
 Frame = +3

Query  63   IMEDFDMPPAEMDD---LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  233
            + +DF++  A MD+   ++     P +K GEE+EIG  GLKK LVK G GWE PEPGDEV
Sbjct  1    MADDFEIADAGMDEEAGMEATSAAP-LKAGEEQEIGKNGLKKLLVKAGTGWEMPEPGDEV  59

Query  234  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  413
            +VHYTGTLLDG+KFDSSRDRG PF F LGQGQVIKGWD+GIKTMKKGE  +FTIPP LAY
Sbjct  60   KVHYTGTLLDGSKFDSSRDRGDPFTFKLGQGQVIKGWDEGIKTMKKGENAVFTIPPALAY  119

Query  414  GESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GE+GSPPTIPPNATL+FDVELLSW SVKDICK
Sbjct  120  GEAGSPPTIPPNATLKFDVELLSWDSVKDICK  151


 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 76/136 (56%), Gaps = 8/136 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L     V K+G+     D  + KK++K   G + P  G  V++ Y   LLDGT F+ 
Sbjct  243  DLELVSWKTVEKIGQ-----DGKITKKIIKASEGHDKPNDGTIVKIKYVAKLLDGTVFEK  297

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  452
              D   PF+F   + QVI G D+ + TMKKGE  + TI P+  +G+  +      +P N+
Sbjct  298  KGDDEDPFEFKTDEEQVIDGLDKAVATMKKGEVAVVTIGPEHGFGDVDTQRDLALVPANS  357

Query  453  TLQFDVELLSWVSVKD  500
            TL ++VE++S+V  KD
Sbjct  358  TLVYEVEMISFVKAKD  373


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 54/114 (47%), Gaps = 10/114 (9%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V EG  +E P+  DEV V Y      G     S + G   +F + QG   + 
Sbjct  152  DGGVVKKIVSEGKKYEMPKDLDEVTVKYVAKNEAGLVVGQSPEEGA--EFYVHQGHFCEA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
                +KTM KGE  + T+ P    GES           L  D+EL+SW +V+ I
Sbjct  210  LAIAVKTMMKGEKALLTVRPKYGLGES--------QGILSIDLELVSWKTVEKI  255



>gb|ACJ85592.1| unknown [Medicago truncatula]
Length=495

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 132/149 (89%), Gaps = 6/149 (4%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            +DF++P AE   +D DLP++    KVG+E+E+GD+GLKKKL+K G GW+TPE GDEV+VH
Sbjct  3    DDFEIPQAEEMNEDFDLPEE----KVGDEREVGDRGLKKKLLKLGEGWDTPESGDEVQVH  58

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDR +PF FTLGQGQVI+GWD+GIKTMKKGE  +FTIPP+LAYGES
Sbjct  59   YTGTLLDGTKFDSSRDRDSPFSFTLGQGQVIQGWDEGIKTMKKGENALFTIPPELAYGES  118

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVE+LSW SVKDICK
Sbjct  119  GSPPTIPPNATLQFDVEMLSWTSVKDICK  147


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ K+++KEG  WE P+  DEV V+Y   L DG     S       +FT+ +G     
Sbjct  148  DGGIFKRILKEGEKWENPKDPDEVLVNYEVRLEDGKAVAKS----DGVEFTVSEGHYCPA  203

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
            + + +K MKKGE  I  + P   +GE G P       +PPNA+LQ  +EL+SW +V D+ 
Sbjct  204  FSKAVKAMKKGEKVILLVKPQYGFGEKGKPAHGDEGAVPPNASLQITLELVSWKTVSDVT  263


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQV  332
             D+ + KK++KEG G+E P  G  V++   G L DGT F      +    F+F   + QV
Sbjct  264  SDKKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTVFFEKGHDEEEKLFEFKTDEEQV  323

Query  333  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP--TIPPNATLQFDV  470
            I G D+ + TMKKGE  +  I P+ A+  S S     +PPN+T+ ++ 
Sbjct  324  IDGLDKAVLTMKKGEVALLIIAPEYAFDSSQSQQELAVPPNSTVYYEA  371



>tpg|DAA48149.1| TPA: hypothetical protein ZEAMMB73_593378 [Zea mays]
Length=420

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 133/155 (86%), Gaps = 8/155 (5%)
 Frame = +3

Query  69   EDFDMPPAEMDDL-------DLP-DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            EDF+MPPA  D++       D   D+ PVMKVGEEKE+G +GLKKKL+KEG GWETPE G
Sbjct  3    EDFEMPPAGADEMMGDDEMGDFGGDEGPVMKVGEEKEVGKEGLKKKLLKEGEGWETPEVG  62

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHYTGTLLDGTKFDSSRDRG PFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+
Sbjct  63   DEVEVHYTGTLLDGTKFDSSRDRGEPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPE  122

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            LAYG SGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  LAYGASGSPPTIPPNATLQFDVELLSWTSVKDICK  157


 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 79/136 (58%), Gaps = 8/136 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L     V ++G++K+I      KK++KEG G+E P  G  VEV   G L DG  F  
Sbjct  260  DLELISWKTVTEIGDDKKI-----LKKVLKEGEGYERPNEGAVVEVKIIGKLQDGAVFTK  314

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  452
                  PFKF   + +VI G D+ +  MKKGE  + TIPP+ A+G + S      +PPN+
Sbjct  315  KGHDEEPFKFKTDEEEVIAGLDRAVLNMKKGEVALVTIPPEYAFGSTESKQDLAVVPPNS  374

Query  453  TLQFDVELLSWVSVKD  500
            T+ ++VEL+S+V  K+
Sbjct  375  TVIYEVELISFVKDKE  390


 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 64/119 (54%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  158  DGGIFKKILKEGEKWENPKDPDEVLVKYEARLEDGTVVSKSEG----VEFTVKDGYFCPA  213

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P   +GE G P       +PPNA+L  D+EL+SW +V +I
Sbjct  214  LAKAVKTMKKAEKVLLTVKPQYGFGEKGRPAAGEEGAVPPNASLLIDLELISWKTVTEI  272



>gb|AFK48961.1| unknown [Medicago truncatula]
Length=495

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 132/149 (89%), Gaps = 6/149 (4%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            +DF++P AE   +D DLP++    KVG+E+E+GD+GLKKKL+K G GW+TPE GDEV+VH
Sbjct  3    DDFEIPQAEEMNEDFDLPEE----KVGDEREVGDRGLKKKLLKLGEGWDTPESGDEVQVH  58

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDR +PF FTLGQGQVI+GWD+GIKTMKKGE  +FTIPP+LAYGES
Sbjct  59   YTGTLLDGTKFDSSRDRDSPFSFTLGQGQVIQGWDEGIKTMKKGENALFTIPPELAYGES  118

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVE+LSW SVKDICK
Sbjct  119  GSPPTIPPNATLQFDVEMLSWTSVKDICK  147


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ K+++KEG  WE P+  DEV V+Y   L DG     S       +FT+ +G     
Sbjct  148  DGGIFKRILKEGEKWENPKDPDEVLVNYEVRLEDGKAVAKS----DGVEFTVSEGHYCPA  203

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
            + + +K MKKGE  I  + P   +GE G P       +PPNA+LQ  +EL+SW +V D+ 
Sbjct  204  FSKAVKAMKKGEKVILLVKPQYGFGEKGKPAHGDEGAVPPNASLQITLELVSWKTVSDVT  263


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQV  332
             D+ + KK++KEG G+E P  G  V++   G L DGT F      +    F+F   + QV
Sbjct  264  SDKKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTVFFEKGHDEEEKLFEFKTDEEQV  323

Query  333  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP--TIPPNATLQFDV  470
            I G D+ + TMKKGE  +  I P+ A+  S S     +PPN+T+ ++ 
Sbjct  324  IDGLDKAVLTMKKGEVALLIIAPEYAFDSSQSQQELAVPPNSTVYYEA  371



>ref|XP_008244682.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Prunus 
mume]
Length=572

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 135/149 (91%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMP-PAEMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFDMP P EM+ D DLPD+ PV+KVGEEKEIG QGLKKKL+KEG GW+TP+ GDEVEVH
Sbjct  3    EDFDMPVPEEMNGDFDLPDEGPVLKVGEEKEIGKQGLKKKLLKEGEGWDTPKNGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD+GI+TMKKGE  +FTIPP+LAYGE+
Sbjct  63   YTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDEGIRTMKKGEDALFTIPPELAYGEA  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPP ATLQFDVELLSW SV DI K
Sbjct  123  GSPPTIPPKATLQFDVELLSWTSVNDISK  151


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 68/120 (57%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V++   L DG   + S DR    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVIVNFEARLDDGKVVEKS-DR---VEFTVKDGYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +G+ G P +     IPPNATL   +EL+SW +V ++ 
Sbjct  208  LSKAVKTMKKGEKVLLTVKPQYGFGDKGKPASGYEGAIPPNATLHITLELVSWKTVSEVT  267


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 69/113 (61%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V++   G L DGT+F      +    F+F   + +VI
Sbjct  269  DKKVIKKILKEGEGFERPNEGAVVKLKLIGKLQDGTEFLKKGHAEGEELFEFKTDEEEVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKKGE  + TI P+ A+G S SP     +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVLTMKKGEVALLTIAPEYAFGSSESPQELAVVPPNSTVYYEVELVSF  381



>gb|KEH22557.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=544

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 133/151 (88%), Gaps = 6/151 (4%)
 Frame = +3

Query  63   IMEDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            + +DF++P AE   +D DLP++    KVG+E+E+GD+GLKKKL+K G GW+TPE GDEV+
Sbjct  1    MNDDFEIPQAEEMNEDFDLPEE----KVGDEREVGDRGLKKKLLKLGEGWDTPESGDEVQ  56

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDR +PF FTLGQGQVI+GWD+GIKTMKKGE  +FTIPP+LAYG
Sbjct  57   VHYTGTLLDGTKFDSSRDRDSPFSFTLGQGQVIQGWDEGIKTMKKGENALFTIPPELAYG  116

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVE+LSW SVKDICK
Sbjct  117  ESGSPPTIPPNATLQFDVEMLSWTSVKDICK  147


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ K+++KEG  WE P+  DEV V+Y   L DG     S       +FT+ +G     
Sbjct  148  DGGIFKRILKEGEKWENPKDPDEVLVNYEVRLEDGKAVAKS----DGVEFTVSEGHYCPA  203

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
            + + +K MKKGE  I  + P   +GE G P       +PPNA+LQ  +EL+SW +V D+ 
Sbjct  204  FSKAVKAMKKGEKVILLVKPQYGFGEKGKPAHGDEGAVPPNASLQITLELVSWKTVSDVT  263


 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 65/113 (58%), Gaps = 4/113 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQV  332
             D+ + KK++KEG G+E P  G  V++   G L DGT F      +    F+F   + QV
Sbjct  264  SDKKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTVFFEKGHDEEEKLFEFKTDEEQV  323

Query  333  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP--TIPPNATLQFDVELLSW  485
            I G D+ + TMKKGE  +  I P+ A+  S S     +PPN+T+ ++VEL+S+
Sbjct  324  IDGLDKAVLTMKKGEVALLIIAPEYAFDSSQSQQELAVPPNSTVYYEVELVSY  376



>ref|XP_006652190.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Oryza brachyantha]
Length=570

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +3

Query  126  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  305
              MKVGEEKEIG QGL+KKL++EG GW+ PE GDEV+VHYTGTLLDGTKFDSSRDRGTPF
Sbjct  21   AAMKVGEEKEIGKQGLRKKLLREGEGWDRPETGDEVQVHYTGTLLDGTKFDSSRDRGTPF  80

Query  306  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  485
             F LGQG+VIKGWDQGIKTM+KGE  + T+PP+LAYGE+GSPP IP NATLQFDVELLSW
Sbjct  81   TFKLGQGEVIKGWDQGIKTMRKGEQAVLTVPPELAYGEAGSPPAIPANATLQFDVELLSW  140

Query  486  VSVKDICK  509
             SVKDICK
Sbjct  141  ASVKDICK  148


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 74/132 (56%), Gaps = 9/132 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  278
            DL+L     V  +G++K I      KK++KEG G+E P  G  V V + G L DGT F  
Sbjct  251  DLELVSWKIVTLIGDDKRI-----LKKVLKEGEGYERPNDGAIVRVRFIGKLEDGTVFAK  305

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
               D   PF+F   + QVI+G D+ + TMKKGE  +  +PP  A+G + +      +P N
Sbjct  306  RGHDGDEPFEFKTDEEQVIEGLDRTVVTMKKGEVALVRVPPQHAFGSTETKQDLAVVPAN  365

Query  450  ATLQFDVELLSW  485
            +T+ ++VEL S+
Sbjct  366  STVWYEVELGSF  377


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 70/140 (50%), Gaps = 10/140 (7%)
 Frame = +3

Query  84   PPAEMDDLDLPDDNPVMKVGEEKEI-GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  260
            PPA   +  L  D  ++     K+I  D G+ KK++ EG  W+ P+  DEV V Y   L 
Sbjct  122  PPAIPANATLQFDVELLSWASVKDICKDGGVFKKVLAEGQKWDNPKDLDEVLVKYEARLE  181

Query  261  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-  437
            DGT    S       +F +  G       + +KTMKKGE  + T+ P   +GE G P + 
Sbjct  182  DGTVVSKS----DGVEFAVKDGYFCPALSKAVKTMKKGEKALLTVKPQYGFGEQGRPASG  237

Query  438  ----IPPNATLQFDVELLSW  485
                +PPNA L  D+EL+SW
Sbjct  238  DEGAVPPNAILHIDLELVSW  257



>ref|NP_001149790.1| LOC100283417 [Zea mays]
 gb|ACG36811.1| peptidyl-prolyl isomerase [Zea mays]
 tpg|DAA48150.1| TPA: peptidyl-prolyl isomerase [Zea mays]
 tpg|DAA48151.1| TPA: peptidyl-prolyl isomerase [Zea mays]
Length=553

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 133/155 (86%), Gaps = 8/155 (5%)
 Frame = +3

Query  69   EDFDMPPAEMDDL-------DLP-DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            EDF+MPPA  D++       D   D+ PVMKVGEEKE+G +GLKKKL+KEG GWETPE G
Sbjct  3    EDFEMPPAGADEMMGDDEMGDFGGDEGPVMKVGEEKEVGKEGLKKKLLKEGEGWETPEVG  62

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHYTGTLLDGTKFDSSRDRG PFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+
Sbjct  63   DEVEVHYTGTLLDGTKFDSSRDRGEPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPE  122

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            LAYG SGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  LAYGASGSPPTIPPNATLQFDVELLSWTSVKDICK  157


 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 79/136 (58%), Gaps = 8/136 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L     V ++G++K+I      KK++KEG G+E P  G  VEV   G L DG  F  
Sbjct  260  DLELISWKTVTEIGDDKKI-----LKKVLKEGEGYERPNEGAVVEVKIIGKLQDGAVFTK  314

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  452
                  PFKF   + +VI G D+ +  MKKGE  + TIPP+ A+G + S      +PPN+
Sbjct  315  KGHDEEPFKFKTDEEEVIAGLDRAVLNMKKGEVALVTIPPEYAFGSTESKQDLAVVPPNS  374

Query  453  TLQFDVELLSWVSVKD  500
            T+ ++VEL+S+V  K+
Sbjct  375  TVIYEVELISFVKDKE  390


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 64/119 (54%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  158  DGGIFKKILKEGEKWENPKDPDEVLVKYEARLEDGTVVSKSEG----VEFTVKDGYFCPA  213

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P   +GE G P       +PPNA+L  D+EL+SW +V +I
Sbjct  214  LAKAVKTMKKAEKVLLTVKPQYGFGEKGRPAAGEEGAVPPNASLLIDLELISWKTVTEI  272



>ref|XP_007200299.1| hypothetical protein PRUPE_ppa003471mg [Prunus persica]
 gb|EMJ01498.1| hypothetical protein PRUPE_ppa003471mg [Prunus persica]
Length=572

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 135/149 (91%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMP-PAEMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDFDMP P EM+ D DLPD+ PV+KVGEEKEIG QGLKKKL+KEG GW+TP+ GDEVEVH
Sbjct  3    EDFDMPVPEEMNGDFDLPDEGPVLKVGEEKEIGKQGLKKKLLKEGEGWDTPKNGDEVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD+GI+TMKKGE  +FTIPP+LAYGE+
Sbjct  63   YTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDEGIRTMKKGEDALFTIPPELAYGET  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPP ATLQFDVELLSW SV DI K
Sbjct  123  GSPPTIPPKATLQFDVELLSWTSVNDISK  151


 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 68/120 (57%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V++   L DG   + S DR    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVIVNFEARLDDGKVVEKS-DR---VEFTVKDGYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +G+ G P +     +PPNATL   +EL+SW +V ++ 
Sbjct  208  LSKAVKTMKKGEKVLLTVKPQYGFGDKGKPASGYVGAVPPNATLHITLELVSWKTVSEVT  267


 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 69/113 (61%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V++   G L DGT+F      +    F+F   + +VI
Sbjct  269  DKKVIKKILKEGEGFERPNEGAVVKLKLIGKLQDGTEFLKKGHAEGEELFEFKTDEEEVI  328

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKKGE  + T+ P+ A+G S SP     +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVLTMKKGEVALLTLAPEYAFGSSESPQELAVVPPNSTVYYEVELVSF  381



>tpg|DAA48153.1| TPA: hypothetical protein ZEAMMB73_593378 [Zea mays]
Length=492

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 133/155 (86%), Gaps = 8/155 (5%)
 Frame = +3

Query  69   EDFDMPPAEMDDL-------DLP-DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            EDF+MPPA  D++       D   D+ PVMKVGEEKE+G +GLKKKL+KEG GWETPE G
Sbjct  3    EDFEMPPAGADEMMGDDEMGDFGGDEGPVMKVGEEKEVGKEGLKKKLLKEGEGWETPEVG  62

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHYTGTLLDGTKFDSSRDRG PFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+
Sbjct  63   DEVEVHYTGTLLDGTKFDSSRDRGEPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPE  122

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            LAYG SGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  LAYGASGSPPTIPPNATLQFDVELLSWTSVKDICK  157


 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 79/136 (58%), Gaps = 8/136 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L     V ++G++K+I      KK++KEG G+E P  G  VEV   G L DG  F  
Sbjct  266  DLELISWKTVTEIGDDKKI-----LKKVLKEGEGYERPNEGAVVEVKIIGKLQDGAVFTK  320

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  452
                  PFKF   + +VI G D+ +  MKKGE  + TIPP+ A+G + S      +PPN+
Sbjct  321  KGHDEEPFKFKTDEEEVIAGLDRAVLNMKKGEVALVTIPPEYAFGSTESKQDLAVVPPNS  380

Query  453  TLQFDVELLSWVSVKD  500
            T+ ++VEL+S+V  K+
Sbjct  381  TVIYEVELISFVKDKE  396


 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 64/125 (51%), Gaps = 15/125 (12%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  158  DGGIFKKILKEGEKWENPKDPDEVLVKYEARLEDGTVVSKSEG----VEFTVKDGYFCPA  213

Query  342  WDQGIKTMKKGECCIFTIPPDL------AYGESGSPP-----TIPPNATLQFDVELLSWV  488
              + +KTMKK E  + T+ P         +GE G P       +PPNA+L  D+EL+SW 
Sbjct  214  LAKAVKTMKKAEKVLLTVKPQCEIPFQNGFGEKGRPAAGEEGAVPPNASLLIDLELISWK  273

Query  489  SVKDI  503
            +V +I
Sbjct  274  TVTEI  278



>tpg|DAA48152.1| TPA: hypothetical protein ZEAMMB73_593378 [Zea mays]
Length=559

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 133/155 (86%), Gaps = 8/155 (5%)
 Frame = +3

Query  69   EDFDMPPAEMDDL-------DLP-DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            EDF+MPPA  D++       D   D+ PVMKVGEEKE+G +GLKKKL+KEG GWETPE G
Sbjct  3    EDFEMPPAGADEMMGDDEMGDFGGDEGPVMKVGEEKEVGKEGLKKKLLKEGEGWETPEVG  62

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHYTGTLLDGTKFDSSRDRG PFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+
Sbjct  63   DEVEVHYTGTLLDGTKFDSSRDRGEPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPE  122

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            LAYG SGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  LAYGASGSPPTIPPNATLQFDVELLSWTSVKDICK  157


 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 79/136 (58%), Gaps = 8/136 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L     V ++G++K+I      KK++KEG G+E P  G  VEV   G L DG  F  
Sbjct  266  DLELISWKTVTEIGDDKKI-----LKKVLKEGEGYERPNEGAVVEVKIIGKLQDGAVFTK  320

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  452
                  PFKF   + +VI G D+ +  MKKGE  + TIPP+ A+G + S      +PPN+
Sbjct  321  KGHDEEPFKFKTDEEEVIAGLDRAVLNMKKGEVALVTIPPEYAFGSTESKQDLAVVPPNS  380

Query  453  TLQFDVELLSWVSVKD  500
            T+ ++VEL+S+V  K+
Sbjct  381  TVIYEVELISFVKDKE  396


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 64/125 (51%), Gaps = 15/125 (12%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  158  DGGIFKKILKEGEKWENPKDPDEVLVKYEARLEDGTVVSKSEG----VEFTVKDGYFCPA  213

Query  342  WDQGIKTMKKGECCIFTIPPDL------AYGESGSPP-----TIPPNATLQFDVELLSWV  488
              + +KTMKK E  + T+ P         +GE G P       +PPNA+L  D+EL+SW 
Sbjct  214  LAKAVKTMKKAEKVLLTVKPQCEIPFQNGFGEKGRPAAGEEGAVPPNASLLIDLELISWK  273

Query  489  SVKDI  503
            +V +I
Sbjct  274  TVTEI  278



>gb|EEE57017.1| hypothetical protein OsJ_06790 [Oryza sativa Japonica Group]
Length=600

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  132  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  311
            M+VGEEKEIG +GL+KKLVKEG GWE P+ GDEV+VHYTGTLLDGTKFDSSRDR  PFKF
Sbjct  1    MEVGEEKEIGKEGLRKKLVKEGEGWERPDAGDEVQVHYTGTLLDGTKFDSSRDRDAPFKF  60

Query  312  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVS  491
            TLGQGQVIKGWD GIKTMKKGE  IFTIPP+LAYGE GSPP IPPNATLQFDVEL+SW S
Sbjct  61   TLGQGQVIKGWDLGIKTMKKGENAIFTIPPELAYGEDGSPPVIPPNATLQFDVELISWES  120

Query  492  VKDICK  509
            VKDICK
Sbjct  121  VKDICK  126


 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 62/119 (52%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  127  DGGILKKVLAEGTKWENPRDRDEVFVKYEVRLEDGTVVAES----DGVEFTVKDGHFCPA  182

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P   +GE G P       IPPNATL  ++EL+SW +V +I
Sbjct  183  ISKAVKTMKKNEKALLTVKPQYGFGEQGRPAARDEAAIPPNATLHINLELVSWKAVTEI  241


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 80/145 (55%), Gaps = 13/145 (9%)
 Frame = +3

Query  87   PAEMDDLDLPDDNPVMKVGEE-------KEIG-DQGLKKKLVKEGAGWETPEPGDEVEVH  242
            PA  D+  +P  N  + +  E        EIG D+ + KK++ EG G+E P     V V 
Sbjct  212  PAARDEAAIPP-NATLHINLELVSWKAVTEIGNDKKILKKILHEGEGYERPSDCTLVRVK  270

Query  243  YTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  419
              G L DGT F +   D   PF+F   + QV++G D+ + +MKKGE  + TIPP+ A+G 
Sbjct  271  LIGKLEDGTIFVTRGHDGDEPFEFKTDEDQVVEGLDKAVLSMKKGEVALVTIPPEYAFGS  330

Query  420  SGSP---PTIPPNATLQFDVELLSW  485
              +      +PPN+T+ ++VEL+S+
Sbjct  331  DETRQDLSVVPPNSTVYYEVELVSF  355



>gb|EEC73201.1| hypothetical protein OsI_07270 [Oryza sativa Indica Group]
Length=600

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  132  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  311
            M+VGEEKEIG +GL+KKLVKEG GWE P+ GDEV+VHYTGTLLDGTKFDSSRDR  PFKF
Sbjct  1    MEVGEEKEIGKEGLRKKLVKEGEGWERPDAGDEVQVHYTGTLLDGTKFDSSRDRDAPFKF  60

Query  312  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVS  491
            TLGQGQVIKGWD GIKTMKKGE  IFTIPP+LAYGE GSPP IPPNATLQFDVEL+SW S
Sbjct  61   TLGQGQVIKGWDLGIKTMKKGENAIFTIPPELAYGEDGSPPVIPPNATLQFDVELISWES  120

Query  492  VKDICK  509
            VKDICK
Sbjct  121  VKDICK  126


 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 62/119 (52%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  127  DGGILKKVLAEGTKWENPRDRDEVFVKYEVRLEDGTVVAES----DGVEFTVKDGHFCPA  182

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P   +GE G P       IPPNATL  ++EL+SW +V +I
Sbjct  183  ISKAVKTMKKNEKALLTVKPQYGFGEQGRPAARDEAAIPPNATLHINLELVSWKAVTEI  241


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 70/116 (60%), Gaps = 5/116 (4%)
 Frame = +3

Query  153  EIG-DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQG  326
            EIG D+ + KK++ EG G+E P     V V   G L DGT F +   D   PF+F   + 
Sbjct  240  EIGNDKKILKKILHEGEGYERPSDCTLVRVKLIGKLEDGTIFVTRGHDGDEPFEFKTDED  299

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
            QV++G D+ + +MKKGE  + TIPP+ A+G   +      +PPN+T+ ++VEL+S+
Sbjct  300  QVVEGLDKAVLSMKKGEVALVTIPPEYAFGSDETRQDLSVVPPNSTVYYEVELVSF  355



>dbj|BAB02082.1| peptidylprolyl isomerase; FK506-binding protein [Arabidopsis 
thaliana]
Length=555

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 123/150 (82%), Gaps = 5/150 (3%)
 Frame = +3

Query  72   DFDMPPAEMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  239
            +F+MPP    + D   D       +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVEV
Sbjct  4    NFEMPPVGGMNDDDDMDFGDGASFLKVGEEKEI-QQGLKKKLLKEGEGYETPENGDEVEV  62

Query  240  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  419
            HYTGTLLDGTKFDSSRDR TPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYGE
Sbjct  63   HYTGTLLDGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYGE  122

Query  420  SGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            SGSPPTIP NATLQFDVELL W SVKDICK
Sbjct  123  SGSPPTIPANATLQFDVELLKWDSVKDICK  152


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++  G  WE P+  DEV V +   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKILAVGEKWENPKDLDEVLVKFEAKLEDGTVVGKS----DGVEFTVKDGHFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  209  LTKAVKTMKKGEKVLLTVKPQYGFGEKGKPASAGEGAVPPNATLEINLELVSWKTVSEVT  268


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D  + KK++KEG G+E P  G  V+V   G L DGT F      +   PF+F   + QV+
Sbjct  270  DNKVVKKVLKEGDGYERPNEGAVVKVKLIGKLQDGTVFLKKGHGENEEPFEFKTDEEQVV  329

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+T+ ++V+LL++
Sbjct  330  DGLDRAVMKMKKGEVALVTIDPEYAFGSNESQQELAVVPPNSTVTYEVDLLTF  382



>gb|AAB82061.1| rof1 [Arabidopsis thaliana]
Length=551

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 123/150 (82%), Gaps = 5/150 (3%)
 Frame = +3

Query  72   DFDMPPAEMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  239
            +F+MPP    + D   D       +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVEV
Sbjct  4    NFEMPPVGGMNDDDDMDFGDGASFLKVGEEKEI-QQGLKKKLLKEGEGYETPENGDEVEV  62

Query  240  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  419
            HYTGTLLDGTKFDSSRDR TPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYGE
Sbjct  63   HYTGTLLDGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYGE  122

Query  420  SGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            SGSPPTIP NATLQFDVELL W SVKDICK
Sbjct  123  SGSPPTIPANATLQFDVELLKWDSVKDICK  152


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++  G  WE P+  DEV V +   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKILAVGEKWENPKDLDEVLVKFEAKLEDGTVVGKS----DGVEFTVKDGHFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  209  LTKAVKTMKKGEKVLLTVKPQYGFGEKGKPASAGEGAVPPNATLEINLELVSWKTVSEVT  268


 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D  + KK++KEG G+E P  G  V+V   G L DGT F      +   PF+F   + QV+
Sbjct  270  DNKVVKKVLKEGDGYERPNEGAVVKVKLIGKLQDGTVFLKKGHGENEEPFEFKTDEEQVV  329

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+T+ ++V+LL++
Sbjct  330  DGLDRAVMKMKKGEVALVTIDPEYAFGSNESQQELAVVPPNSTVTYEVDLLTF  382



>ref|NP_189160.3| rotamase FKBP 1 [Arabidopsis thaliana]
 sp|Q38931.2|FKB62_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP62; Short=PPIase 
FKBP62; AltName: Full=70 kDa peptidyl-prolyl isomerase; 
AltName: Full=FK506-binding protein 62; Short=AtFKBP62; 
AltName: Full=Immunophilin FKBP62; AltName: Full=Peptidylprolyl 
isomerase ROF1; AltName: Full=Protein ROTAMASE FKBP 1; 
AltName: Full=Rotamase [Arabidopsis thaliana]
 gb|AAB82062.1| rof1 [Arabidopsis thaliana]
 gb|AEE76996.1| rotamase FKBP 1 [Arabidopsis thaliana]
Length=551

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 123/150 (82%), Gaps = 5/150 (3%)
 Frame = +3

Query  72   DFDMPPAEMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  239
            +F+MPP    + D   D       +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVEV
Sbjct  4    NFEMPPVGGMNDDDDMDFGDGASFLKVGEEKEI-QQGLKKKLLKEGEGYETPENGDEVEV  62

Query  240  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  419
            HYTGTLLDGTKFDSSRDR TPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYGE
Sbjct  63   HYTGTLLDGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYGE  122

Query  420  SGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            SGSPPTIP NATLQFDVELL W SVKDICK
Sbjct  123  SGSPPTIPANATLQFDVELLKWDSVKDICK  152


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++  G  WE P+  DEV V +   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKILAVGEKWENPKDLDEVLVKFEAKLEDGTVVGKS----DGVEFTVKDGHFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  209  LTKAVKTMKKGEKVLLTVKPQYGFGEKGKPASAGEGAVPPNATLEINLELVSWKTVSEVT  268


 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D  + KK++KEG G+E P  G  V+V   G L DGT F      +   PF+F   + QV+
Sbjct  270  DNKVVKKVLKEGDGYERPNEGAVVKVKLIGKLQDGTVFLKKGHGENEEPFEFKTDEEQVV  329

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+T+ ++V+LL++
Sbjct  330  DGLDRAVMKMKKGEVALVTIDPEYAFGSNESQQELAVVPPNSTVTYEVDLLTF  382



>ref|NP_001118695.1| rotamase FKBP 1 [Arabidopsis thaliana]
 gb|AEE76997.1| rotamase FKBP 1 [Arabidopsis thaliana]
Length=562

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 123/150 (82%), Gaps = 5/150 (3%)
 Frame = +3

Query  72   DFDMPPAEMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  239
            +F+MPP    + D   D       +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVEV
Sbjct  4    NFEMPPVGGMNDDDDMDFGDGASFLKVGEEKEI-QQGLKKKLLKEGEGYETPENGDEVEV  62

Query  240  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  419
            HYTGTLLDGTKFDSSRDR TPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYGE
Sbjct  63   HYTGTLLDGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYGE  122

Query  420  SGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            SGSPPTIP NATLQFDVELL W SVKDICK
Sbjct  123  SGSPPTIPANATLQFDVELLKWDSVKDICK  152


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++  G  WE P+  DEV V +   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKILAVGEKWENPKDLDEVLVKFEAKLEDGTVVGKS----DGVEFTVKDGHFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  209  LTKAVKTMKKGEKVLLTVKPQYGFGEKGKPASAGEGAVPPNATLEINLELVSWKTVSEVT  268


 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D  + KK++KEG G+E P  G  V+V   G L DGT F      +   PF+F   + QV+
Sbjct  270  DNKVVKKVLKEGDGYERPNEGAVVKVKLIGKLQDGTVFLKKGHGENEEPFEFKTDEEQVV  329

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+T+ ++V+LL++
Sbjct  330  DGLDRAVMKMKKGEVALVTIDPEYAFGSNESQQELAVVPPNSTVTYEVDLLTF  382



>gb|EYU40640.1| hypothetical protein MIMGU_mgv1a003616mg [Erythranthe guttata]
 gb|EYU40641.1| hypothetical protein MIMGU_mgv1a003616mg [Erythranthe guttata]
Length=574

 Score =   222 bits (566),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 134/155 (86%), Gaps = 2/155 (1%)
 Frame = +3

Query  51   LCFWIMEDFDMPPAE-MDD-LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            L   + +DFD+P AE MDD +DLP +   MKVGEEK+IG  GLKKKL+KEG  W+TP+ G
Sbjct  21   LQLLMEDDFDIPAAEGMDDFMDLPGEGGYMKVGEEKDIGKLGLKKKLLKEGEAWDTPDNG  80

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHYTGTLLDGTKFDSSRDRG  FKFTLGQGQVIKGWD+GIKTMKKGE  IFTIPP 
Sbjct  81   DEVEVHYTGTLLDGTKFDSSRDRGETFKFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPV  140

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            LAYGESGSPPTIPPNATLQFDVELLSWVS+KDICK
Sbjct  141  LAYGESGSPPTIPPNATLQFDVELLSWVSIKDICK  175


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 70/120 (58%), Gaps = 7/120 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF----DSSRDRGTPFKFTLGQGQ  329
            D+ + KK++K+G G+E P  G  V++   G L DGT F        D    F+F   + Q
Sbjct  293  DKKVVKKILKDGEGYERPNDGTVVKLKLIGKLQDGTVFVKKGHGGDDENDLFEFKTDEDQ  352

Query  330  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            VI+G D+ + TMKKGE  + TI P  A+G S S      +PPN+T+ +DVEL+S+V  K+
Sbjct  353  VIEGLDKAVATMKKGEVAVLTIDPQYAFGSSESKQDLAVVPPNSTVYYDVELVSFVKEKE  412


 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 64/119 (54%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++K+G  WE P+  DEV V Y   L DGT    S       +F + +G     
Sbjct  176  DGGIFKKILKDGEKWENPKDPDEVLVKYEARLEDGTVVAKS----DGVEFNVQEGYFCPA  231

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  + T+ P   + E G P +     IPPNA+L   ++L+SW +V ++
Sbjct  232  LSKAVKTMKKGEKVLLTVKPQYGFSEKGKPASGDEKAIPPNASLDIVLDLVSWKTVSNV  290



>ref|NP_001046873.1| Os02g0491400 [Oryza sativa Japonica Group]
 dbj|BAD21897.1| putative peptidylprolyl isomerase [Oryza sativa Japonica Group]
 dbj|BAD22074.1| putative peptidylprolyl isomerase [Oryza sativa Japonica Group]
 dbj|BAF08787.1| Os02g0491400 [Oryza sativa Japonica Group]
Length=682

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  132  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  311
            M+VGEEKEIG +GL+KKLVKEG GWE P+ GDEV+VHYTGTLLDGTKFDSSRDR  PFKF
Sbjct  83   MEVGEEKEIGKEGLRKKLVKEGEGWERPDAGDEVQVHYTGTLLDGTKFDSSRDRDAPFKF  142

Query  312  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVS  491
            TLGQGQVIKGWD GIKTMKKGE  IFTIPP+LAYGE GSPP IPPNATLQFDVEL+SW S
Sbjct  143  TLGQGQVIKGWDLGIKTMKKGENAIFTIPPELAYGEDGSPPVIPPNATLQFDVELISWES  202

Query  492  VKDICK  509
            VKDICK
Sbjct  203  VKDICK  208


 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 62/119 (52%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  209  DGGILKKVLAEGTKWENPRDRDEVFVKYEVRLEDGTVVAES----DGVEFTVKDGHFCPA  264

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P   +GE G P       IPPNATL  ++EL+SW +V +I
Sbjct  265  ISKAVKTMKKNEKALLTVKPQYGFGEQGRPAARDEAAIPPNATLHINLELVSWKAVTEI  323


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 70/116 (60%), Gaps = 5/116 (4%)
 Frame = +3

Query  153  EIG-DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQG  326
            EIG D+ + KK++ EG G+E P     V V   G L DGT F +   D   PF+F   + 
Sbjct  322  EIGNDKKILKKILHEGEGYERPSDCTLVRVKLIGKLEDGTIFVTRGHDGDEPFEFKTDED  381

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
            QV++G D+ + +MKKGE  + TIPP+ A+G   +      +PPN+T+ ++VEL+S+
Sbjct  382  QVVEGLDKAVLSMKKGEVALVTIPPEYAFGSDETRQDLSVVPPNSTVYYEVELVSF  437



>ref|XP_004952509.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Setaria italica]
Length=676

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +3

Query  132  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  311
            +K+GEE+EIG +GLKKKLV+EG GW+ P  GDEVEVHYTGTLLDGTKFDSSRDR +PFKF
Sbjct  78   LKIGEEREIGKEGLKKKLVQEGEGWDRPGAGDEVEVHYTGTLLDGTKFDSSRDRDSPFKF  137

Query  312  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVS  491
            TLGQGQVIKGWD GIKTMKKGE  IFTIPP+LAYGE GSPP IPPNATLQFDVELLSWV+
Sbjct  138  TLGQGQVIKGWDLGIKTMKKGENAIFTIPPELAYGEDGSPPVIPPNATLQFDVELLSWVN  197

Query  492  VKDICK  509
            +KDICK
Sbjct  198  IKDICK  203


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 5/121 (4%)
 Frame = +3

Query  153  EIG-DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQG  326
            EIG D+ + KK++KEG G++ P     V V   G L DGT F +   D   PF+F   + 
Sbjct  317  EIGHDKKVLKKILKEGEGYDRPNECAVVRVKLIGKLADGTLFVNKGHDGEEPFEFKTDED  376

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  497
            QVI+G D+ + +MKKGE  + TIPP  A+G + +     T+PPN+++ ++VEL+S+   K
Sbjct  377  QVIEGLDKAVLSMKKGEVALVTIPPHHAFGANETDQDLATVPPNSSVYYEVELVSFDKEK  436

Query  498  D  500
            D
Sbjct  437  D  437


 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 62/119 (52%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  204  DGGILKKVLSEGEKWENPKDPDEVFVKYEARLEDGTVVSKS----DGVEFTVKDGLFCPA  259

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E    T+ P   +GE     SG    +PP+ATL  D++++SW +V +I
Sbjct  260  ISKAVKTMKKNEKAFLTVKPQYGFGEQGRSASGEEAAVPPDATLHIDLQVVSWKTVTEI  318



>ref|XP_002992143.1| hypothetical protein SELMODRAFT_134839 [Selaginella moellendorffii]
 gb|EFJ06798.1| hypothetical protein SELMODRAFT_134839 [Selaginella moellendorffii]
Length=593

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 124/152 (82%), Gaps = 4/152 (3%)
 Frame = +3

Query  63   IMEDFDMPPAEMDD---LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  233
            + +DF++  A MD+   ++     P +K GEE+EIG  GLKK LVK G GWE PEPGDEV
Sbjct  1    MADDFEIADAGMDEEAGMEATSAAP-LKAGEEQEIGKNGLKKLLVKAGTGWEMPEPGDEV  59

Query  234  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  413
            +VHYTGTLLDG+KFDSSRDRG PF F LGQGQVIKGWD+GIKTMKKGE  +FTIPP LAY
Sbjct  60   KVHYTGTLLDGSKFDSSRDRGDPFTFKLGQGQVIKGWDEGIKTMKKGENAVFTIPPALAY  119

Query  414  GESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GE+GSPPTIPPNATL+FDVELLSW SVKDI K
Sbjct  120  GEAGSPPTIPPNATLKFDVELLSWDSVKDISK  151


 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 76/136 (56%), Gaps = 8/136 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L     V K+G+     D  + KK++K   G + P  G  V++ Y   LLDGT F+ 
Sbjct  256  DLELVSWKTVEKIGQ-----DGKITKKIIKASEGHDKPNDGTIVKIKYVAKLLDGTVFEK  310

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  452
              D   PF+F   + QVI G D+ + TMKKGE  + TI P+  +G+  +      +P N+
Sbjct  311  KGDDEDPFEFKTDEEQVIDGLDKAVATMKKGEVAVVTIGPEHGFGDVDTQRDLALVPANS  370

Query  453  TLQFDVELLSWVSVKD  500
            TL ++VE++S+V  KD
Sbjct  371  TLVYEVEMISFVKAKD  386


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 56/119 (47%), Gaps = 7/119 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V EG  +E P+  DEV V Y      G     S + G   +F + QG   + 
Sbjct  152  DGGVVKKIVSEGKKYEMPKDLDEVTVKYVAKNEAGLVVGQSPEEGA--EFYVHQGHFCEA  209

Query  342  WDQGIKTMKKGECCIFTIPPDL-AYGESGSPPTI----PPNATLQFDVELLSWVSVKDI  503
                +KTM KGE  + T+ P    +  S +   +        TL  D+EL+SW +V+ I
Sbjct  210  LAIAVKTMMKGEKALLTVRPKCEMFVFSNALDRLDGLGESQGTLSIDLELVSWKTVEKI  268



>gb|KHN44911.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=582

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  248
            EDFD   A   DLD    NP++KVGEEKEIG +GLKKKL+KEG GW+TPE GDEV+VHYT
Sbjct  15   EDFDFAGATGGDLDGSSSNPILKVGEEKEIGKEGLKKKLLKEGEGWDTPEVGDEVQVHYT  74

Query  249  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
            GTLLDGTKFDSSRDRGTPF FTLGQGQVIKGWDQGI TMKKGE  +FTIP +LAYGE+GS
Sbjct  75   GTLLDGTKFDSSRDRGTPFSFTLGQGQVIKGWDQGIITMKKGENSLFTIPAELAYGETGS  134

Query  429  PPTIPPNATLQFDVELLSWVSVKDICK  509
            PPTIPPNATLQFDVELLSW SVKDICK
Sbjct  135  PPTIPPNATLQFDVELLSWTSVKDICK  161


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++ +G  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  162  DGGLFKKILTKGEKWENPKDPDEVLVKYEACLEDGTLVAKS----DGVEFTVNDGYFCPA  217

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  218  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPAHDEEGAVPPNATLQITLELVSWKTVSEVT  277


 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 5/103 (5%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVIKGWDQGIKTM  365
            EG G+E P  G  V++   G L DGT F      D G  F+F   + QVI G D+ + TM
Sbjct  289  EGEGYERPNEGAIVKLKVIGKLQDGTLFLKKGHDDEGELFEFKTDEEQVIDGLDRAVLTM  348

Query  366  KKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
            KKGE  +  I P+ A+G S S      +PPN+T+ ++VEL+S+
Sbjct  349  KKGEIALLIIAPEYAFGSSESQLELAVVPPNSTVYYEVELVSF  391



>ref|XP_003520990.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine 
max]
Length=582

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  248
            EDFD   A   DLD    NP++KVGEEKEIG +GLKKKL+KEG GW+TPE GDEV+VHYT
Sbjct  15   EDFDFAGATGGDLDGSSSNPILKVGEEKEIGKEGLKKKLLKEGEGWDTPEVGDEVQVHYT  74

Query  249  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
            GTLLDGTKFDSSRDRGTPF FTLGQGQVIKGWDQGI TMKKGE  +FTIP +LAYGE+GS
Sbjct  75   GTLLDGTKFDSSRDRGTPFSFTLGQGQVIKGWDQGIITMKKGENSLFTIPAELAYGETGS  134

Query  429  PPTIPPNATLQFDVELLSWVSVKDICK  509
            PPTIPPNATLQFDVELLSW SVKDICK
Sbjct  135  PPTIPPNATLQFDVELLSWTSVKDICK  161


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++ +G  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  162  DGGLFKKILTKGEKWENPKDPDEVLVKYEACLEDGTLVAKS----DGVEFTVNDGYFCPA  217

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  218  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPAHDEEGAVPPNATLQITLELVSWKTVSEVT  277


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 5/103 (5%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVIKGWDQGIKTM  365
            EG G+E P  G  V++   G L DGT F      D G  F+F   + QVI G D+ + TM
Sbjct  289  EGEGYERPNEGAIVKLKVIGKLQDGTLFLKKGHDDEGELFEFKTDEEQVIDGLDRAVLTM  348

Query  366  KKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
            KKGE  +  I P+ A+G S S      +PPN+T+ ++VEL+S+
Sbjct  349  KKGEIALLIIGPEYAFGSSESQLELAVVPPNSTVYYEVELVSF  391



>ref|XP_003547780.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Glycine 
max]
Length=574

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 130/151 (86%), Gaps = 4/151 (3%)
 Frame = +3

Query  69   EDFDMPPAE--MDDLDLPDD--NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDFDM  AE   +D D      NPV+KVGEEKEIG +GLKKKL+KEG GW+TPE GDEV+
Sbjct  3    EDFDMAAAEPMGEDFDFAGSGSNPVLKVGEEKEIGKEGLKKKLLKEGEGWDTPEAGDEVQ  62

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGTPF FTLGQGQVIKGWDQGI TMKKGE  +FTIP +LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGTPFSFTLGQGQVIKGWDQGIITMKKGENALFTIPAELAYG  122

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWTSVKDICK  153


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  154  DGGLFKKILTEGEKWENPKDPDEVLVKYEAHLEDGTLVAKS----DGVEFTVNDGHFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
            + + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  210  FSKAVKTMKKGEKVLLTVKPQYGFGEKGKPAHGDEGAVPPNATLQITLELVSWKTVSEVT  269


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 68/113 (60%), Gaps = 5/113 (4%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  335
            D+ + KK++KEG G+E P  G  V++   G L DGT F      D G  F+F   + QVI
Sbjct  271  DKKVIKKILKEGEGYEHPNEGAIVKLKVIGKLQDGTLFLKKGHDDEGGLFEFKTDEEQVI  330

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             G D+ + TMKKGE  + TI P+ A+G S S      +PPN+TL +++EL+S+
Sbjct  331  DGLDRAVLTMKKGEVALLTIAPEYAFGSSESQQELAVVPPNSTLYYEIELVSF  383



>ref|XP_003626943.1| 70 kDa peptidyl-prolyl isomerase [Medicago truncatula]
 gb|AET01419.1| peptidyl-prolyl cis-trans isomerase FKBP62-like protein [Medicago 
truncatula]
Length=575

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 131/151 (87%), Gaps = 4/151 (3%)
 Frame = +3

Query  69   EDFDMPPAEM--DDLDLPD--DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDFD+P  +   DD D     DNP++KVGEEKEIG QGLKKKL+KEG GW+TP+ GDEV 
Sbjct  3    EDFDIPAVDSMNDDFDFAGAGDNPILKVGEEKEIGKQGLKKKLLKEGEGWDTPDVGDEVH  62

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGT F FTLGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGTTFNFTLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYG  122

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWTSVKDICK  153


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK+VKEG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  154  DGGLFKKIVKEGEKWENPKDLDEVLVKYEARLDDGTLVAKS----DGVEFTVKEGYFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  I T+ P   + E G P       +PPNATL+  +EL+SW +V ++ 
Sbjct  210  LPKAVKTMKKGEKVILTVKPQYGFDEKGKPAHGDEGAVPPNATLEITLELVSWKTVSEVT  269


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 63/109 (58%), Gaps = 6/109 (6%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQVIKGWDQGIKT  362
            EG G+E P  G  V++   G L DGT F       D    F+FT  + QVI G D+ + T
Sbjct  281  EGEGYERPNDGAVVKLKLIGKLQDGTVFLKKGHGDDEAELFEFTTDEEQVIDGLDRAVMT  340

Query  363  MKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            MKKGE  + TI P+ A+G S S      +PPN+TL ++VEL+S++  K+
Sbjct  341  MKKGEVALLTIAPEYAFGSSESRQELAVVPPNSTLYYEVELVSFIKDKE  389



>ref|XP_002453845.1| hypothetical protein SORBIDRAFT_04g019590 [Sorghum bicolor]
 gb|EES06821.1| hypothetical protein SORBIDRAFT_04g019590 [Sorghum bicolor]
Length=685

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 117/144 (81%), Gaps = 12/144 (8%)
 Frame = +3

Query  78   DMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTL  257
            D PPAE+            KVGEE+EIG +GLKKKLVKEG GW  P  GDEVEVHYTGTL
Sbjct  80   DNPPAEL------------KVGEEREIGKEGLKKKLVKEGEGWGRPGDGDEVEVHYTGTL  127

Query  258  LDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT  437
            +DGTKFDSSRDR +PFKF LGQGQVIKGWD GIKTMKKGE  +FTIPP+LAYGE GSPP 
Sbjct  128  MDGTKFDSSRDRDSPFKFKLGQGQVIKGWDLGIKTMKKGENAVFTIPPELAYGEDGSPPV  187

Query  438  IPPNATLQFDVELLSWVSVKDICK  509
            IPPNATLQFDVELLSWV +KDICK
Sbjct  188  IPPNATLQFDVELLSWVCIKDICK  211


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 68/118 (58%), Gaps = 4/118 (3%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVI  335
             D+ + KK++KEG G++ P     V V   G L DGT F     D   PF+F   + QVI
Sbjct  328  NDKKVLKKILKEGEGYDRPNDCAIVRVKLIGKLEDGTLFVKKGHDGEEPFEFKTDEDQVI  387

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            +G D+ + +MKKGE  +  IPP  A+G + +      +PPN+++ +++EL+S+   KD
Sbjct  388  EGLDKAVLSMKKGEVALVIIPPHHAFGTNETNQDLAMVPPNSSVYYEMELVSFDKEKD  445


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  212  DGGILKKVLAEGDKWENPRDPDEVFVKYEARLEDGTVVSKS----DGVEFTVRDGVFCPA  267

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E    T+ P   +G  G P      ++PPNATL  D++++SW +V ++
Sbjct  268  ISKAVKTMKKNEKAHLTVMPQYGFGVKGRPTSGEEASVPPNATLHIDLQVVSWRTVTEL  326



>emb|CAA68913.1| peptidylprolyl isomerase [Triticum aestivum]
Length=568

 Score =   217 bits (552),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 118/143 (83%), Gaps = 6/143 (4%)
 Frame = +3

Query  96   MDDLDLPD----DNPV-MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  260
            MD LD+ D    D+P  MKV EEKEIG QGLKKKLVKEG GW+T E   +VEVHYTGTLL
Sbjct  7    MDGLDVDDEEEADSPATMKVREEKEIGKQGLKKKLVKEGEGWDTAETALKVEVHYTGTLL  66

Query  261  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI  440
            DGTKFDSSRDRGTPFKF L QGQVIKGWDQGIKTMKKGE    TIPPDLAYGE  +P TI
Sbjct  67   DGTKFDSSRDRGTPFKFKLEQGQVIKGWDQGIKTMKKGENASLTIPPDLAYGER-APRTI  125

Query  441  PPNATLQFDVELLSWVSVKDICK  509
            PPNATL+FDVELLSW SVKDICK
Sbjct  126  PPNATLRFDVELLSWASVKDICK  148


 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 9/116 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DG+    S       +F++  G     
Sbjct  149  DGGIFKKVLVEGQKWENPKDLDEVTVKYEARLEDGSVVSKSE----SIEFSVKDGYFCPA  204

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSV  494
              + +KTMKKGE  + T+ P   +GE G   T     +PPN+TL  D++L+SW ++
Sbjct  205  LSKAVKTMKKGEKVLLTVKPQYGFGEQGRAATEVEGAVPPNSTLHIDLQLVSWKTL  260


 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 66/115 (57%), Gaps = 7/115 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRG-TPFKFTLGQGQVIK  338
            D+ + KK++KEG G+E P  G  V V   G L DGT F      G  PF+F   + QVI+
Sbjct  266  DKRILKKVLKEGEGYERPNDGAVVRVGLIGKLDDGTVFTKKGHEGDEPFEFKTDEEQVIQ  325

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP------PTIPPNATLQFDVELLSW  485
            G D  + TMKKGE     IPP+ A+G + +         +PPN+++ ++VEL+S+
Sbjct  326  GLDTTVLTMKKGEEASARIPPEHAFGSTETKLSSLIFAVVPPNSSVFYEVELVSF  380



>gb|AFK35673.1| unknown [Medicago truncatula]
Length=575

 Score =   217 bits (552),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 130/151 (86%), Gaps = 4/151 (3%)
 Frame = +3

Query  69   EDFDMPPAEM--DDLDLPD--DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            EDFD+P  +   DD D     DNP++KVGEEKEIG QGLKKKL+KEG GW+TP+ GDEV 
Sbjct  3    EDFDIPAVDSMNDDFDFAGAGDNPILKVGEEKEIGKQGLKKKLLKEGEGWDTPDVGDEVH  62

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGT F FTLGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGTTFNFTLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYG  122

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPT PPNATLQFDVELLSW SVKDICK
Sbjct  123  ESGSPPTTPPNATLQFDVELLSWTSVKDICK  153


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 64/109 (59%), Gaps = 6/109 (6%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQVIKGWDQGIKT  362
            EG G+E P  G  V++   G L DGT F       D    F+FT  +GQVI G D+ + T
Sbjct  281  EGEGYERPNDGAVVKLKLIGKLQDGTVFLKKGHGDDEAELFEFTTDEGQVIDGLDRAVMT  340

Query  363  MKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            MKKGE  + TI P+ A+G S S      +PPN+TL ++VEL+S++  K+
Sbjct  341  MKKGEVALLTIAPEYAFGSSESRQELAVVPPNSTLYYEVELVSFIKDKE  389


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D GL KK+VKEG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  154  DGGLFKKIVKEGEKWENPKDLDEVLVKYEARLDDGTLVAKS----DGVEFTVKEGYFCPA  209

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  I T+ P   + E G P       +PPNATL+  +EL+SW +V ++ 
Sbjct  210  LPKAVKTMKKGEKVILTVKPQYGFDEKGKPAHGDEGAVPPNATLEITLELVSWKTVSEVT  269



>emb|CDY15096.1| BnaC03g44570D [Brassica napus]
Length=705

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 127/151 (84%), Gaps = 5/151 (3%)
 Frame = +3

Query  69   EDFDMPPA----EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            +DF+MPP     + D++D  DD   +K GEEKEI  QGLKKKLVKEG G+ETPE GDEVE
Sbjct  21   KDFEMPPVGGMNDDDEMDFGDDASFLKPGEEKEI-QQGLKKKLVKEGEGFETPENGDEVE  79

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQ IKGWD  IKTMKKGE  +FTIP +LAYG
Sbjct  80   VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQAIKGWDISIKTMKKGENAVFTIPSELAYG  139

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            ESGSPPTIP NATLQFDVELLSW SVKDICK
Sbjct  140  ESGSPPTIPANATLQFDVELLSWSSVKDICK  170


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V  G  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  302  DGGVFKKIVAAGEKWEMPKDLDEVLVKYEAKLEDGTVVGKSDG----VEFTVKDGYFCPA  357

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
            + + +KTMKK E  + T+ P   +GE G P +     +PPNATL+ ++ELLSW +V ++
Sbjct  358  FAKAVKTMKKAEKILLTVKPQYGFGEKGKPASGGETAVPPNATLEIELELLSWKTVPEV  416


 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (57%), Gaps = 5/69 (7%)
 Frame = +3

Query  312  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVEL  476
            +L  G       + +KTMKK E  + T+ P   +GE G P       +PPNATL+ ++EL
Sbjct  196  SLKDGYFCPALSKAVKTMKKAEKVLLTVKPQYGFGEKGKPAFGGEGALPPNATLEIELEL  255

Query  477  LSWVSVKDI  503
            +SW +V ++
Sbjct  256  ISWKTVSEV  264



>ref|XP_010685108.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Beta vulgaris 
subsp. vulgaris]
Length=547

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 131/151 (87%), Gaps = 5/151 (3%)
 Frame = +3

Query  69   EDFDMPPAE--MDD--LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  236
            +DFDMP AE  M+D  +D  D+   MKVGEEKEI  +GLKKKL+KEG GW+ P+ GDEVE
Sbjct  3    DDFDMPAAEDMMNDENMDFADETS-MKVGEEKEISKEGLKKKLLKEGEGWDNPDNGDEVE  61

Query  237  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  416
            VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  I TIP +LAYG
Sbjct  62   VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAILTIPAELAYG  121

Query  417  ESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            E+GSPPTIPP+ATLQFDVELLSWVSVKDICK
Sbjct  122  EAGSPPTIPPSATLQFDVELLSWVSVKDICK  152


 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  153  DGGIFKKILTEGEKWENPKDTDEVFVRYEARLEDGTLVGKS----DGVEFTVNEGHFCPA  208

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  + ++ P   +GE G P +     +PP+A L+  +EL+SW +V ++
Sbjct  209  LSKAVKTMKKGEKALLSVKPQYGFGEQGKPASGNEGAVPPSAVLEITLELVSWKTVSNV  267


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 65/111 (59%), Gaps = 3/111 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK++KEG G++ P  G  V++   G L DGT F         F+F   + QVI+G
Sbjct  270  DKKVVKKILKEGEGYDRPNEGAVVKLKLIGKLQDGTVFLKKGHEDDLFEFKTDEEQVIQG  329

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
             D+ + TMKKGE    TI P+ A+G   +      +PPN+T+ +++EL+S+
Sbjct  330  LDRAVLTMKKGEVASLTIAPEYAFGSLETKQDLAVVPPNSTVCYEIELVSF  380



>ref|XP_003524915.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoformX1 [Glycine 
max]
Length=570

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 129/149 (87%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPA--EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDF+ P A       +   ++P++KVGEEKEIG  GLKKKL+KEG GW+TP+ GD+VEVH
Sbjct  3    EDFEFPSAGNMEMPEEEEFESPILKVGEEKEIGKMGLKKKLLKEGEGWDTPDSGDQVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 70/117 (60%), Gaps = 4/117 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  338
            D+ + KK +KEG G+E P  G  V+V   G L DGT F         PF+F + + QVI 
Sbjct  269  DRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFVKKGYVDEQPFEFKIDEEQVID  328

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            G DQ +K MKKGE  +  I P+ A+G SGS      +PPN+T+ ++VELLS+V  K+
Sbjct  329  GLDQAVKNMKKGEIALLIIQPEYAFGPSGSSQELANVPPNSTVYYEVELLSFVKEKE  385


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ K ++ EG  W+ P+  DEV V +   L DGT    S       +FT+ +G     
Sbjct  152  DGGILKNIITEGEKWDNPKDLDEVFVKFEARLEDGTVISKS----DGVEFTVEEGYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P  A+GESG P       +PPNA LQ D+EL+SW +V DI 
Sbjct  208  LAKAVKTMKKGEKVLLNVKPQYAFGESGRPALGDEGAVPPNAYLQLDLELVSWKTVSDIT  267

Query  507  K  509
            K
Sbjct  268  K  268



>ref|XP_003574982.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Brachypodium 
distachyon]
Length=648

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  120  DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGT  299
            D   MK GEEK IG +GL+KKLVKEG G E P  GDEVEVHYTGTL+DGTKFDSSRDRGT
Sbjct  48   DIAAMKAGEEKGIGKEGLRKKLVKEGEGSEHPGAGDEVEVHYTGTLMDGTKFDSSRDRGT  107

Query  300  PFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELL  479
            PFKFTLG+GQVIKGWD GIKTMK+GE  IFTIPP+L YGE GSPP IP NA LQFDVELL
Sbjct  108  PFKFTLGRGQVIKGWDLGIKTMKRGENAIFTIPPELGYGEDGSPPVIPANAVLQFDVELL  167

Query  480  SWVSVKDICK  509
            SW SVKDICK
Sbjct  168  SWASVKDICK  177


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 64/119 (54%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D  + KK++ EG  WE P+  DEV V Y   L DG+    S       +FT+ +G     
Sbjct  178  DGSIFKKILVEGNKWENPKDSDEVFVKYEARLEDGSIISKS----DGIEFTVKEGHFCPA  233

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P   +GE G P +     +PP+ATL  D++L+SW +V +I
Sbjct  234  ISKAVKTMKKNEKAVLTVKPQYGFGEQGRPASADKAAVPPDATLHIDIQLVSWKTVTEI  292


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 70/116 (60%), Gaps = 5/116 (4%)
 Frame = +3

Query  153  EIG-DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQG  326
            EIG D+ ++KK++++G G++ P     V+V   G L DGT F     D   PF+F   + 
Sbjct  291  EIGNDKKIQKKILQDGEGYDRPNDCATVKVKLIGKLEDGTVFFKKGHDGEEPFEFKTDEE  350

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  485
            QVI+G D+ + +MKKGE    TI P+ A+G   +      +PPN+T+ +D+EL+S+
Sbjct  351  QVIEGLDKAVLSMKKGEIAFVTISPEHAFGSDETKQDLAVVPPNSTVYYDLELVSF  406



>ref|XP_008352304.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Malus domestica]
Length=567

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 130/157 (83%), Gaps = 10/157 (6%)
 Frame = +3

Query  69   EDFDMPPAEMD-----DLDLPD-----DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPE  218
            +DFD   A  +     DLDLPD      +P +KVG+EKEIG  GLKKKL+KEG GW+TP 
Sbjct  3    DDFDFSAATNNLNDAGDLDLPDAEDDATSPTLKVGDEKEIGKNGLKKKLLKEGEGWDTPG  62

Query  219  PGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIP  398
             GDEVEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIP
Sbjct  63   SGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFNLGQGQVIKGWDEGIKTMKKGENAVFTIP  122

Query  399  PDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            P+LAYGESGSPPTIPPNATLQFDVELLSW SVKDI K
Sbjct  123  PELAYGESGSPPTIPPNATLQFDVELLSWTSVKDILK  159


 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 67/123 (54%), Gaps = 9/123 (7%)
 Frame = +3

Query  156  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  335
            + D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G   
Sbjct  158  LKDGGVMKKIITEGEKWENPKDLDEVFVKYEARLEDGTLVSKS----NGVEFTVQDGYFC  213

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKD  500
                + +KTMKKGE  + T+ P   +GE+G P       +PPNATL+  +EL+SW +V D
Sbjct  214  PALAKAVKTMKKGEKVLLTVKPQYGFGEAGRPAIGDEGAVPPNATLEIALELVSWKTVSD  273

Query  501  ICK  509
            + K
Sbjct  274  VTK  276


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK +KEG G+E P  G  V+V   G L DGT F        PF+F   + QVI+G
Sbjct  277  DKKVLKKTLKEGEGYERPNDGAVVKVKLVGKLPDGTIFTKKGHDDEPFEFKTDEEQVIEG  336

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             D+ +K MKKGE  + TI P+ A+G + S      +P N+T+ ++VEL+S+V  K+
Sbjct  337  LDRAVKNMKKGEGALVTIQPEYAFGSTESAQDLAVVPANSTVHYEVELVSFVKDKE  392



>ref|XP_007153782.1| hypothetical protein PHAVU_003G064500g [Phaseolus vulgaris]
 gb|ESW25776.1| hypothetical protein PHAVU_003G064500g [Phaseolus vulgaris]
Length=569

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 130/150 (87%), Gaps = 5/150 (3%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  239
            EDF+ P A    +++PD+   + ++KVGEEKEIG  GLKKKL+KEG GW++P  GD+VEV
Sbjct  3    EDFEFPSA--GSMEMPDEEMESSILKVGEEKEIGKMGLKKKLLKEGEGWDSPNSGDQVEV  60

Query  240  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  419
            HYTGTLLDGT FDSSRDRGTPF+F LGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYGE
Sbjct  61   HYTGTLLDGTHFDSSRDRGTPFRFNLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYGE  120

Query  420  SGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            SGSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  121  SGSPPTIPPNATLQFDVELLSWTSVKDICK  150


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 68/112 (61%), Gaps = 4/112 (4%)
 Frame = +3

Query  177  KKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQG  353
            KK +KEG G+E P  G  V+V   G L DGT F         PF+F + + QVI G ++ 
Sbjct  273  KKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFIKKGYGDEQPFEFKIDEEQVIDGLEKA  332

Query  354  IKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            +K MKKGE  +  I P+ A+G SGSP     IPPN+TL ++VELLS+V  K+
Sbjct  333  VKNMKKGEIALLIIQPEYAFGPSGSPQELAIIPPNSTLYYEVELLSFVKEKE  384


 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 69/121 (57%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ K ++ EG  W+ P+  DEV V Y   L DGT    S       +FT+ +G   + 
Sbjct  151  DGGILKNIITEGEKWDNPKDLDEVFVKYEARLEDGTVISKS----DGVEFTVEEGYFCRA  206

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P  A+GESG P +     +PPNA+L+ D+EL+SW SV DI 
Sbjct  207  LAKAVKTMKKGEKVLLNVKPQYAFGESGRPASGEEGAVPPNASLEVDLELVSWKSVSDIT  266

Query  507  K  509
            K
Sbjct  267  K  267



>ref|XP_009373610.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Pyrus x bretschneideri]
Length=567

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 129/157 (82%), Gaps = 10/157 (6%)
 Frame = +3

Query  69   EDFDMPPAEMD-----DLDLPD-----DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPE  218
            +DFD   A        DLDLPD      +P +KVG+EKEIG  GLKKKL+KEG GW+TP 
Sbjct  3    DDFDFSAATNSLNDPGDLDLPDAEDDATSPTLKVGDEKEIGKNGLKKKLLKEGEGWDTPG  62

Query  219  PGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIP  398
             GDEVEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIP
Sbjct  63   SGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFNLGQGQVIKGWDEGIKTMKKGENAVFTIP  122

Query  399  PDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            P+LAYGESGSPPTIPPNATLQFDVELLSW SVKDI K
Sbjct  123  PELAYGESGSPPTIPPNATLQFDVELLSWTSVKDILK  159


 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 70/118 (59%), Gaps = 3/118 (3%)
 Frame = +3

Query  156  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  335
            I D+ + KK +KEG G+E P  G  V+V   G L DGT F        PF+F   + QVI
Sbjct  275  IKDKKVLKKTLKEGEGYERPNDGAVVKVKLVGKLPDGTIFTKKGHDDEPFEFKTDEEQVI  334

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            +G D+ +K MKKGE  + TI P+ A+G + S      +P N+T+ ++VEL+S+V  K+
Sbjct  335  EGLDRAVKNMKKGEVALVTIQPEYAFGSTESAQDLAVVPANSTVHYEVELVSFVKDKE  392


 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 67/123 (54%), Gaps = 9/123 (7%)
 Frame = +3

Query  156  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  335
            + D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G   
Sbjct  158  LKDGGVMKKIITEGEKWENPKDLDEVFVKYEARLEDGTLVSKSE----GVEFTVQDGHFC  213

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKD  500
                + +KTMKKGE  + T+ P   +GE+G   T     +PPNATL+  +EL+SW +V D
Sbjct  214  PALAKAVKTMKKGEKVLLTVKPQYGFGEAGRSATGDEGVVPPNATLEIALELVSWKTVSD  273

Query  501  ICK  509
            + K
Sbjct  274  VIK  276



>ref|XP_011084142.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Sesamum 
indicum]
Length=650

 Score =   213 bits (542),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 131/159 (82%), Gaps = 12/159 (8%)
 Frame = +3

Query  69   EDFDMPPA---------EMD---DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWET  212
            +DF+ P A         EMD   D+DLP  NP++KVGEEKEIG  GLKKKL+KEG GWE 
Sbjct  3    DDFEFPAAGSNEMEMDDEMDAGNDMDLPVGNPILKVGEEKEIGKDGLKKKLLKEGEGWEN  62

Query  213  PEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFT  392
            P+ GDEVEVHY GTLLDGT+FDSSRDRGTPF F LGQGQVIKGWD+GIKTMKKGE  +FT
Sbjct  63   PDSGDEVEVHYVGTLLDGTQFDSSRDRGTPFTFKLGQGQVIKGWDEGIKTMKKGEKALFT  122

Query  393  IPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            IPP+LAYGESGSPP IPPN+TLQF+VELLSW SVKDICK
Sbjct  123  IPPELAYGESGSPPKIPPNSTLQFEVELLSWNSVKDICK  161


 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 74/118 (63%), Gaps = 4/118 (3%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVI  335
             DQ + KK++KEG G+E P+ G  V+V   G L DGT F     D   PF+F + + QVI
Sbjct  278  NDQKILKKILKEGEGYERPDDGATVQVKLIGKLHDGTIFVRKGYDDEPPFEFKVDEDQVI  337

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            +G D+ IKTMKKGE  + +I P+ A+G S SP     +P N+ + +++E++S++  K+
Sbjct  338  EGLDRTIKTMKKGEVALVSIQPEYAFGPSESPQELAVVPGNSVVYYELEMISFLKEKE  395


 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG GW+ P+  DEV V Y   L DGT       +    +FT+  G     
Sbjct  162  DGGIYKKVLTEGEGWQNPKDLDEVFVKYEARLEDGTIV----SKADGVEFTVKDGYFCPA  217

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + IKTMKKGE  + T+     +GE G P T     +PPNATLQ ++EL+SW +V D+ 
Sbjct  218  LSKAIKTMKKGEKVLLTVKAQYGFGEKGRPATGDELYVPPNATLQINLELVSWKTVSDVS  277



>gb|AFW71473.2| peptidyl-prolyl isomerase [Zea mays]
Length=619

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +3

Query  132  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  311
            +KVGEE+EIG +GLKKKLVKEG G + P  GDEVEVHYTGTL+DGT FDS+RDR +PFKF
Sbjct  20   LKVGEEREIGKEGLKKKLVKEGEGCDRPGAGDEVEVHYTGTLIDGTMFDSTRDRDSPFKF  79

Query  312  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVS  491
            TLGQGQVIKGWD GIKTMKKGE  +FTIPP+LAYGE GSPP IPPNATLQFDVELLSWV 
Sbjct  80   TLGQGQVIKGWDLGIKTMKKGENAVFTIPPELAYGEDGSPPVIPPNATLQFDVELLSWVC  139

Query  492  VKDICK  509
            +KDI K
Sbjct  140  IKDISK  145


 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V +G  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  146  DGGILKKVVAKGDKWENPRDPDEVVVKYEARLEDGTVVSKS----DGVEFTVRDGVFCPA  201

Query  342  WDQGIKTMKKGECCIFTIPPDLAYG-----ESGSPPTIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E    T+ P   +G      SG   ++PPNATL  D++++SW +V ++
Sbjct  202  ISKAVKTMKKNEKAHLTVMPQYGFGVKGRQASGEEASVPPNATLHIDLQVVSWRTVTEL  260


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 61/107 (57%), Gaps = 4/107 (4%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  368
            EG G++ P     V V   G L DGT F     D   PF+F   + QVI+G D+ + +MK
Sbjct  273  EGEGYDCPNDCAVVRVKLIGKLEDGTLFVKKGHDGEEPFEFKTDEDQVIEGLDKAVLSMK  332

Query  369  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            KGE  + TIPP  A+G + +     T+PPN+ + +++EL+S+   KD
Sbjct  333  KGEVSLVTIPPHHAFGTNETTKDLATVPPNSYVYYEMELVSFDKEKD  379



>ref|NP_001151484.1| LOC100285117 [Zea mays]
 gb|ACG43033.1| peptidyl-prolyl isomerase [Zea mays]
Length=677

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +3

Query  132  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  311
            +KVGEE+EIG +GLKKKLVKEG G + P  GDEVEVHYTGTL+DGT FDS+RDR +PFKF
Sbjct  78   LKVGEEREIGKEGLKKKLVKEGEGCDRPGAGDEVEVHYTGTLIDGTMFDSTRDRDSPFKF  137

Query  312  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVS  491
            TLGQGQVIKGWD GIKTMKKGE  +FTIPP+LAYGE GSPP IPPNATLQFDVELLSWV 
Sbjct  138  TLGQGQVIKGWDLGIKTMKKGENAVFTIPPELAYGEDGSPPVIPPNATLQFDVELLSWVC  197

Query  492  VKDICK  509
            +KDI K
Sbjct  198  IKDISK  203


 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V +G  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  204  DGGILKKVVAKGDKWENPRDPDEVVVKYEARLEDGTVVSKS----DGVEFTVRDGVFCPA  259

Query  342  WDQGIKTMKKGECCIFTIPPDLAYG-----ESGSPPTIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E    T+ P   +G      SG   ++PPNATL  D++++SW +V ++
Sbjct  260  ISKAVKTMKKNEKAHLTVMPQYGFGVKGRQASGEEASVPPNATLHIDLQVVSWRTVTEL  318


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 61/107 (57%), Gaps = 4/107 (4%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  368
            EG G++ P     V V   G L DGT F     D   PF+F   + QVI+G D+ + +MK
Sbjct  331  EGEGYDCPNDCAVVRVKLIGKLEDGTLFVKKGHDGEEPFEFKTDEDQVIEGLDKAVLSMK  390

Query  369  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            KGE  + TIPP  A+G + +     T+PPN+ + +++EL+S+   KD
Sbjct  391  KGEVSLVTIPPHHAFGTNETTKDLATVPPNSYVYYEMELVSFDKEKD  437



>gb|ACN30883.1| unknown [Zea mays]
Length=677

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +3

Query  132  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  311
            +KVGEE+EIG +GLKKKLVKEG G + P  GDEVEVHYTGTL+DGT FDS+RDR +PFKF
Sbjct  78   LKVGEEREIGKEGLKKKLVKEGEGCDRPGAGDEVEVHYTGTLIDGTMFDSTRDRDSPFKF  137

Query  312  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVS  491
            TLGQGQVIKGWD GIKTMKKGE  +FTIPP+LAYGE GSPP IPPNATLQFDVELLSWV 
Sbjct  138  TLGQGQVIKGWDLGIKTMKKGENAVFTIPPELAYGEDGSPPVIPPNATLQFDVELLSWVC  197

Query  492  VKDICK  509
            +KDI K
Sbjct  198  IKDISK  203


 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V +G  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  204  DGGILKKVVAKGDKWENPRDPDEVVVKYEARLEDGTVVSKS----DGVEFTVRDGVFCPA  259

Query  342  WDQGIKTMKKGECCIFTIPPDLAYG-----ESGSPPTIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E    T+ P   +G      SG   ++PPNATL  D++++SW +V ++
Sbjct  260  ISKAVKTMKKNEKAHLTVMPQYGFGVKGRQASGEEASVPPNATLHIDLQVVSWRTVTEL  318


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 61/107 (57%), Gaps = 4/107 (4%)
 Frame = +3

Query  192  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  368
            EG G++ P     V V   G L DGT F     D   PF+F   + QVI+G D+ + +MK
Sbjct  331  EGEGYDCPNDCAVVRVKLIGKLEDGTLFVKKGHDGEEPFEFKTDEDQVIEGLDKAVLSMK  390

Query  369  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            KGE  + TIPP  A+G + +     T+PPN+ + +++EL+S+   KD
Sbjct  391  KGEVSLVTIPPHHAFGTNETTKDLATVPPNSYVYYEMELVSFDKEKD  437



>ref|XP_006492988.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
FKBP65-like [Citrus sinensis]
Length=567

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 122/157 (78%), Gaps = 23/157 (15%)
 Frame = +3

Query  69   EDFDMPP-AEMD-----DLDLPDD----NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPE  218
            +DF+ P  + M+     D+D+P+D    +P++KVGEEKEIG  GLK              
Sbjct  3    DDFEFPTTSNMEEGLDMDMDVPEDDDPVSPILKVGEEKEIGKNGLK-------------X  49

Query  219  PGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIP  398
             GDEVEVHYTGTLLDGTKFDSSRDR TPFKF LGQGQVIKGWD+GIKTMKKG+  +FTIP
Sbjct  50   SGDEVEVHYTGTLLDGTKFDSSRDRETPFKFKLGQGQVIKGWDEGIKTMKKGKNAVFTIP  109

Query  399  PDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            P+LAYGESGSPPTIPPNATLQFDVELL+W SVKDICK
Sbjct  110  PELAYGESGSPPTIPPNATLQFDVELLAWTSVKDICK  146


 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  147  DGGIFKKILVEGEKWENPKDLDEVFVKYEARLEDGTLISKS----DGVEFTVGDGYFCAA  202

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  + T+ P  A+G++G P T     +P NA L   +EL+SW +V DI 
Sbjct  203  LAKAVKTMKKGEKVLLTVKPQYAFGKNGRPATGDEDAVPSNANLHITLELVSWKTVSDIT  262

Query  507  K  509
            K
Sbjct  263  K  263


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 70/117 (60%), Gaps = 4/117 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F     D    F+F + + QVI 
Sbjct  264  DKKVLKKILKEGDGYEXPNDGAVVQVKLIGKLHDGTVFVKKGHDEEPLFEFKIDEEQVID  323

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            G D+ +KT+KKGE  + TI P+ A+G   S      +P N+TL ++VEL+S++  K+
Sbjct  324  GLDRAVKTLKKGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKE  380



>gb|EMS49100.1| 70 kDa peptidyl-prolyl isomerase [Triticum urartu]
Length=651

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  129  VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  308
             MK GEE+ IG +GL+KKL++EG G + P  GDEVEVHYTGTL+DGTKFDSSRDR  PF+
Sbjct  59   AMKAGEERGIGKEGLRKKLLREGEGSQLPGAGDEVEVHYTGTLVDGTKFDSSRDRDAPFR  118

Query  309  FTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWV  488
            FTLG+GQVIKGWD GIKTMK+GE  IFTIPP+LAYGE GSPP IPPNATLQFDVELLSW 
Sbjct  119  FTLGRGQVIKGWDLGIKTMKRGENAIFTIPPELAYGEDGSPPVIPPNATLQFDVELLSWA  178

Query  489  SVKDICK  509
            SVKDICK
Sbjct  179  SVKDICK  185


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 78/141 (55%), Gaps = 11/141 (8%)
 Frame = +3

Query  81   MPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGT  254
            +PP  M   DL L     V ++G +K I      KK+++EG G++ P+    V+V   G 
Sbjct  279  VPPNAMLHIDLQLVSWKTVTEIGNDKTI-----LKKILQEGEGYDRPKDCSTVKVKLIGK  333

Query  255  LLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP  431
            L DGT F     D   PF+F   + QVI+G DQ + +MKKGE    TIPP+ A+G   + 
Sbjct  334  LEDGTMFVKKGHDGEEPFEFKTDEDQVIEGLDQAVLSMKKGEVAFVTIPPEHAFGSDETK  393

Query  432  ---PTIPPNATLQFDVELLSW  485
                 +PPN T+ +DVEL+S+
Sbjct  394  QDLAIVPPNTTVYYDVELVSF  414


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 63/119 (53%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D  + KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  186  DGSIFKKILAEGEKWENPKDRDEVFVKYEARLEDGTLVTKS----DGVEFTVKEGHFCPA  241

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P   +GE G P +     +PPNA L  D++L+SW +V +I
Sbjct  242  IAKAVKTMKKNEKALLTVKPQYGFGEQGRPASRDEAAVPPNAMLHIDLQLVSWKTVTEI  300



>dbj|BAJ95453.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=650

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +3

Query  129  VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  308
             MK G+E+ +G +GL+K+LV+EG G + P  GDEVEVHYTGTL DGT FDSSRDRG PF+
Sbjct  58   AMKAGDERGVGKEGLRKRLVREGEGSQLPGAGDEVEVHYTGTLADGTNFDSSRDRGAPFR  117

Query  309  FTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWV  488
            FTLG+GQVIKGWD GIKTMK+GE  IFTIPP+LAYGE GSPP IPPNATLQFDVELLSW 
Sbjct  118  FTLGRGQVIKGWDLGIKTMKRGENAIFTIPPELAYGEDGSPPVIPPNATLQFDVELLSWA  177

Query  489  SVKDICK  509
            SVKDICK
Sbjct  178  SVKDICK  184


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 77/141 (55%), Gaps = 11/141 (8%)
 Frame = +3

Query  81   MPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGT  254
            +PP  M   DL L     V ++G +K I      KK+++EG G++ P+    V+V   G 
Sbjct  278  VPPNAMLQIDLQLVSWKTVTEIGNDKTI-----LKKILQEGEGYDRPKDCSTVKVKLIGK  332

Query  255  LLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP  431
            L DGT F     D   PF+F   + QVI G D+ + +MKKGE    TIPP+ A+G   + 
Sbjct  333  LDDGTMFVKKGHDGEEPFEFKTDEDQVIDGLDKAVLSMKKGEVAFVTIPPEHAFGSDETK  392

Query  432  ---PTIPPNATLQFDVELLSW  485
                 +PPN T+ +D+EL+S+
Sbjct  393  HDLAIVPPNTTVYYDIELVSF  413


 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 63/119 (53%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D  + KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  185  DGSIFKKILAEGEKWENPKDRDEVFVKYEARLEDGTLVTKS----DGVEFTVKEGHFCPA  240

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + IKTMKK E  + T+ P   +G  G P +     +PPNA LQ D++L+SW +V +I
Sbjct  241  VSKAIKTMKKNEKALLTVKPQYGFGGQGRPASRGEAAVPPNAMLQIDLQLVSWKTVTEI  299



>ref|XP_003532733.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max]
Length=570

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPA--EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDF+ P A       +   ++P++KVGEEKEIG  GLKKKL+KEG GW+ P+ GD+VEVH
Sbjct  3    EDFEFPSAGNMEMPEEEEIESPILKVGEEKEIGKMGLKKKLLKEGEGWDIPDCGDQVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFRLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 71/118 (60%), Gaps = 4/118 (3%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVI  335
             D+ + KK +KEG G+E P  G  V+V   G L DGT F     D   PF+F + + QV 
Sbjct  268  NDRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFIKKGYDDQQPFEFKIDEEQVT  327

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
             G DQ +K+MKKGE  +  I P+ A+G SGS      +PPN+T+ ++VELLS++  K+
Sbjct  328  DGLDQAVKSMKKGEIALLIIQPEYAFGPSGSSQELANVPPNSTVYYEVELLSFIKEKE  385


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ K ++ EG  W+ P+  DEV V Y   L DG     S       +FT+ +G     
Sbjct  152  DGGILKNIITEGEKWDNPKDLDEVFVKYEARLEDGIVISKS----DGVEFTVEEGYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P  A+GESG P +     +PPNA+LQ D+EL+SW +V DI 
Sbjct  208  LAKAVKTMKKGEKVLLNVKPQYAFGESGRPASGDEGAVPPNASLQVDLELVSWKTVSDIT  267



>gb|KHN12365.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Glycine soja]
Length=570

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   EDFDMPPA--EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            EDF+ P A       +   ++P++KVGEEKEIG  GLKKKL+KEG GW+ P+ GD+VEVH
Sbjct  3    EDFEFPSAGNMEMPEEEEIESPILKVGEEKEIGKMGLKKKLLKEGEGWDIPDCGDQVEVH  62

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFRLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYGES  122

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPPTIPPNATLQFDVELLSW SVKDICK
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICK  151


 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 72/119 (61%), Gaps = 4/119 (3%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVI  335
             D+ + KK +KEG G+E P  G  V+V   G L DGT F     D   PF+F + + QV 
Sbjct  268  NDRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFIKKGYDDQQPFEFKIDEEQVT  327

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDI  503
             G DQ +K+MKKGE  +  I P+ A+G SGS      +PPN+T+ ++VELLS++  K++
Sbjct  328  DGLDQAVKSMKKGEIALLIIQPEYAFGPSGSSQELANVPPNSTVYYEVELLSFIKEKEL  386


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 9/120 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ K ++ EG  W+ P+  DEV V Y   L DG     S       +FT+ +G     
Sbjct  152  DGGILKNIITEGEKWDNPKDLDEVFVKYEARLEDGIVISKS----DGVEFTVEEGYFCPA  207

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              + +KTMKKGE  +  + P  A+GESG P +     +PPNA+LQ D+EL+SW +V DI 
Sbjct  208  LAKAVKTMKKGEKVLLNVKPQYAFGESGRPASGDEGAVPPNASLQVDLELVSWKTVSDIT  267



>ref|XP_003574798.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase [Brachypodium distachyon]
Length=567

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  120  DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGT  299
            D PV+KVGEEKE+G QGLKKKL+KEG GWETPE GDEVEVHYTGTLLDG KFDSSRDR  
Sbjct  30   DGPVLKVGEEKEVGKQGLKKKLLKEGEGWETPEVGDEVEVHYTGTLLDGKKFDSSRDRAD  89

Query  300  PFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELL  479
             FKF LGQGQVIKGWDQGIKTMKKGE  +FTIPP+LAYGE+GSPPTIP NATLQFDVELL
Sbjct  90   TFKFKLGQGQVIKGWDQGIKTMKKGENALFTIPPELAYGETGSPPTIPANATLQFDVELL  149

Query  480  SWVSVKDICK  509
            SW SV+DICK
Sbjct  150  SWTSVRDICK  159


 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 82/137 (60%), Gaps = 9/137 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  278
            DL+L     V ++GE+K+I      KK++KEG G+E P  G  V+V  TG L DGT F  
Sbjct  262  DLELVSWKTVTEIGEDKKI-----LKKVIKEGEGYERPNEGAVVKVKITGKLQDGTVFLK  316

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
              +D   PF+F   + +VI G +  +  MKKGE  + TIPP+ AYG + S      +PPN
Sbjct  317  KGQDEQEPFEFKTDEEEVIGGLELAVLNMKKGEVALVTIPPEHAYGSTESKQDLAIVPPN  376

Query  450  ATLQFDVELLSWVSVKD  500
            +T+ ++VEL+S+V  K+
Sbjct  377  STVIYEVELVSFVKDKE  393


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 66/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G +   
Sbjct  160  DGGIFKKILKEGEKWENPKDPDEVFVKYEARLEDGTVVSKSEG----VEFTVKDGYLCPA  215

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P   +GE G P T     IPPNA+L  D+EL+SW +V +I
Sbjct  216  LAKAVKTMKKAEKVLLTVKPQYGFGEMGRPATGQEGGIPPNASLLIDLELVSWKTVTEI  274



>dbj|BAK02378.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 127/155 (82%), Gaps = 10/155 (6%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPD--------DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            +DFD+P    DD+ + D        D P MKVGEEKEIG QGLKKKL+KEG GW+TPE G
Sbjct  3    DDFDIPAG--DDMMMGDGTGDFGGADGPGMKVGEEKEIGKQGLKKKLLKEGEGWDTPEVG  60

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHYTGTLLDG KFDSSRDR   FKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+
Sbjct  61   DEVEVHYTGTLLDGKKFDSSRDRDDTFKFKLGQGQVIKGWDEGIKTMKKGENALFTIPPE  120

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            LAYGESGSPPTIP NATLQFDVELLSW SV+DICK
Sbjct  121  LAYGESGSPPTIPANATLQFDVELLSWTSVRDICK  155


 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 80/136 (59%), Gaps = 8/136 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  278
            DL+L     V ++G++K+I      KK++KEG G+E P  G  V V  TG L DGT F  
Sbjct  258  DLELVSWKTVTEIGDDKKI-----LKKVLKEGEGYERPNEGAVVTVKITGKLQDGTVFLK  312

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG--ESGSPPTIPPNA  452
               D   PF+F   +  VI+G D+ +  MKKGE    TIPP+ AYG  ES     +PPN+
Sbjct  313  KGHDEQEPFEFKTDEDAVIEGLDRAVLNMKKGEVAFVTIPPEYAYGSTESKQDAIVPPNS  372

Query  453  TLQFDVELLSWVSVKD  500
            T+ ++VEL+S+V  K+
Sbjct  373  TVIYEVELVSFVKDKE  388


 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WETP+  DEV V Y   L DGT    S       +FT+  G +   
Sbjct  156  DGGIFKKILKEGDKWETPKDPDEVFVKYEARLEDGTVVSKSEG----VEFTVKDGHLCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  +  + P   +GE G P       +PPNA+L  D+EL+SW +V +I
Sbjct  212  LAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLIIDLELVSWKTVTEI  270



>gb|EMT24309.1| 70 kDa peptidyl-prolyl isomerase [Aegilops tauschii]
Length=611

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 127/155 (82%), Gaps = 10/155 (6%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPD--------DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  224
            +DFD+P    DDL + D        + P MKVGEEKEIG QGLKKKL+KEG GW+TPE G
Sbjct  3    DDFDIPAG--DDLMMGDGMGDFGGAEGPGMKVGEEKEIGKQGLKKKLLKEGEGWDTPEVG  60

Query  225  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  404
            DEVEVHYTGTLLDG KFDSSRDR   FKF LGQGQVIKGWDQGIKTMKKGE  +FTIPP+
Sbjct  61   DEVEVHYTGTLLDGKKFDSSRDRDDTFKFKLGQGQVIKGWDQGIKTMKKGENALFTIPPE  120

Query  405  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            LAYGESGSPPTIP NATLQFDVELLSW SV+DICK
Sbjct  121  LAYGESGSPPTIPANATLQFDVELLSWTSVRDICK  155


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 81/136 (60%), Gaps = 8/136 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  278
            DL+L     V ++G++K+I      KK++KEG G+E P  G  V V  TG L DGT F  
Sbjct  258  DLELVSWKTVTEIGDDKKI-----LKKVLKEGEGYERPNEGAVVTVKITGKLQDGTVFLK  312

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG--ESGSPPTIPPNA  452
               D   PF+F   +  VI+G D+ +  MKKGE  + TIPP+ AYG  ES     +PPN+
Sbjct  313  KGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAVVPPNS  372

Query  453  TLQFDVELLSWVSVKD  500
            T+ ++VEL+S+V  K+
Sbjct  373  TVIYEVELVSFVKDKE  388


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G +   
Sbjct  156  DGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEG----VEFTVKDGHLCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  + T+ P   +GE G P       +PPNA L  D+EL+SW +V +I
Sbjct  212  LAKAVKTMKKGEKVLLTVKPQYGFGEMGRPAAGEGGAVPPNAGLVIDLELVSWKTVTEI  270



>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73
 pdb|3JYM|B Chain B, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73
Length=377

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  120  DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGT  299
            + P MKVGEE EIG QGLKKKL+KEG GW+TPE GDEVEVHYTGTLLDG KFDSSRDR  
Sbjct  12   EGPGMKVGEENEIGKQGLKKKLLKEGEGWDTPEVGDEVEVHYTGTLLDGKKFDSSRDRDD  71

Query  300  PFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELL  479
             FKF LGQGQVIKGWDQGIKTMKKGE  +FTIPP+LAYGESGSPPTIP NATLQFDVELL
Sbjct  72   TFKFKLGQGQVIKGWDQGIKTMKKGENALFTIPPELAYGESGSPPTIPANATLQFDVELL  131

Query  480  SWVSVKDICK  509
            SW SV+DI K
Sbjct  132  SWTSVRDIAK  141


 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 80/136 (59%), Gaps = 8/136 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  278
            DL+L     V ++G++K+I      KK++KE  G+E P  G  V V  TG L DGT F  
Sbjct  244  DLELVSWKTVTEIGDDKKI-----LKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLK  298

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG--ESGSPPTIPPNA  452
               D   PF+F   +  VI+G D+ +  MKKGE  + TIPP+ AYG  ES     +PPN+
Sbjct  299  KGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNS  358

Query  453  TLQFDVELLSWVSVKD  500
            T+ ++VEL+S+V  K+
Sbjct  359  TVIYEVELVSFVKDKE  374


 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G +   
Sbjct  142  DGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEG----VEFTVKDGHLCPA  197

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  +  + P   +GE G P       +PPNA+L  D+EL+SW +V +I
Sbjct  198  LAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEI  256



>sp|Q43207.1|FKB70_WHEAT RecName: Full=70 kDa peptidyl-prolyl isomerase; AltName: Full=Peptidyl-prolyl 
cis-trans isomerase; Short=PPIase; AltName: 
Full=Rotamase [Triticum aestivum]
 emb|CAA60505.1| peptidylprolyl isomerase [Triticum aestivum]
Length=559

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  120  DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGT  299
            + P MKVGEE EIG QGLKKKL+KEG GW+TPE GDEVEVHYTGTLLDG KFDSSRDR  
Sbjct  26   EGPGMKVGEENEIGKQGLKKKLLKEGEGWDTPEVGDEVEVHYTGTLLDGKKFDSSRDRDD  85

Query  300  PFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELL  479
             FKF LGQGQVIKGWDQGIKTMKKGE  +FTIPP+LAYGESGSPPTIP NATLQFDVELL
Sbjct  86   TFKFKLGQGQVIKGWDQGIKTMKKGENALFTIPPELAYGESGSPPTIPANATLQFDVELL  145

Query  480  SWVSVKDICK  509
            SW SV+DI K
Sbjct  146  SWTSVRDIAK  155


 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 80/136 (59%), Gaps = 8/136 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  278
            DL+L     V ++G++K+I      KK++KE  G+E P  G  V V  TG L DGT F  
Sbjct  258  DLELVSWKTVTEIGDDKKI-----LKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLK  312

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG--ESGSPPTIPPNA  452
               D   PF+F   +  VI+G D+ +  MKKGE  + TIPP+ AYG  ES     +PPN+
Sbjct  313  KGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNS  372

Query  453  TLQFDVELLSWVSVKD  500
            T+ ++VEL+S+V  K+
Sbjct  373  TVIYEVELVSFVKDKE  388


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G +   
Sbjct  156  DGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEG----VEFTVKDGHLCPA  211

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  +  + P   +GE G P       +PPNA+L  D+EL+SW +V +I
Sbjct  212  LAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEI  270



>ref|XP_002979133.1| hypothetical protein SELMODRAFT_110584 [Selaginella moellendorffii]
 gb|EFJ19541.1| hypothetical protein SELMODRAFT_110584 [Selaginella moellendorffii]
Length=569

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +3

Query  135  KVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFT  314
            K G+E+EIG  GLKK LVK G GWE P  GDEV+VHYTG LLDGT+FDSSRDRG PF F 
Sbjct  14   KEGQEREIGKHGLKKLLVKAGEGWERPSTGDEVKVHYTGMLLDGTEFDSSRDRGEPFSFK  73

Query  315  LGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSV  494
            LG GQVIKGWD GI TM+KGE   FTIPP+LAYGE+G+ P+IP NATL+FDVELLSW S+
Sbjct  74   LGVGQVIKGWDHGISTMRKGESATFTIPPELAYGEAGAGPSIPGNATLKFDVELLSWDSI  133

Query  495  KDICK  509
            K+ICK
Sbjct  134  KEICK  138


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK++K+G G+E P  G  V+V Y G L +G  FD     G  F+F + + QVI G
Sbjct  258  DRKVVKKILKQGEGYEMPNDGSLVKVKYVGKLANGRVFDERGLAGELFEFRVDEEQVISG  317

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGES---GSPPTIPPNATLQFDVELLSWVSVKD  500
             D+ +  MKKGE  + TI P+  YG S   GS   IP N+TL +++EL S+V  KD
Sbjct  318  LDKAVSKMKKGEVSLITIDPEYGYGNSVTRGSLSLIPANSTLTYELELDSFVKEKD  373


 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 61/119 (51%), Gaps = 7/119 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V EG  W TP+  DEV V +   L DGT   ++   G  F+ T   G +   
Sbjct  139  DGGILKKIVAEGRNWATPKDDDEVLVRFEAKLEDGTVVATTPLAGVEFRVT--DGYLCPA  196

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + ++TMK+ E  I T+     +GE+G         IPPNA+L   +ELLSW  V  I
Sbjct  197  ISKAVRTMKREEKVILTVKSQYGFGEAGKKAHGNECAIPPNASLIISLELLSWRVVDYI  255



>ref|XP_002988507.1| hypothetical protein SELMODRAFT_183937 [Selaginella moellendorffii]
 gb|EFJ10303.1| hypothetical protein SELMODRAFT_183937 [Selaginella moellendorffii]
Length=569

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +3

Query  135  KVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFT  314
            K G+E+EIG  GLKK LVK G GWE P  GDEV+VHYTG LLDGT+FDSSRDRG PF F 
Sbjct  14   KEGQEREIGKHGLKKLLVKAGEGWERPSTGDEVKVHYTGMLLDGTEFDSSRDRGEPFSFK  73

Query  315  LGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSV  494
            LG GQVIKGWD GI TM+KGE   FTIPP+LAYGE+G+ P+IP NATL+FDVELLSW S+
Sbjct  74   LGVGQVIKGWDHGISTMRKGETATFTIPPELAYGEAGAGPSIPGNATLKFDVELLSWDSI  133

Query  495  KDICK  509
            K+ICK
Sbjct  134  KEICK  138


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D+ + KK++K+G G+E P  G  V+V Y G L +G  FD     G  F+F + + QVI G
Sbjct  258  DRKVVKKILKQGEGYEMPNDGSLVKVKYVGKLANGRVFDERGLAGELFEFRVDEEQVISG  317

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGES---GSPPTIPPNATLQFDVELLSWVSVKD  500
             D+ +  MKKGE  + TI P+  YG S   GS   IP N+TL +++EL S+V  KD
Sbjct  318  LDKAVSKMKKGEVSLITIDPEYGYGNSVTRGSLSLIPANSTLTYELELDSFVKEKD  373


 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 61/119 (51%), Gaps = 7/119 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V EG  W TP+  DEV V +   L DGT   ++   G  F+ T   G +   
Sbjct  139  DGGILKKIVAEGRNWATPKDDDEVLVRFEAKLEDGTVVATTPLAGVEFRVT--DGYLCPA  196

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + ++TMK+ E  I T+     +GE+G         IPPNA+L   +ELLSW  V  I
Sbjct  197  ISKAVRTMKREEKVILTVKSQYGFGEAGKKAHGNECAIPPNASLIISLELLSWRVVDYI  255



>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73
Length=356

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  135  KVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFT  314
            KVGEE EIG QGLKKKL+KEG GW+TPE GDEVEVHYTGTLLDG KFDSSRDR   FKF 
Sbjct  1    KVGEENEIGKQGLKKKLLKEGEGWDTPEVGDEVEVHYTGTLLDGKKFDSSRDRDDTFKFK  60

Query  315  LGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSV  494
            LGQGQVIKGWDQGIKTMKKGE  +FTIPP+LAYGESGSPPTIP NATLQFDVELLSW SV
Sbjct  61   LGQGQVIKGWDQGIKTMKKGENALFTIPPELAYGESGSPPTIPANATLQFDVELLSWTSV  120

Query  495  KDICK  509
            +DI K
Sbjct  121  RDIAK  125


 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 78/132 (59%), Gaps = 8/132 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  278
            DL+L     V ++G++K+I      KK++KE  G+E P  G  V V  TG L DGT F  
Sbjct  228  DLELVSWKTVTEIGDDKKI-----LKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLK  282

Query  279  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG--ESGSPPTIPPNA  452
               D   PF+F   +  VI+G D+ +  MKKGE  + TIPP+ AYG  ES     +PPN+
Sbjct  283  KGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNS  342

Query  453  TLQFDVELLSWV  488
            T+ ++VEL+S+V
Sbjct  343  TVIYEVELVSFV  354


 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 65/119 (55%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G +   
Sbjct  126  DGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEG----VEFTVKDGHLCPA  181

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDI  503
              + +KTMKKGE  +  + P   +GE G P       +PPNA+L  D+EL+SW +V +I
Sbjct  182  LAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEI  240



>gb|EMT19050.1| 70 kDa peptidyl-prolyl isomerase [Aegilops tauschii]
Length=676

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 108/154 (70%), Gaps = 27/154 (18%)
 Frame = +3

Query  129  VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  308
             MK GEE+ IG +GL+++L +EG G + P  GDEVEVHYTGTL DGTKFDSSRDR  PF+
Sbjct  57   AMKAGEERGIGKEGLRERLGREGEGPQLPGAGDEVEVHYTGTLADGTKFDSSRDRDAPFR  116

Query  309  FTLGQ---------------------------GQVIKGWDQGIKTMKKGECCIFTIPPDL  407
            FTLG+                           GQVIKGWD GIKTMK+GE  IFTIPP+L
Sbjct  117  FTLGRAYPHAKALFSVKPSLLSVGWKNKYIASGQVIKGWDLGIKTMKRGENAIFTIPPEL  176

Query  408  AYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  509
            AYGE GSPP IPPNATLQFDVELLSW SVKDICK
Sbjct  177  AYGEDGSPPVIPPNATLQFDVELLSWASVKDICK  210


 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 78/141 (55%), Gaps = 11/141 (8%)
 Frame = +3

Query  81   MPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGT  254
            +PP  M   DL L     V ++G +K I      KK+++EG G++ P+    V+V   G 
Sbjct  304  VPPNAMLQIDLQLVSWKTVTEIGNDKTI-----LKKILQEGEGYDRPKDCSTVKVKLIGK  358

Query  255  LLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP  431
            L DGT F     D   PF+F   + QVI+G D+ + +MKKGE    TIPP+ A+G   + 
Sbjct  359  LDDGTMFVKKGHDGEEPFEFKTDEDQVIEGLDKAVLSMKKGEVAFVTIPPEHAFGSDETK  418

Query  432  ---PTIPPNATLQFDVELLSW  485
                 +PPN T+ +DVEL+S+
Sbjct  419  QDLAVVPPNTTVYYDVELVSF  439


 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 64/119 (54%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D  + KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  211  DGSIFKKILAEGEKWENPKDCDEVFVKYEARLEDGTLITKS----DGIEFTVKEGHFCPA  266

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
              + +KTMKK E  + T+ P   +GE G P +     +PPNA LQ D++L+SW +V +I
Sbjct  267  ISKAVKTMKKNEKALLTVKPQYGFGEQGRPASRGEAAVPPNAMLQIDLQLVSWKTVTEI  325



>ref|XP_001769063.1| predicted protein [Physcomitrella patens]
 gb|EDQ66141.1| predicted protein [Physcomitrella patens]
Length=562

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 111/149 (74%), Gaps = 4/149 (3%)
 Frame = +3

Query  72   DFDMPPAEMDDLDLP--DDNPVMKVGEEKE-IGDQGLKKKLVKEGAGWETPEPGDEVEVH  242
            DFD+P AE  +      D +P   VG+ +E I   GL+K + K G GWETP+ GDEV VH
Sbjct  5    DFDIPDAEEVEETGEEVDYDP-QTVGKVQELIKGGGLQKLITKAGEGWETPDTGDEVSVH  63

Query  243  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  422
            YTGTLLDGTKFDSS DRG PF F LGQGQVIKGWD+G+ TMKKGE   FTI P+ AYGE+
Sbjct  64   YTGTLLDGTKFDSSLDRGQPFTFKLGQGQVIKGWDKGVATMKKGEKATFTISPENAYGEA  123

Query  423  GSPPTIPPNATLQFDVELLSWVSVKDICK  509
            GSPP IP NATL+FDVELL W SVKDICK
Sbjct  124  GSPPVIPANATLKFDVELLHWASVKDICK  152


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 67/117 (57%), Gaps = 4/117 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVIK  338
            D+ + KK++  G G+E P  G  V+V Y   L +GT F+ + +D    F+F   +GQVI 
Sbjct  273  DKKVIKKILTAGEGYEKPNDGSTVKVRYVAKLENGTIFEKNGQDGEELFQFVTDEGQVID  332

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  500
            G D+ + TMKK E  + TI P+  +G   +      +P N+TL +++EL+ ++  K+
Sbjct  333  GLDKAVLTMKKNEHALVTIYPEYGFGGEETKRDLAIVPANSTLFYEIELVEFIKEKE  389


 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 64/121 (53%), Gaps = 8/121 (7%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTL-LDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            D G+ KK+V EG  WE P+  DEV V Y   L    T    S + G   +FT+  G    
Sbjct  153  DGGIIKKIVTEGKKWENPKDLDEVLVKYEVRLQRHQTVVAKSPESGV--EFTVKDGHFCP  210

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
               Q +KTM KGE  + T+ P   +GE G+ P+     IP +A L+ ++EL+SW  V+++
Sbjct  211  AIGQAVKTMLKGEKALLTVKPRYGFGEKGAAPSGDVKAIPSDAVLEIELELISWKVVEEV  270

Query  504  C  506
             
Sbjct  271  T  271



>ref|XP_010244430.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Nelumbo nucifera]
Length=541

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            E+EIG QGL+K+++++G+ W TP PGDEVEVHY+G +  G  FDSSRDRGTPF+F LGQG
Sbjct  19   EREIGTQGLRKRIIQQGSSWLTPFPGDEVEVHYSGRVEGGLDFDSSRDRGTPFRFKLGQG  78

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKGWD G+ TM+KGE  IFTIPP+LAYGE  SPP IPPN+TL FDVE+LSW SV+D+
Sbjct  79   EVIKGWDDGVATMRKGERAIFTIPPELAYGEMVSPPMIPPNSTLIFDVEMLSWSSVRDL  137


 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 60/116 (52%), Gaps = 7/116 (6%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP+  DEV V Y   L DGT    S D     +F L  G +  
Sbjct  139  GDGGILKKIIKEGEGWSTPKDADEVLVKYEARLEDGTLISKSDD---GIEFHLSDGYLCP  195

Query  339  GWDQGIKTMKKGE----CCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSV  494
               + +KTM+KGE       F+   +   G + S  + PP + L   +EL+SW SV
Sbjct  196  AIAKAVKTMRKGEKAELSVRFSYGLEHGNGVTKSDCSFPPKSNLSVHLELVSWKSV  251


 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 59/101 (58%), Gaps = 2/101 (2%)
 Frame = +3

Query  195  GAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKG  374
            G G++ P  G   +V YTG L DGT F+ S+    PF+    +G++ +G D+ I TMKKG
Sbjct  268  GEGYDRPSEGSLAKVVYTGKLEDGTIFE-SKGSEEPFELMCFEGKIHEGLDRAITTMKKG  326

Query  375  ECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  497
            E  + TI PD  +  + S    P +ATL ++VEL+S+   K
Sbjct  327  EKALVTISPDYGFDNAVSKD-FPKSATLLYEVELISFTKEK  366



>ref|XP_006380967.1| hypothetical protein POPTR_0006s03190g [Populus trichocarpa]
 gb|ERP58764.1| hypothetical protein POPTR_0006s03190g [Populus trichocarpa]
Length=535

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            EK+IG QGL+KK+VK+G  W+TP PGDEVEVH+ G +  G   +SSRD+G PFKF LGQG
Sbjct  23   EKKIGSQGLRKKIVKKGNSWQTPFPGDEVEVHFNGYIEGGASLESSRDKGVPFKFKLGQG  82

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  506
            +VIKGWD+G+ TMK GE  IFT+PP+LAYGE+GSPP IPPNATL FDVE+LSW S++D+ 
Sbjct  83   EVIKGWDEGVATMKNGERAIFTVPPNLAYGEAGSPPLIPPNATLVFDVEMLSWSSIRDLT  142


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 64/113 (57%), Gaps = 1/113 (1%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD+ + KK+VK G G++ P  G  V+V Y G L DGT FD     G PF+F   + QV +
Sbjct  261  GDKKVLKKIVKAGEGFDRPTEGSHVKVTYVGKLEDGTVFDRKGTNGEPFEFITLEEQVNE  320

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  497
            G D+ I TMKKGE    T+     +G   S   +P N+ L ++VELL ++  K
Sbjct  321  GLDRAIMTMKKGEHATVTVDAKYLHGHDIS-GMLPANSMLHYEVELLDFIKEK  372


 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 60/121 (50%), Gaps = 8/121 (7%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KKL+KEG GW TP  GDEV V Y   +  G     S +     +F +G G +  
Sbjct  143  GDGGILKKLMKEGEGWATPRDGDEVLVKYEARIETGMLVSKSEE---GVEFHVGDGYLCP  199

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGS-----PPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE     +     + + G+        IPP + L   +EL+SW S+ D+
Sbjct  200  AVSRAVKTMRKGEKAELAVNLSYGFIQKGNLAPDIESNIPPYSNLTIQLELVSWRSITDV  259

Query  504  C  506
             
Sbjct  260  T  260



>ref|XP_011040721.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Populus 
euphratica]
Length=535

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            EK+IG +GL+KK+VK+G  W+TP PGDEVEVH+ G +  G   +SSRD+G PFKF LGQG
Sbjct  23   EKKIGIEGLRKKIVKKGNSWQTPFPGDEVEVHFNGYIEGGAILESSRDKGIPFKFKLGQG  82

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKGWD+G+ TMK GE  IFT+PP+LAYGE+GSPP IPPNATL FDVE+LSW S++D+
Sbjct  83   EVIKGWDEGVATMKNGERAIFTVPPNLAYGEAGSPPLIPPNATLVFDVEMLSWSSIRDL  141


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 63/113 (56%), Gaps = 1/113 (1%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD+ + KK+VK G G++ P  G  V+V Y G L DGT FD     G P +F   + QV +
Sbjct  261  GDKKVLKKIVKAGEGFDRPTEGSHVKVTYVGKLEDGTVFDRKGTNGEPCEFVTLEEQVNE  320

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  497
            G D+ I TMKKGE    T+     +G   S   +P N+ L ++VELL ++  K
Sbjct  321  GLDRAIMTMKKGEHATVTVDAKYLHGHDIS-GMLPANSRLHYEVELLDFIKEK  372


 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 60/120 (50%), Gaps = 8/120 (7%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP  GDEV V Y   +  G     S +     +F +G G +  
Sbjct  143  GDGGILKKIMKEGEGWATPRDGDEVLVKYEARIETGMLVSKSEE---GVEFHVGDGYLCP  199

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGS-----PPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE     +     + + G+        IPP + L   +EL+SW SV D+
Sbjct  200  ALSRAVKTMRKGEKAELAVKLYYGFIQKGNLAPDIESNIPPYSNLTIQLELVSWRSVTDV  259



>ref|XP_002982601.1| hypothetical protein SELMODRAFT_445274 [Selaginella moellendorffii]
 gb|EFJ16354.1| hypothetical protein SELMODRAFT_445274 [Selaginella moellendorffii]
Length=569

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = +3

Query  123  NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP  302
            + + K G EKE G  GLKK LV+ G GW+ P+PGDE+ VHY G   DGTKFDS+ D+  P
Sbjct  39   SAMQKEGVEKEFGQSGLKKLLVRAGQGWDVPKPGDELTVHYVGRFADGTKFDSTHDKNQP  98

Query  303  FKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLS  482
            F F LGQG+VI+GWD+GI +MKK E  +FTIPPD+AYG++G PP +PPNATL F+VELL+
Sbjct  99   FVFRLGQGEVIRGWDRGIGSMKKKEVAVFTIPPDMAYGKAGCPPLVPPNATLVFEVELLT  158

Query  483  WVSVKDICK  509
            W S+ D+ K
Sbjct  159  WASITDVLK  167


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 62/121 (51%), Gaps = 7/121 (6%)
 Frame = +3

Query  156  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  335
            + D G+ KK+V EG  WETP+  DEV V +T TL DGT  + +  +G         G   
Sbjct  166  LKDGGIVKKVVSEGHKWETPKDSDEVTVRFTATLQDGTLVEKTPAKGVT--ICPRDGFFC  223

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKD  500
                + ++ MK GE  + T+ P   + E G   T     +PP ATL  D+ELL W +V D
Sbjct  224  PAIGKAVRAMKHGEQALLTVTPQYGFAEQGRKATRSGAYVPPYATLTVDIELLEWRTVDD  283

Query  501  I  503
            +
Sbjct  284  V  284


 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 64/118 (54%), Gaps = 4/118 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVIK  338
            D+ + KK++  G G   P  G  V V Y   LLDGT F+     +    +FT+G+ Q + 
Sbjct  287  DRRVVKKILVAGEGQTKPNDGALVRVKYEARLLDGTVFERKGYGQDDLLEFTIGEEQAVS  346

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGES---GSPPTIPPNATLQFDVELLSWVSVKDI  503
            G D+ +  MKKGE    TI PD  YG S       T+PP++TL + VEL+S+   KDI
Sbjct  347  GLDRAVAAMKKGEVAEVTIAPDYGYGGSEFRTDLATVPPSSTLVYIVELVSFDKDKDI  404



>ref|XP_002993334.1| hypothetical protein SELMODRAFT_449100 [Selaginella moellendorffii]
 gb|EFJ05596.1| hypothetical protein SELMODRAFT_449100 [Selaginella moellendorffii]
Length=569

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = +3

Query  123  NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP  302
            + + K G EKE G  GLKK LV+ G GW+ P+PGDE+ VHY G   DGTKFDS+ D+  P
Sbjct  39   SAMQKEGVEKEFGQSGLKKLLVRAGQGWDVPKPGDELTVHYVGRFADGTKFDSTHDKNQP  98

Query  303  FKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLS  482
            F F LGQG+VI+GWD+GI +MKK E  +FTIPPD+AYG++G PP +PPNATL F+VELL+
Sbjct  99   FVFRLGQGEVIRGWDRGIGSMKKKEVAVFTIPPDMAYGKAGCPPLVPPNATLVFEVELLT  158

Query  483  WVSVKDICK  509
            W S+ D+ K
Sbjct  159  WASITDVLK  167


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 62/121 (51%), Gaps = 7/121 (6%)
 Frame = +3

Query  156  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  335
            + D G+ KK+V EG  WETP+  DEV V +T TL DGT  + +  +G         G   
Sbjct  166  LKDGGIVKKVVSEGHKWETPKDSDEVTVRFTATLQDGTLVEKTPAKGVT--ICPRDGFFC  223

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKD  500
                + ++ MK GE  + T+ P   + E G   T     +PP ATL  D+ELL W +V D
Sbjct  224  PAIGKAVRAMKHGEQALLTVTPQYGFAEQGRKATRSGAYVPPYATLTVDIELLEWRTVDD  283

Query  501  I  503
            +
Sbjct  284  V  284


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 64/118 (54%), Gaps = 4/118 (3%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVIK  338
            D+ + KK++  G G   P  G  V V Y   LLDGT F+     +    +FT+G+ Q + 
Sbjct  287  DRRVVKKILVAGEGQTKPNDGALVRVKYEARLLDGTVFERKGYGQDDLLEFTIGEEQAVS  346

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGES---GSPPTIPPNATLQFDVELLSWVSVKDI  503
            G D+ +  MKKGE    TI PD  YG S       T+PP++TL + VEL+S+   KDI
Sbjct  347  GLDRAVAAMKKGEVAEVTIAPDYGYGGSEFRTDLATVPPSSTLVYIVELVSFDKDKDI  404



>gb|KDP41599.1| hypothetical protein JCGZ_16006 [Jatropha curcas]
Length=601

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 99/131 (76%), Gaps = 1/131 (1%)
 Frame = +3

Query  117  DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRG  296
            +  P +KVGEE+EI + G+KKKL+K G GWETPE  DEV VHY GTLLDGTKFDS+RDRG
Sbjct  27   ESAPPLKVGEEREISNSGIKKKLLKRGLGWETPEFNDEVTVHYVGTLLDGTKFDSTRDRG  86

Query  297  TPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVEL  476
             P    LGQG VI G D GI +MKKGEC +FT+P +L YG SGS   +PPN+ + F+VEL
Sbjct  87   EPMTLKLGQGDVIAGLDHGIISMKKGECALFTVPAELGYGVSGS-DNVPPNSVVLFEVEL  145

Query  477  LSWVSVKDICK  509
            +SW++V D+ K
Sbjct  146  ISWITVVDVSK  156


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 69/136 (51%), Gaps = 9/136 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L    PV+ V      GD  + KK++KEG G      G  V + YT  L +GT F+ 
Sbjct  261  DLELVSFKPVVDV-----TGDAKVLKKILKEGEGTLVANEGAIVTIRYTARLQEGTVFEK  315

Query  282  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE---SGSPPTIPPN  449
               D   P +F   + QVI G D+   TMKKGE  + TI P+  +G          +PP+
Sbjct  316  KGLDGEHPLQFVTDEEQVIAGLDRAAATMKKGEQAVLTIHPEYGFGSIEVKRDLAIVPPS  375

Query  450  ATLQFDVELLSWVSVK  497
            + L ++VE+L ++  K
Sbjct  376  SVLVYEVEMLDFLKEK  391


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 7/119 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++K G   E P   DEV V Y  TL DGT    + + G   +F L  G +   
Sbjct  157  DGGIIKKIMKRGTRIERPGDMDEVHVKYEVTLADGTVVGQTPEEG--IEFHLKDGHLCPA  214

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDI  503
              + + TM++GE     + P   +GE     +G   ++P N+ L  D+EL+S+  V D+
Sbjct  215  LPKALITMRRGEKVKLIVQPQYGFGEEGMDANGGIHSVPQNSILNMDLELVSFKPVVDV  273



>ref|XP_011079092.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Sesamum 
indicum]
Length=531

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            E  IG +GL+KK+V++G  W+TP  GDEVEVHY   L +G  FDS+R++G PF+F LGQ 
Sbjct  26   ETVIGTRGLRKKIVRKGISWQTPVSGDEVEVHYNVKLQEGEYFDSTREKGAPFRFKLGQC  85

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  506
            +VI+GWD+GI TM+KGE  +FTIPP+LAYG++GSPP IPPNATL FD+EL+SW  V+DIC
Sbjct  86   EVIEGWDEGIATMRKGERAVFTIPPELAYGKTGSPPIIPPNATLIFDIELISWCPVRDIC  145


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 53/115 (46%), Gaps = 4/115 (3%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK+ +EG GW TP   DEV V Y     +G     S +     +F+L  G +  
Sbjct  146  GDGGILKKITREGEGWATPNDADEVLVKYIAKNENGVVISKSEE---GLEFSLTNGHLCP  202

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE     +         G     PP   L   +EL+SW +V D+
Sbjct  203  AMSRAVKTMRKGEKAELCVKFSYGLRHCGD-GIFPPYPDLIIHLELVSWKTVVDV  256


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 59/113 (52%), Gaps = 2/113 (2%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD  + KK++ +G  ++ P  G   +V Y G L DGT F+       PF++   + Q+ +
Sbjct  258  GDNKILKKIMNKGEAFDRPNEGSIAKVVYVGKLEDGTVFERRGSEEEPFEYMCAEEQIHE  317

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  497
            G D+ + TM+KGE  +  I  +  +  +     +   +++ +D++L+ +V  K
Sbjct  318  GLDRAVMTMRKGEEAVVKISSE--FLNAPKDERLSSASSVLYDIKLIDFVKEK  368



>ref|XP_010273188.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X3 [Nelumbo 
nucifera]
Length=435

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  108  DLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSR  287
            ++ +  P +KVGEE+EI   G+KKKL+K G GW+TPE GDEV VHY GTLLDGTKF+SSR
Sbjct  24   EVIESAPPLKVGEEREINSSGVKKKLLKRGQGWDTPEFGDEVTVHYVGTLLDGTKFNSSR  83

Query  288  DRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFD  467
            DR  PF F LG   ++ G DQGI TMKKGE  +FT+P +L YG  GS   +PPN+ +QF+
Sbjct  84   DRDEPFTFKLGHCPLVAGLDQGIITMKKGEVSLFTLPSNLGYGTKGS-DGVPPNSDIQFE  142

Query  468  VELLSWVSVKDICK  509
            VEL+SW++V DICK
Sbjct  143  VELISWITVVDICK  156


 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 77/145 (53%), Gaps = 11/145 (8%)
 Frame = +3

Query  81   MPPAEMDDLDLP--DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGT  254
            +PP  + ++DL      PV+ V      GD  + KK+++EG G  +   G  V + YTG 
Sbjct  252  IPPNSVLNIDLVLLSFKPVIDV-----TGDTKVLKKILREGEGTVSANDGAAVTIRYTGK  306

Query  255  LLDGTKFDSSRDRGT-PFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES---  422
            L DGT F+     G  P +F + + QVI G D+   TMKKGE CI TI P+  +G +   
Sbjct  307  LQDGTIFERKGFDGVGPLEFVIDEEQVILGLDRAAATMKKGELCIVTINPEYGFGNNEIE  366

Query  423  GSPPTIPPNATLQFDVELLSWVSVK  497
                 IPP +T+ ++VE++ +   K
Sbjct  367  RDLAVIPPCSTVVYEVEMVDFTREK  391


 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 62/119 (52%), Gaps = 7/119 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++++G   E P   DEV V Y   L+DGT    + + GT  +  +  G     
Sbjct  157  DGGIIKKILEKGERIEQPGDLDEVMVKYQAMLIDGTIVAKTPEEGT--ELHVKDGHFCPA  214

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDI  503
             ++ IKTMK+GE     +    A+GE+G       P IPPN+ L  D+ LLS+  V D+
Sbjct  215  LEKAIKTMKRGEKVKLIVESKYAFGENGRDASNGFPAIPPNSVLNIDLVLLSFKPVIDV  273



>ref|XP_009764942.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Nicotiana 
sylvestris]
Length=532

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            E  IG +GL KK++++G  W+TP PGDE++VHY+  L DG  FDSS D+G PF+F LGQG
Sbjct  23   ETVIGKEGLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQG  82

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKGWD+GI TMK+ E  IF IPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI
Sbjct  83   EVIKGWDEGIATMKRSERAIFIIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDI  141


 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 58/115 (50%), Gaps = 5/115 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP+  DE  V Y  +  DG     S D     +F+L    +  
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDD---GVEFSLLDDYLCP  199

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE    T+ P   Y   G    + PN  L   +EL+SW +V D+
Sbjct  200  AMKKSVKTMRKGEIAELTVKP--TYCFDGVENGMQPNLNLNIHLELISWKTVVDV  252


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT FD       P ++   +G+  +
Sbjct  254  GDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSE  313

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
              D+ I TM+KGE  I TI  D    E  S
Sbjct  314  SLDRAIMTMRKGEEAIVTISSDYCQVEEVS  343



>ref|XP_009764944.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X3 [Nicotiana 
sylvestris]
Length=531

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            E  IG +GL KK++++G  W+TP PGDE++VHY+  L DG  FDSS D+G PF+F LGQG
Sbjct  23   ETVIGKEGLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQG  82

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKGWD+GI TMK+ E  IF IPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI
Sbjct  83   EVIKGWDEGIATMKRSERAIFIIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDI  141


 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 58/115 (50%), Gaps = 5/115 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP+  DE  V Y  +  DG     S D     +F+L    +  
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDD---GVEFSLLDDYLCP  199

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE    T+ P   Y   G    + PN  L   +EL+SW +V D+
Sbjct  200  AMKKSVKTMRKGEIAELTVKP--TYCFDGVENGMQPNLNLNIHLELISWKTVVDV  252


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT FD       P ++   +G+  +
Sbjct  254  GDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSE  313

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
              D+ I TM+KGE  I TI  D    E  S
Sbjct  314  SLDRAIMTMRKGEEAIVTISSDYCQVEEVS  343



>ref|XP_009596526.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like isoform 
X3 [Nicotiana tomentosiformis]
Length=414

 Score =   166 bits (421),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            E  IG +GL+KK++++G  W+TP PGDE++VHY   + DG   DSS D+G PF+F LGQG
Sbjct  24   ETVIGKEGLRKKILQKGNSWKTPLPGDEIQVHYNVKIEDGEILDSSHDKGKPFEFKLGQG  83

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKGWD+GI TMKK E  IFTIPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI
Sbjct  84   EVIKGWDEGIATMKKSERAIFTIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDI  142


 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 62/115 (54%), Gaps = 5/115 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP+  DEV V Y  +  DG    SS D     +F+L  G +  
Sbjct  144  GDGGILKKIIKEGEGWATPKDVDEVLVKYIASSADGKTLSSSDD---GVEFSLLDGYLYP  200

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE    T+ P  AY   G    + PN  L   +EL+SW +V D+
Sbjct  201  AMTKSVKTMRKGEIAELTVKP--AYYFDGVENGMQPNLNLTIHLELISWKTVVDV  253


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVI  335
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT F+        PF++   +GQ  
Sbjct  255  GDKKVLKKLIKAGEGYDRPNEGSLVKVVYIGKLQDGTVFERKGLSDEDPFEYVCLEGQFN  314

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAY  413
            +G D+ I TM+KGE  I TI  D  +
Sbjct  315  EGLDRAIMTMRKGEEAIVTISSDYFH  340



>ref|XP_009764948.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like isoform 
X6 [Nicotiana sylvestris]
Length=398

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            E  IG +GL KK++++G  W+TP PGDE++VHY+  L DG  FDSS D+G PF+F LGQG
Sbjct  23   ETVIGKEGLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQG  82

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKGWD+GI TMK+ E  IF IPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI
Sbjct  83   EVIKGWDEGIATMKRSERAIFIIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDI  141


 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 58/115 (50%), Gaps = 5/115 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP+  DE  V Y  +  DG     S D     +F+L    +  
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDD---GVEFSLLDDYLCP  199

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE    T+ P   Y   G    + PN  L   +EL+SW +V D+
Sbjct  200  AMKKSVKTMRKGEIAELTVKP--TYCFDGVENGMQPNLNLNIHLELISWKTVVDV  252


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT FD       P ++   +G+  +
Sbjct  254  GDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSE  313

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
              D+ I TM+KGE  I TI  D    E  S
Sbjct  314  SLDRAIMTMRKGEEAIVTISSDYCQVEEVS  343



>ref|XP_009764943.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Nicotiana 
sylvestris]
Length=532

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            E  IG +GL KK++++G  W+TP PGDE++VHY+  L DG  FDSS D+G PF+F LGQG
Sbjct  23   ETVIGKEGLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQG  82

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKGWD+GI TMK+ E  IF IPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI
Sbjct  83   EVIKGWDEGIATMKRSERAIFIIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDI  141


 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 58/115 (50%), Gaps = 5/115 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP+  DE  V Y  +  DG     S D     +F+L    +  
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDD---GVEFSLLDDYLCP  199

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE    T+ P   Y   G    + PN  L   +EL+SW +V D+
Sbjct  200  AMKKSVKTMRKGEIAELTVKP--TYCFDGVENGMQPNLNLNIHLELISWKTVVDV  252


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT FD       P ++   +G+  +
Sbjct  254  GDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSE  313

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
              D+ I TM+KGE  I TI  D    E  S
Sbjct  314  SLDRAIMTMRKGEEAIVTISSDYCQVEEVS  343



>ref|XP_009764947.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like isoform 
X5 [Nicotiana sylvestris]
Length=408

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            E  IG +GL KK++++G  W+TP PGDE++VHY+  L DG  FDSS D+G PF+F LGQG
Sbjct  23   ETVIGKEGLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQG  82

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKGWD+GI TMK+ E  IF IPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI
Sbjct  83   EVIKGWDEGIATMKRSERAIFIIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDI  141


 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 58/115 (50%), Gaps = 5/115 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP+  DE  V Y  +  DG     S D     +F+L    +  
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDD---GVEFSLLDDYLCP  199

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE    T+ P   Y   G    + PN  L   +EL+SW +V D+
Sbjct  200  AMKKSVKTMRKGEIAELTVKP--TYCFDGVENGMQPNLNLNIHLELISWKTVVDV  252


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT FD       P ++   +G+  +
Sbjct  254  GDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSE  313

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
              D+ I TM+KGE  I TI  D    E  S
Sbjct  314  SLDRAIMTMRKGEEAIVTISSDYCQVEEVS  343



>ref|XP_009596524.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=531

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            E  IG +GL+KK++++G  W+TP PGDE++VHY   + DG   DSS D+G PF+F LGQG
Sbjct  24   ETVIGKEGLRKKILQKGNSWKTPLPGDEIQVHYNVKIEDGEILDSSHDKGKPFEFKLGQG  83

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKGWD+GI TMKK E  IFTIPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI
Sbjct  84   EVIKGWDEGIATMKKSERAIFTIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDI  142


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 62/115 (54%), Gaps = 5/115 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP+  DEV V Y  +  DG    SS D     +F+L  G +  
Sbjct  144  GDGGILKKIIKEGEGWATPKDVDEVLVKYIASSADGKTLSSSDD---GVEFSLLDGYLYP  200

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE    T+ P  AY   G    + PN  L   +EL+SW +V D+
Sbjct  201  AMTKSVKTMRKGEIAELTVKP--AYYFDGVENGMQPNLNLTIHLELISWKTVVDV  253


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVI  335
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT F+        PF++   +GQ  
Sbjct  255  GDKKVLKKLIKAGEGYDRPNEGSLVKVVYIGKLQDGTVFERKGLSDEDPFEYVCLEGQFN  314

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAY  413
            +G D+ I TM+KGE  I TI  D  +
Sbjct  315  EGLDRAIMTMRKGEEAIVTISSDYFH  340



>ref|XP_009596525.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=530

 Score =   168 bits (425),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            E  IG +GL+KK++++G  W+TP PGDE++VHY   + DG   DSS D+G PF+F LGQG
Sbjct  24   ETVIGKEGLRKKILQKGNSWKTPLPGDEIQVHYNVKIEDGEILDSSHDKGKPFEFKLGQG  83

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKGWD+GI TMKK E  IFTIPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI
Sbjct  84   EVIKGWDEGIATMKKSERAIFTIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDI  142


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 62/115 (54%), Gaps = 5/115 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP+  DEV V Y  +  DG    SS D     +F+L  G +  
Sbjct  144  GDGGILKKIIKEGEGWATPKDVDEVLVKYIASSADGKTLSSSDD---GVEFSLLDGYLYP  200

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE    T+ P  AY   G    + PN  L   +EL+SW +V D+
Sbjct  201  AMTKSVKTMRKGEIAELTVKP--AYYFDGVENGMQPNLNLTIHLELISWKTVVDV  253


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVI  335
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT F+        PF++   +GQ  
Sbjct  255  GDKKVLKKLIKAGEGYDRPNEGSLVKVVYIGKLQDGTVFERKGLSDEDPFEYVCLEGQFN  314

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAY  413
            +G D+ I TM+KGE  I TI  D  +
Sbjct  315  EGLDRAIMTMRKGEEAIVTISSDYFH  340



>ref|XP_009764945.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X4 [Nicotiana 
sylvestris]
Length=525

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            E  IG +GL KK++++G  W+TP PGDE++VHY+  L DG  FDSS D+G PF+F LGQG
Sbjct  23   ETVIGKEGLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQG  82

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKGWD+GI TMK+ E  IF IPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI
Sbjct  83   EVIKGWDEGIATMKRSERAIFIIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDI  141


 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 58/115 (50%), Gaps = 5/115 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP+  DE  V Y  +  DG     S D     +F+L    +  
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDD---GVEFSLLDDYLCP  199

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE    T+ P   Y   G    + PN  L   +EL+SW +V D+
Sbjct  200  AMKKSVKTMRKGEIAELTVKP--TYCFDGVENGMQPNLNLNIHLELISWKTVVDV  252


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT FD       P ++   +G+  +
Sbjct  254  GDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSE  313

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
              D+ I TM+KGE  I TI  D    E  S
Sbjct  314  SLDRAIMTMRKGEEAIVTISSDYCQVEEVS  343



>ref|XP_009764949.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X7 [Nicotiana 
sylvestris]
Length=524

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            E  IG +GL KK++++G  W+TP PGDE++VHY+  L DG  FDSS D+G PF+F LGQG
Sbjct  23   ETVIGKEGLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQG  82

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKGWD+GI TMK+ E  IF IPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI
Sbjct  83   EVIKGWDEGIATMKRSERAIFIIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDI  141


 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 58/115 (50%), Gaps = 5/115 (4%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP+  DE  V Y  +  DG     S D     +F+L    +  
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDD---GVEFSLLDDYLCP  199

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE    T+ P   Y   G    + PN  L   +EL+SW +V D+
Sbjct  200  AMKKSVKTMRKGEIAELTVKP--TYCFDGVENGMQPNLNLNIHLELISWKTVVDV  252


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT FD       P ++   +G+  +
Sbjct  254  GDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSE  313

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
              D+ I TM+KGE  I TI  D    E  S
Sbjct  314  SLDRAIMTMRKGEEAIVTISSDYCQVEEVS  343



>ref|XP_010273182.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = +3

Query  126  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  305
            P +KVGEE+EI   G+KKKL+K G GW+TPE GDEV VHY GTLLDGTKF+SSRDR  PF
Sbjct  30   PPLKVGEEREINSSGVKKKLLKRGQGWDTPEFGDEVTVHYVGTLLDGTKFNSSRDRDEPF  89

Query  306  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  485
             F LG   ++ G DQGI TMKKGE  +FT+P +L YG  GS   +PPN+ +QF+VEL+SW
Sbjct  90   TFKLGHCPLVAGLDQGIITMKKGEVSLFTLPSNLGYGTKGS-DGVPPNSDIQFEVELISW  148

Query  486  VSVKDICK  509
            ++V DICK
Sbjct  149  ITVVDICK  156


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 77/145 (53%), Gaps = 11/145 (8%)
 Frame = +3

Query  81   MPPAEMDDLDLP--DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGT  254
            +PP  + ++DL      PV+ V      GD  + KK+++EG G  +   G  V + YTG 
Sbjct  252  IPPNSVLNIDLVLLSFKPVIDV-----TGDTKVLKKILREGEGTVSANDGAAVTIRYTGK  306

Query  255  LLDGTKFDSSRDRGT-PFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES---  422
            L DGT F+     G  P +F + + QVI G D+   TMKKGE CI TI P+  +G +   
Sbjct  307  LQDGTIFERKGFDGVGPLEFVIDEEQVILGLDRAAATMKKGELCIVTINPEYGFGNNEIE  366

Query  423  GSPPTIPPNATLQFDVELLSWVSVK  497
                 IPP +T+ ++VE++ +   K
Sbjct  367  RDLAVIPPCSTVVYEVEMVDFTREK  391


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 62/119 (52%), Gaps = 7/119 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++++G   E P   DEV V Y   L+DGT    + + GT  +  +  G     
Sbjct  157  DGGIIKKILEKGERIEQPGDLDEVMVKYQAMLIDGTIVAKTPEEGT--ELHVKDGHFCPA  214

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDI  503
             ++ IKTMK+GE     +    A+GE+G       P IPPN+ L  D+ LLS+  V D+
Sbjct  215  LEKAIKTMKRGEKVKLIVESKYAFGENGRDASNGFPAIPPNSVLNIDLVLLSFKPVIDV  273



>ref|XP_002499621.1| fkbp-type peptidyl-prolyl cis-trans isomerase [Micromonas sp. 
RCC299]
 gb|ACO60879.1| fkbp-type peptidyl-prolyl cis-trans isomerase [Micromonas sp. 
RCC299]
Length=577

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 102/146 (70%), Gaps = 6/146 (4%)
 Frame = +3

Query  66   MEDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHY  245
            M+ FD    E  DLD+ ++  V          D G+ KK++ +G G E PE GDEV VHY
Sbjct  12   MDGFDEDEIEYPDLDVDEEADVSTAK------DGGVTKKVLAKGTGDERPEKGDEVVVHY  65

Query  246  TGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG  425
            TGTLLDGTKFDSS DRG PFKF LG GQVIKGWDQG+ +MKKGE  I T  PD AYGE G
Sbjct  66   TGTLLDGTKFDSSVDRGDPFKFRLGLGQVIKGWDQGVASMKKGEKAILTCKPDYAYGERG  125

Query  426  SPPTIPPNATLQFDVELLSWVSVKDI  503
            SPPTIP N+TL+F+VEL SW S KD+
Sbjct  126  SPPTIPANSTLKFEVELFSWKSDKDL  151



>emb|CBI32825.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = +3

Query  153  EIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQV  332
            +IG QGL+K++++ G  W TP PGDEV+VHY+G +  G  FDSSRDRG PF F LGQ +V
Sbjct  10   DIGSQGLRKRILQMGHSWLTPFPGDEVQVHYSGRVEGGAYFDSSRDRGAPFWFKLGQCEV  69

Query  333  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            IKGW++G+ TMKKGE  IFTIPPDLAYGE+G PP IPPN+TL +D+E+LSW +++D+
Sbjct  70   IKGWEEGVATMKKGERAIFTIPPDLAYGETGLPPLIPPNSTLIYDIEMLSWNTIRDL  126


 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 66/120 (55%), Gaps = 8/120 (7%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++ EG GW TP+ GDEV V Y   L +GT+  S  D G+  +F LG      
Sbjct  128  GDGGILKKIMTEGEGWATPKDGDEVLVKYEVRLENGTEV-SKCDEGS--EFHLGDDLPCP  184

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
               + +KTM++GE    ++     + + G+  T     IPPN+ L   +EL+SW SV DI
Sbjct  185  AISKAVKTMRRGEKAELSVRFSYGFKQIGNEVTRTDGAIPPNSNLIICLELISWKSVIDI  244


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 60/110 (55%), Gaps = 4/110 (4%)
 Frame = +3

Query  156  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  335
            +GD+ + KK++K G G++ P  G   +V Y G L +GT F+    R  P +    + Q+ 
Sbjct  245  MGDKKVLKKIMKVGEGFDRPSEGSLAKVAYIGKLENGTVFERKGSREEPLELLCFEEQIN  304

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  485
            +G D+ I TM+KGE  + TI  D  +  SG    +  N+   ++VEL+ +
Sbjct  305  EGLDRAIMTMRKGEQALVTIQAD-GHEVSG---MVSANSLHHYEVELIDF  350



>ref|XP_006364803.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Solanum 
tuberosum]
Length=536

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 103/141 (73%), Gaps = 5/141 (4%)
 Frame = +3

Query  96   MDDLDLPDDNPV---MKVGEEKEI--GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  260
            M D +    N V    K+ E +EI  G +GL+KK++++G  W+TP  GDE++VHY   L 
Sbjct  1    MGDFNSKKSNKVNFETKIQELQEIVIGKEGLRKKILQKGNSWKTPFHGDEIQVHYRVKLQ  60

Query  261  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI  440
            DG  FDSS DRG PF F LGQG+VIKGWD+GI TMKK E  IFTIPP+LAYGE GSPP I
Sbjct  61   DGEFFDSSYDRGKPFTFKLGQGEVIKGWDEGIATMKKSERAIFTIPPNLAYGEIGSPPLI  120

Query  441  PPNATLQFDVELLSWVSVKDI  503
            PPN+TL F++EL+SW S++DI
Sbjct  121  PPNSTLIFEIELISWNSIRDI  141


 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 58/115 (50%), Gaps = 3/115 (3%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP   DEV V Y  +  DG       D     +F+L +G +  
Sbjct  143  GDGGILKKIIKEGQGWATPRDVDEVLVKYVASSADGIILSQYDD---AVEFSLMEGHLYP  199

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE    T+ P   +   G       N+ L   +EL+SW SV D+
Sbjct  200  AMKKSLKTMRKGEIVELTVKPACNFDGDGIGILQSSNSNLIIHLELISWKSVVDV  254


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +3

Query  156  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  335
            IGD  + KKL+K G G++ P  G   +V Y G L DGT F+       PF++   +GQ+ 
Sbjct  255  IGDNKVLKKLIKAGEGYDHPNEGSLAKVIYIGKLQDGTIFERKGSDEEPFEYVCLEGQLN  314

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGE  419
            +  D+ I TMKKGE  I TI  D  + E
Sbjct  315  ENLDRAIMTMKKGEEAIVTINSDSMFYE  342



>gb|EYU20825.1| hypothetical protein MIMGU_mgv1a004220mg [Erythranthe guttata]
Length=538

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            E  IG +GL K+++++G  W+TP PGDEVEVHY+ +L     FDSSRD+GTPF+F LGQG
Sbjct  23   EAIIGPKGLSKRILEKGISWQTPTPGDEVEVHYSVSLQGAEYFDSSRDKGTPFRFKLGQG  82

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKGWD+GI TM+K E  IFTIPP+L YGE GSPP +PPN+TL FDV+L+SW  ++DI
Sbjct  83   EVIKGWDEGIATMRKNERAIFTIPPELGYGEIGSPPLVPPNSTLVFDVQLISWYPIRDI  141


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 7/120 (6%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++ EG GW TP   DEV V+Y     +G     S + G   +F+L  G +  
Sbjct  143  GDGGIIKKIISEGKGWATPNESDEVFVNYVAECENGVVISKSDEEG--LEFSLISGHLCP  200

Query  339  GWDQGIKTMKKGECCIFTIPPD--LAYGESGSPPT---IPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE    ++     L Y E  +      +P    L   +EL++W +V DI
Sbjct  201  AMSKAVKTMRKGEKAELSVKFSYGLIYCEDETSKIDDLVPTCPNLIIHLELVNWRTVVDI  260


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 43/83 (52%), Gaps = 0/83 (0%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD+ + KK+ K G  ++ P  G  V+V Y G L DGT  +       PF++   + ++  
Sbjct  262  GDKNILKKITKNGEAFDHPNEGSLVKVVYIGKLEDGTVLERRGSDEEPFEYICAEEKIHG  321

Query  339  GWDQGIKTMKKGECCIFTIPPDL  407
            G D+ + TMKKGE  I  I  D 
Sbjct  322  GLDRAVMTMKKGEEAIVKISADF  344



>ref|XP_002947775.1| hypothetical protein VOLCADRAFT_103560 [Volvox carteri f. nagariensis]
 gb|EFJ51308.1| hypothetical protein VOLCADRAFT_103560 [Volvox carteri f. nagariensis]
Length=617

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 96/137 (70%), Gaps = 6/137 (4%)
 Frame = +3

Query  99   DDLDLPDDNPVMKVGEEKEIGDQG-LKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF  275
            DD D  D+     VG+E  + D G L KK++  G  WETPE GDEV VHY GTL DG+KF
Sbjct  43   DDFDYGDE-----VGKEVPLTDDGGLIKKIITAGESWETPEAGDEVTVHYVGTLEDGSKF  97

Query  276  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNAT  455
            DSSRDR  PF FTLGQG+VIKGWD G+  MKKGE  +    P+ AYG  GSPP IPPNAT
Sbjct  98   DSSRDRDEPFVFTLGQGRVIKGWDLGVAKMKKGETALLICKPEYAYGAQGSPPKIPPNAT  157

Query  456  LQFDVELLSWVSVKDIC  506
            L F+VELLSW SVKDI 
Sbjct  158  LHFEVELLSWRSVKDIA  174


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 6/105 (6%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDG-TKFDSSRDRGTPFKFTLGQGQVI  335
            GD G+ K ++ EG+GW T E   E +V YT  +    T F +S D      FT+ +G +I
Sbjct  175  GDGGVIKTVLTEGSGWATCEDQFEAKVSYTARVSGSETPFATSDDT----LFTVSEGHLI  230

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-IPPNATLQFD  467
                  +KTMKKGE     + P   +GE+GS    +PPNA L+ +
Sbjct  231  PAVRVALKTMKKGEKVALKVKPAYGFGEAGSEQYGVPPNADLEVE  275


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 54/113 (48%), Gaps = 5/113 (4%)
 Frame = +3

Query  177  KKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGI  356
            K L+     +  P  G +V V   G +L         + G+   FT G+ QV +G +  +
Sbjct  286  KTLLSNDKEFRKPNEGAKVTVRLVGEVLPNGPVFVRHEEGSELVFTTGEEQVCEGLEAAV  345

Query  357  KTMKKGECCIFTIP-PDLAYG----ESGSPPTIPPNATLQFDVELLSWVSVKD  500
              MK+G+  + TI  P   YG     +G    +PP + LQFDVEL+ + + K+
Sbjct  346  MKMKEGDKALVTINDPAQGYGFETEYAGPLAVVPPGSALQFDVELVQFENSKE  398



>ref|XP_010653645.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Vitis vinifera]
Length=517

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = +3

Query  153  EIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQV  332
            +IG QGL+K++++ G  W TP PGDEV+VHY+G +  G  FDSSRDRG PF F LGQ +V
Sbjct  10   DIGSQGLRKRILQMGHSWLTPFPGDEVQVHYSGRVEGGAYFDSSRDRGAPFWFKLGQCEV  69

Query  333  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            IKGW++G+ TMKKGE  IFTIPPDLAYGE+G PP IPPN+TL +D+E+LSW +++D+
Sbjct  70   IKGWEEGVATMKKGERAIFTIPPDLAYGETGLPPLIPPNSTLIYDIEMLSWNTIRDL  126


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 66/120 (55%), Gaps = 8/120 (7%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++ EG GW TP+ GDEV V Y   L +GT+  S  D G+  +F LG      
Sbjct  128  GDGGILKKIMTEGEGWATPKDGDEVLVKYEVRLENGTEV-SKCDEGS--EFHLGDDLPCP  184

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
               + +KTM++GE    ++     + + G+  T     IPPN+ L   +EL+SW SV DI
Sbjct  185  AISKAVKTMRRGEKAELSVRFSYGFKQIGNEVTRTDGAIPPNSNLIICLELISWKSVIDI  244


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 60/110 (55%), Gaps = 4/110 (4%)
 Frame = +3

Query  156  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  335
            +GD+ + KK++K G G++ P  G   +V Y G L +GT F+    R  P +    + Q+ 
Sbjct  245  MGDKKVLKKIMKVGEGFDRPSEGSLAKVAYIGKLENGTVFERKGSREEPLELLCFEEQIN  304

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  485
            +G D+ I TM+KGE  + TI  D  +  SG    +  N+   ++VEL+ +
Sbjct  305  EGLDRAIMTMRKGEQALVTIQAD-GHEVSG---MVSANSLHHYEVELIDF  350



>ref|XP_010061642.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Eucalyptus 
grandis]
 gb|KCW68629.1| hypothetical protein EUGRSUZ_F02235 [Eucalyptus grandis]
Length=608

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +3

Query  108  DLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSR  287
            ++ D  P MKVGEE+ +G  GL KKL++ G GWETPE GDE  VH+  TL DGT FDSSR
Sbjct  24   EVIDSAPPMKVGEERPLGRTGLAKKLLRHGRGWETPELGDEAAVHFVATLTDGTLFDSSR  83

Query  288  DRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFD  467
            DR  P    LGQGQ++ G D GI TMK+GEC +FT+PP+L YG  G    +PPNA ++F+
Sbjct  84   DRDEPLTLKLGQGQLVSGLDHGIITMKEGECALFTVPPELGYGAVGR-EGVPPNAAVRFE  142

Query  468  VELLSWVSVKDICK  509
            VEL+SW+ V DICK
Sbjct  143  VELISWIRVVDICK  156


 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 70/143 (49%), Gaps = 11/143 (8%)
 Frame = +3

Query  78   DMPPAEMDDLDLP--DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTG  251
            ++PP  + D+DL      PV+ V      GD  + KK++KEG G  T   G  V + Y  
Sbjct  251  NVPPNSILDVDLELVSFKPVIDV-----TGDGKVLKKILKEGEGAFTANEGAAVTISYAA  305

Query  252  TLLDGTKFDSS-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE---  419
             L DGT F+    D   P  F   + QVI G D+   TMKKGE  + TI  +  +G    
Sbjct  306  RLEDGTVFEKKGLDGEQPLNFVTDEEQVIAGLDRASATMKKGELAMVTINHEYGFGSVEV  365

Query  420  SGSPPTIPPNATLQFDVELLSWV  488
                  +PP + L ++VE+L ++
Sbjct  366  EQDLAIVPPCSDLIYEVEMLDFI  388


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 7/119 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++ +G   E P   DEV V Y   L DGT    + + G  F+F +  G +   
Sbjct  157  DGGIVKKILVKGERNEQPSDLDEVLVKYRVALPDGTIIAEAPEEG--FEFYVKDGHLCPA  214

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDI  503
            + + + TMKKGE     I P  A+G+     S     +PPN+ L  D+EL+S+  V D+
Sbjct  215  FSKAVMTMKKGERVKLLIQPQYAFGDKKFGNSDQLHNVPPNSILDVDLELVSFKPVIDV  273



>gb|KJB53362.1| hypothetical protein B456_009G2211001 [Gossypium raimondii]
Length=397

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = +3

Query  126  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  305
            P +KVGEE+E+G+ G+KKKL+  G  WETPE GDEV VH+ GTLL+G KF S+RD G P 
Sbjct  32   PPLKVGEERELGNSGIKKKLLNNGIHWETPEFGDEVTVHFVGTLLNGIKFCSTRDNGEPM  91

Query  306  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  485
             F LG+G+V KG D GI TMKKGE  +FT+PPD  YG  G    +PP++ +QFDVELLSW
Sbjct  92   TFKLGEGKVAKGLDNGITTMKKGERVLFTLPPDFGYGAEGR-DGVPPDSIVQFDVELLSW  150

Query  486  VSVKDICK  509
            ++V DICK
Sbjct  151  ITVVDICK  158


 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 71/139 (51%), Gaps = 9/139 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            +L+L    PV+ V      GD  + KK++KEG G      G  V + Y   L DGT F+ 
Sbjct  263  ELELVSFKPVIDV-----TGDSKVFKKILKEGEGALVANEGAAVTISYIAWLEDGTVFER  317

Query  282  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
               D G P +F   + QVI G D+   TMKKGE  + T+ P+  +G   +      +PP+
Sbjct  318  KGVDGGQPLEFITDEEQVIPGLDRAAATMKKGEQALLTVSPEYGFGSVVAERDLAVVPPS  377

Query  450  ATLQFDVELLSWVSVKDIC  506
            + L ++VE+L +V V  + 
Sbjct  378  SNLVYEVEMLDFVKVTTVA  396


 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 63/120 (53%), Gaps = 7/120 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++++G   E P   DEV V Y   L DGT    + + G  ++F +  G +   
Sbjct  159  DGGIIKKIMEKGERNERPSDLDEVLVKYQVALADGTIVAKASEEG--YEFYVKDGHLFPA  216

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDIC  506
              + I TMK+GE     + P  A+G+ G       P+IPPN+ L  ++EL+S+  V D+ 
Sbjct  217  LTKAIVTMKRGEKVKLIVQPKYAFGDKGKEATDGFPSIPPNSVLNVELELVSFKPVIDVT  276



>gb|KDP24694.1| hypothetical protein JCGZ_26469 [Jatropha curcas]
Length=476

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            EK+IG+ GL+KK++K+G  W+TP PGDEVEVH++G +  G   DS+RD+G PF F LGQG
Sbjct  24   EKKIGNDGLRKKILKKGISWQTPFPGDEVEVHFSGHVEGGASLDSTRDKGVPFCFKLGQG  83

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKG D GI TMKKGE   FT+PP L YGE+GSPP IP NATL FD+E+LSW +++D+
Sbjct  84   EVIKGLDDGIATMKKGERATFTVPPKLGYGEAGSPPLIPSNATLVFDIEMLSWSTIRDL  142


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 7/119 (6%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP  GD+V V Y   L +G     S       +F +G+  +  
Sbjct  144  GDGGILKKIIKEGEGWATPRDGDKVLVKYEARLENGLLVSKSDQDA---EFHVGESYLSP  200

Query  339  GWDQGIKTMKKGECCIFTIPPDLAY----GESGSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM++GE     +     +     E+G  P+I  ++ L   +EL+SW SV DI
Sbjct  201  ALGKAVKTMRRGEKAELAVKCSYGFIQNGNEAGIDPSILSDSNLTIQLELVSWRSVIDI  259


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 48/87 (55%), Gaps = 0/87 (0%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD+ + K +VK G G+E P  G +V+V Y G L DG   +       PF+F   +GQV +
Sbjct  261  GDKKVLKTIVKAGEGFERPNEGSQVKVTYIGKLEDGVVVEKKGTIEEPFEFKTLEGQVNE  320

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGE  419
            G D+ + +MK+GE  + T+  +   G 
Sbjct  321  GLDRAVMSMKRGEDALVTVSAEYLSGH  347



>ref|XP_003520475.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like isoform 
X1 [Glycine max]
 gb|KHN12184.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Glycine soja]
Length=540

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  150  KEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQ  329
            KEIG++GL K+++++G  W+TP  GDEVEVH+ G + +G   +SS D+G+PF+F LGQ +
Sbjct  27   KEIGNEGLTKRILRKGVTWQTPFSGDEVEVHFNGQVENGASLESSYDKGSPFRFKLGQCE  86

Query  330  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            VIKGWD+G+ TMKKGE  IF IPP+LAYGE GS P IPPNATL FD+E+LSW S++D+
Sbjct  87   VIKGWDEGVATMKKGERAIFKIPPNLAYGEEGSLPLIPPNATLIFDIEMLSWSSIRDL  144


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 62/123 (50%), Gaps = 13/123 (11%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+KKK+++EG GW TP   DEV V Y   L +G    S  D+G   +F +  G +  
Sbjct  146  GDGGVKKKIIREGEGWATPREADEVLVKYEARLENGM-LVSKSDQGV--EFNVSDGYLCP  202

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI-------PPNATL-QFDVELLSWVSV  494
                 +KTM+KGE  +  +     YG S +   I       PP++ L    +EL+SW  V
Sbjct  203  AMSIAVKTMRKGE--VAELAMRFCYGLSQNSSRITELEGVLPPDSNLTSIKLELVSWKIV  260

Query  495  KDI  503
             D+
Sbjct  261  ADV  263


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 59/113 (52%), Gaps = 0/113 (0%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD+ + KK+   G G++ P  G +V+V Y     DGT  +S      PF+FT  + QV +
Sbjct  265  GDKKILKKIKNLGEGFDRPNEGSQVKVIYLCKGEDGTIIESKGSEEEPFEFTTQEEQVPE  324

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  497
            G ++ I TMKKGE  + T+  +     + S      N  L ++VEL+ +V  K
Sbjct  325  GLERAIMTMKKGEQALVTVDAEYLCDYNNSKGNTANNKVLYYEVELVDFVKEK  377



>gb|KJB53364.1| hypothetical protein B456_009G2211001, partial [Gossypium raimondii]
Length=391

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = +3

Query  126  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  305
            P +KVGEE+E+G+ G+KKKL+  G  WETPE GDEV VH+ GTLL+G KF S+RD G P 
Sbjct  32   PPLKVGEERELGNSGIKKKLLNNGIHWETPEFGDEVTVHFVGTLLNGIKFCSTRDNGEPM  91

Query  306  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  485
             F LG+G+V KG D GI TMKKGE  +FT+PPD  YG  G    +PP++ +QFDVELLSW
Sbjct  92   TFKLGEGKVAKGLDNGITTMKKGERVLFTLPPDFGYGAEGR-DGVPPDSIVQFDVELLSW  150

Query  486  VSVKDICK  509
            ++V DICK
Sbjct  151  ITVVDICK  158


 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 69/133 (52%), Gaps = 9/133 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            +L+L    PV+ V      GD  + KK++KEG G      G  V + Y   L DGT F+ 
Sbjct  263  ELELVSFKPVIDV-----TGDSKVFKKILKEGEGALVANEGAAVTISYIAWLEDGTVFER  317

Query  282  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
               D G P +F   + QVI G D+   TMKKGE  + T+ P+  +G   +      +PP+
Sbjct  318  KGVDGGQPLEFITDEEQVIPGLDRAAATMKKGEQALLTVSPEYGFGSVVAERDLAVVPPS  377

Query  450  ATLQFDVELLSWV  488
            + L ++VE+L +V
Sbjct  378  SNLVYEVEMLDFV  390


 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 63/120 (53%), Gaps = 7/120 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++++G   E P   DEV V Y   L DGT    + + G  ++F +  G +   
Sbjct  159  DGGIIKKIMEKGERNERPSDLDEVLVKYQVALADGTIVAKASEEG--YEFYVKDGHLFPA  216

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDIC  506
              + I TMK+GE     + P  A+G+ G       P+IPPN+ L  ++EL+S+  V D+ 
Sbjct  217  LTKAIVTMKRGEKVKLIVQPKYAFGDKGKEATDGFPSIPPNSVLNVELELVSFKPVIDVT  276



>ref|XP_007018460.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
[Theobroma cacao]
 gb|EOY15685.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
[Theobroma cacao]
Length=603

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 102/142 (72%), Gaps = 6/142 (4%)
 Frame = +3

Query  99   DDLD-----LPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLD  263
            DDLD     + +  P +KVGEE+E+G  G+KKKL+K G  WETPE GDEV VHY GTLLD
Sbjct  18   DDLDEEPGEVIESAPPLKVGEERELGSSGIKKKLLKNGISWETPEFGDEVTVHYVGTLLD  77

Query  264  GTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIP  443
            GTKF S+RD+  P  F LG+G V KG D GI TMKKGEC +FT+PPD  YG  G    +P
Sbjct  78   GTKFCSTRDKDEPLTFKLGEGLVAKGLDHGIVTMKKGECALFTLPPDFGYGAEGR-DGVP  136

Query  444  PNATLQFDVELLSWVSVKDICK  509
            P++ +Q+++ELLSW++V DI K
Sbjct  137  PDSVIQYEMELLSWITVVDISK  158


 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 60/117 (51%), Gaps = 4/117 (3%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVI  335
            GD  + KK++KEG G      G  V + YT  L D T F+    D   P +F   + QVI
Sbjct  277  GDSKVFKKILKEGEGAVVANEGAAVTISYTARLEDNTVFEKKGVDGEQPLEFITDEEQVI  336

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  497
             G D+   TMKKGE  + TI P+  +G   +      +PP A L ++VE+L +V  K
Sbjct  337  PGLDRAAATMKKGERALLTISPEYGFGSVVAECDLAVVPPCANLFYEVEMLDFVKEK  393


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 62/119 (52%), Gaps = 7/119 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++K+G   E P   DEV V Y   L+DGT    +   G   +F +  G +   
Sbjct  159  DGGIIKKIMKKGERNEWPSDLDEVLVKYQMALVDGTIVAKTPAEGN--EFYVKDGHLCSA  216

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDI  503
              + I TMK+GE     + P  A+GE G       P +PPN+ L  ++EL+S+ SV D+
Sbjct  217  LTKAILTMKRGEKVTLIVQPKYAFGEKGRDATDGFPAVPPNSVLNIELELVSFKSVIDV  275



>ref|XP_008790247.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Phoenix dactylifera]
Length=631

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 105/146 (72%), Gaps = 3/146 (2%)
 Frame = +3

Query  78   DMPPAEMDDL--DLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTG  251
            D   AE+D+   ++ +  P ++VGEE+EI   GLKKKL++ G GWETP  GDEV VHY G
Sbjct  18   DTNLAELDEEPGEVIESAPPLRVGEEREINAAGLKKKLLRAGRGWETPVTGDEVTVHYVG  77

Query  252  TLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP  431
            TLLDG+KFDSSR+RG P    LG G+V+ G DQGI TMKKGE  +FT+P  L YG + S 
Sbjct  78   TLLDGSKFDSSRERGEPLTLKLGHGEVVPGLDQGIVTMKKGELALFTLPSSLGYG-NLST  136

Query  432  PTIPPNATLQFDVELLSWVSVKDICK  509
              +PP A +Q++VEL+SW++V DICK
Sbjct  137  HDVPPGADIQYEVELVSWLTVMDICK  162


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 73/136 (54%), Gaps = 8/136 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            D++L    PV+ V     + D  + KK+++ G G+  P  G+ V + YT  L DGT F+ 
Sbjct  266  DVELLSLKPVLDV-----MDDLKVLKKILRAGEGFRRPNDGETVHIRYTAMLEDGTVFEK  320

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG---SPPTIPPNA  452
                   F+F + + QVI G D+ + TM KGE    T+ P+  +G      +  TIPP +
Sbjct  321  LGFDKELFEFVIDEEQVIAGLDRAVATMLKGEFSQVTVKPEYGFGNDEVKLAVTTIPPCS  380

Query  453  TLQFDVELLSWVSVKD  500
            TL ++VEL+ ++  K+
Sbjct  381  TLIYEVELVDFIKQKE  396


 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 19/162 (12%)
 Frame = +3

Query  45   SSLCFWIMEDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPE  218
            SSL +  +   D+PP      +++L     VM + +     D G+ KK++   +G +  +
Sbjct  127  SSLGYGNLSTHDVPPGADIQYEVELVSWLTVMDICK-----DGGIVKKVL---SGGDDRQ  178

Query  219  PGD--EVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFT  392
             GD  EV V Y   LLDG+    + + G   +F + +G +     + +KTMK+GE  + T
Sbjct  179  AGDLDEVTVKYQVRLLDGSVVAETPEGG--MEFYINEGHLCPALPKVLKTMKRGEKAVVT  236

Query  393  IPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
            + P  A+GE G   +     IP NATL  DVELLS   V D+
Sbjct  237  VQPQYAFGERGRDASDGFRAIPSNATLNIDVELLSLKPVLDV  278



>ref|XP_010111217.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Morus notabilis]
 gb|EXC30695.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Morus notabilis]
Length=524

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  144  EEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQ  323
            +EKEI  QGLKK++++ G+ W+TP  GDEV+VH++G +  G   D SRD GTPFKF LGQ
Sbjct  52   QEKEIRKQGLKKQILRNGSSWQTPSRGDEVQVHFSGRIKGGACLDQSRDIGTPFKFKLGQ  111

Query  324  GQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
             +VIKG D+G+ TMKKGE  IFTIPP+LAYGE G+PP IPPN+TL +D+E++SW +++DI
Sbjct  112  CEVIKGLDEGVATMKKGERAIFTIPPNLAYGEVGNPPLIPPNSTLVYDIEMISWRTIRDI  171


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 62/120 (52%), Gaps = 9/120 (8%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP  GDEV V Y  +L +G     S +     +F +    +  
Sbjct  173  GDGGILKKIIKEGEGWATPRDGDEVLVKYKSSLENGMLVSESDNT----EFYISDDYICP  228

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGE----SGSPPTIPPNAT-LQFDVELLSWVSVKDI  503
               + +KTM++GE     +    ++ E    + +   I P A+ L  ++EL+SW SV D+
Sbjct  229  AISRTVKTMRRGEKAELAVKSSYSFKEVVNGTATMGVIAPLASNLTIEIELISWKSVVDV  288


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  195  GAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKG  374
            G G++ P  G  V+V YTGTL DG++F+S      P++F   + QV +G D+ I TMKKG
Sbjct  302  GEGFDHPNEGAIVKVIYTGTLEDGSEFESKGSEEEPYEFVCLEEQVNEGLDRAIMTMKKG  361

Query  375  ECCIFTIPPDL  407
            E  + T+  + 
Sbjct  362  EQALVTVGAEF  372



>ref|XP_002283423.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase [Vitis vinifera]
 emb|CBI19379.3| unnamed protein product [Vitis vinifera]
Length=600

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 105/144 (73%), Gaps = 6/144 (4%)
 Frame = +3

Query  93   EMDDLD-----LPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTL  257
            E+DDLD     + +  P + VG+E+E+ + GLKK+L+ +G GWETP+ GDEV VHY GTL
Sbjct  15   EVDDLDEEPGEVIESAPPLCVGQERELNNSGLKKRLLHKGIGWETPDFGDEVTVHYVGTL  74

Query  258  LDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT  437
            LDG  FDS+RDR  P  FTLG+G+V+ G DQGI TM + E  +FT+PP L YGE+G    
Sbjct  75   LDGGTFDSTRDRNEPSTFTLGRGEVVDGLDQGIVTMTQEEIALFTVPPHLGYGEAGR-QG  133

Query  438  IPPNATLQFDVELLSWVSVKDICK  509
            +PPN+ +QF V+L+SW++V D+C+
Sbjct  134  VPPNSVVQFQVQLISWITVVDVCR  157


 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 73/145 (50%), Gaps = 11/145 (8%)
 Frame = +3

Query  81   MPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGT  254
            +PP+   + DL+L    PV+ V      GD  + KK++ EGA       G  V V YT  
Sbjct  253  IPPSSVLIIDLELVSFKPVIDV-----TGDSKVFKKILVEGANTIAANEGATVTVRYTAK  307

Query  255  LLDGTKFDSS-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE---S  422
            L DGT F+    D   P +F   + QVI G DQ + TM KGE  I TI P+  YG     
Sbjct  308  LEDGTIFEKKGFDGENPLQFITDEEQVISGLDQAVATMTKGERSIVTIHPEYGYGSIEVM  367

Query  423  GSPPTIPPNATLQFDVELLSWVSVK  497
                 +PP++ + ++VE+L +V  K
Sbjct  368  QDISIVPPSSIIIYEVEMLDFVKEK  392


 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 7/119 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++++G     P   DE+ V Y   L+D T    + + G   +F +  GQ    
Sbjct  158  DGGIIKKILEKGNRNVQPGDLDELLVKYKVKLVDDTIVAQTPEEG--IEFYMKDGQFCSA  215

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDI  503
              + IKTMK GE     + P  A+G+ G       P IPP++ L  D+EL+S+  V D+
Sbjct  216  MPKAIKTMKSGEKVKLIVQPQYAFGDVGRDAENEFPLIPPSSVLIIDLELVSFKPVIDV  274



>ref|XP_006482027.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Citrus 
sinensis]
Length=535

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +3

Query  138  VGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTL  317
            +  E+EIG QGL+K+++++G  W+TP  GDEV+VH++G +  G    SSRD GTPF F L
Sbjct  20   ISVEREIGKQGLRKQILRKGTSWQTPLLGDEVQVHFSGHIDGGACLASSRDTGTPFCFKL  79

Query  318  GQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  497
            GQG+VIKGWD+G+ TMKKGE  IF IP  LAYGE+GSPP IP N++L FD+ELLSW +++
Sbjct  80   GQGEVIKGWDEGVATMKKGERAIFFIPSVLAYGEAGSPPLIPSNSSLVFDIELLSWSAIR  139

Query  498  DI  503
            DI
Sbjct  140  DI  141


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 58/113 (51%), Gaps = 1/113 (1%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GDQ + KK+ K G G++ P  G  V+V Y G L DGT F++      PF+FT  +  V +
Sbjct  261  GDQKVLKKIKKAGQGFDRPNEGSLVKVIYIGRLEDGTVFETRGSNEEPFEFTTLEENVNE  320

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  497
            G ++ I TMKK E    TI  +       S   +  ++ L ++V L+ +   K
Sbjct  321  GLERAIMTMKKEEQATVTISAEYLCSHEVS-ELVSADSVLHYEVTLIDFTKEK  372


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 56/120 (47%), Gaps = 8/120 (7%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP   DEV V Y   L +G    S  + G  F+  +  G +  
Sbjct  143  GDGGILKKIIKEGEGWATPRDNDEVLVKYEARLQNGA-LVSESNEGVEFR--VFDGHLCP  199

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
               + +KTM++GE     +         G   T     +   + L   +ELLSW SV D+
Sbjct  200  AISKAVKTMRRGEKAELAVKFSYGIENDGYEATNIEGGVSSFSNLTIQLELLSWKSVVDV  259



>gb|KDD74899.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Helicosporidium 
sp. ATCC 50920]
Length=531

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+KK +   G+GWE+PE GD+V VHYTGTL DGTKFDSS DRG PF FTLGQGQVIKG
Sbjct  13   DGGVKKTITVLGSGWESPEAGDKVSVHYTGTLEDGTKFDSSVDRGDPFSFTLGQGQVIKG  72

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  506
            WD+ + TMKKGE C   +  D AYG+ GSPP IP +ATL F++ELLSW SVKD+ 
Sbjct  73   WDETVATMKKGEKCRVVLRSDYAYGKQGSPPKIPADATLVFEIELLSWRSVKDLT  127



>ref|XP_006430496.1| hypothetical protein CICLE_v10011447mg [Citrus clementina]
 gb|ESR43736.1| hypothetical protein CICLE_v10011447mg [Citrus clementina]
Length=535

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  147  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  326
            E+EIG QGL+K+++++G  W+TP  GDEV+VH++G +  G    SSRD GTPF F LGQG
Sbjct  23   EREIGKQGLRKQILRKGTSWQTPLLGDEVQVHFSGHIDGGACLASSRDTGTPFCFKLGQG  82

Query  327  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            +VIKGWD+G+ TMKKGE  IF IP  LAYGE+GSPP IP N++L FD+ELLSW +++DI
Sbjct  83   EVIKGWDEGVATMKKGERAIFFIPSVLAYGEAGSPPLIPSNSSLVFDIELLSWSTIRDI  141


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 58/113 (51%), Gaps = 1/113 (1%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GDQ + KK+ K G G++ P  G  V+V Y G L DGT F++      PF+FT  +  V +
Sbjct  261  GDQKVLKKIKKAGQGFDRPNEGSLVKVIYIGRLEDGTVFETRGSNEEPFEFTTLEENVNE  320

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  497
            G ++ I TMKK E    TI  +       S   +  ++ L ++V L+ +   K
Sbjct  321  GLERAIMTMKKEEQATVTISAEYLCSHEVS-ELVSADSVLHYEVTLIDFTKEK  372


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 56/120 (47%), Gaps = 8/120 (7%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP   DEV V +   L +G    S  + G  F+  +  G +  
Sbjct  143  GDGGILKKIIKEGEGWATPRDNDEVLVEFEARLQNGA-LVSESNEGVEFR--VFDGHLCP  199

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  503
               + ++TM++GE     +         G   T     +   + L   +ELLSW SV D+
Sbjct  200  AISKAVRTMRRGEKAELAVKFSYGIENDGYEATNIEGGVSSFSNLTIQLELLSWKSVVDV  259



>ref|XP_007162035.1| hypothetical protein PHAVU_001G118200g [Phaseolus vulgaris]
 gb|ESW34029.1| hypothetical protein PHAVU_001G118200g [Phaseolus vulgaris]
Length=610

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  150  KEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQ  329
            KEIG++GL K+++++G  W+TP  GDEVEVH+ G + +G   +SS D+G+ F+F LGQ +
Sbjct  97   KEIGNEGLTKRILRKGVTWQTPLSGDEVEVHFRGHVENGASLESSYDKGSTFRFKLGQCE  156

Query  330  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            VIKGWD+G+ TMKKGE  IF IPP+LAYGE GSPP IPPNATL +D+E+L+W +++D+
Sbjct  157  VIKGWDEGVATMKKGERAIFKIPPNLAYGEEGSPPLIPPNATLIYDIEMLTWSTIRDL  214


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 60/123 (49%), Gaps = 13/123 (11%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KKL +EG GW TP   DEV V Y   L +G    S  D+G   +F +  G +  
Sbjct  216  GDGGIMKKLTREGEGWATPREADEVLVKYEARLENGM-LVSKSDQGV--EFNVSDGYLCP  272

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI-------PPNATL-QFDVELLSWVSV  494
                 +KTM+KGE     +   L YG S +   I       PP++ L    +EL+SW  V
Sbjct  273  AMSIAVKTMRKGEVADLAVR--LFYGHSQNSNMITELDGVPPPDSNLTSIKLELVSWKIV  330

Query  495  KDI  503
             D+
Sbjct  331  TDV  333


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 50/101 (50%), Gaps = 0/101 (0%)
 Frame = +3

Query  195  GAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKG  374
            G G++ P  G +V+V Y     D T  +       PF+FT  + QV +G ++ I TMKK 
Sbjct  347  GEGFDRPNEGSQVKVIYLCKGEDDTIIERKGSEEEPFEFTTQEEQVPEGLERAIMTMKKA  406

Query  375  ECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  497
            E  + T+  +   G + S      +  L ++VEL+ +V  K
Sbjct  407  EQALVTVDAEYLCGCNNSQGNTENHKVLYYEVELVDFVKEK  447



>ref|XP_010327744.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Solanum 
lycopersicum]
Length=494

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 100/142 (70%), Gaps = 5/142 (4%)
 Frame = +3

Query  96   MDDLDLPDDNPV---MKVGEEKEI--GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  260
            M D +    N V    K+ + +EI  G +GL+KK++++G  W+TP  GDE++VHY   L 
Sbjct  1    MGDFNSKKSNKVNFETKIQDSQEIVIGKEGLRKKILQKGNSWKTPFHGDEIQVHYRVKLQ  60

Query  261  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI  440
            DG  FDSS DRG  F F LGQG+VIKGWD+GI TMKK E  I TIPP+LAYGE GSPP I
Sbjct  61   DGEFFDSSYDRGKTFTFKLGQGEVIKGWDEGIATMKKSERAILTIPPNLAYGEIGSPPLI  120

Query  441  PPNATLQFDVELLSWVSVKDIC  506
            PPN+ L F++EL+SW S++DI 
Sbjct  121  PPNSILIFEIELISWNSIRDIS  142


 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 60/121 (50%), Gaps = 8/121 (7%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP   DEV V Y  +  DG     S D     +F+L +G +  
Sbjct  143  GDGGILKKIIKEGQGWATPRDVDEVLVKYVASSADGKILSQSDD---AVEFSLMEGHLYP  199

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGES-----GSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE     + P   +G S     G       N+ L   +EL+SW SV D+
Sbjct  200  AMKKSLKTMRKGEIVELIVKPPYYFGNSSFDGDGIGILQSSNSNLIIHLELISWKSVVDV  259

Query  504  C  506
             
Sbjct  260  I  260



>gb|KHG02788.1| Peptidyl-prolyl cis-trans isomerase FKBP65 -like protein [Gossypium 
arboreum]
Length=603

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 101/142 (71%), Gaps = 6/142 (4%)
 Frame = +3

Query  99   DDLDLP-----DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLD  263
            DDLD       +  P +KVGEE+E+G+ G+KKKL+  G  WETPE GDEV VH+ GTLL+
Sbjct  18   DDLDEEPGEEIESAPPLKVGEERELGNSGIKKKLLNNGIHWETPEFGDEVTVHFVGTLLN  77

Query  264  GTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIP  443
            G KF S+RD G P  F LG+G+V KG D GI TMKKGE  +FT+PPD  YG  G    +P
Sbjct  78   GIKFCSTRDNGEPITFKLGEGKVAKGLDNGITTMKKGERVLFTLPPDFGYGAEGR-DGVP  136

Query  444  PNATLQFDVELLSWVSVKDICK  509
            P++ +QF+VELLSW++V DICK
Sbjct  137  PDSIVQFEVELLSWITVVDICK  158


 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 70/136 (51%), Gaps = 9/136 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            +L+L    PV+ V      GD  + KK++KEG G      G  V + Y   L DGT F+ 
Sbjct  263  ELELVSFKPVIDV-----TGDSKVFKKILKEGEGALVANEGAAVTISYIAWLEDGTVFER  317

Query  282  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
               D G P +F   + QVI G D+   TMKKGE  + TI P+  +G   +      +PP+
Sbjct  318  KGVDGGQPLEFITDEEQVIPGLDRAAATMKKGEQALLTICPEYGFGSVVAERDLAVVPPS  377

Query  450  ATLQFDVELLSWVSVK  497
            + L ++VE+L +V  K
Sbjct  378  SNLVYEVEMLDFVKEK  393


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 63/119 (53%), Gaps = 7/119 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK++++G   E P   DEV V Y  TL  GT    + + G  ++F +  G +   
Sbjct  159  DGGIIKKIMEKGERNERPSDLDEVLVKYQVTLAGGTIVAKTPEEG--YEFYVKDGHLFPA  216

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDI  503
              + I TMK+GE     + P  A+G+ G       P+IPPN+ L  ++EL+S+  V D+
Sbjct  217  LTKAIITMKRGEKVKLIVQPKYAFGDKGKEATDGFPSIPPNSVLNVELELVSFKPVIDV  275



>ref|XP_010936158.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Elaeis guineensis]
Length=594

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 103/147 (70%), Gaps = 4/147 (3%)
 Frame = +3

Query  78   DMPPAEMDDLD---LPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  248
            D   AE+DD +   + +  P ++VGEE+EI   GLKKKL++ G GWETP  GDEV VH  
Sbjct  18   DTNLAELDDEEPGEVIESAPPLRVGEEREINAAGLKKKLLRAGRGWETPVSGDEVTVHCV  77

Query  249  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
            G LLDG+KFDSSR+RG P  F LG G+++ G DQGI TM KGE  +FT+P  L YG  G+
Sbjct  78   GMLLDGSKFDSSRERGEPLTFKLGHGEMVTGLDQGIVTMTKGELALFTLPSSLGYGNLGA  137

Query  429  PPTIPPNATLQFDVELLSWVSVKDICK  509
               +PP A +Q++VEL+SW++V DICK
Sbjct  138  HD-VPPGADIQYEVELVSWLTVMDICK  163


 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 71/132 (54%), Gaps = 8/132 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            D++L    PV+ V     +GD  + KK+++ G G+  P  G+ V + YT  L DG+ F+ 
Sbjct  267  DVELLSLKPVLDV-----MGDLKVLKKILRAGEGFRRPNDGEMVRIRYTAMLEDGSVFEK  321

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG---SPPTIPPNA  452
                   F+F + + QVI G D  + TM KGE    T+ P+  +G      +  T+PP +
Sbjct  322  VGFDEELFEFVIDEEQVIAGLDSAVATMLKGEFSQVTVKPEYGFGNDEVKLAVTTVPPCS  381

Query  453  TLQFDVELLSWV  488
            TL ++VEL+ ++
Sbjct  382  TLIYEVELVDFI  393


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 65/121 (54%), Gaps = 12/121 (10%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGD--EVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  335
            D G+ KK++   +G +  + GD  EV V Y   LLDG+    + + G   +F + +G + 
Sbjct  164  DGGIVKKVL---SGCDDRQTGDLDEVTVKYQVRLLDGSVVAETAEGG--LEFYINEGHLC  218

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKD  500
                + +KTMKKGE  + T+ P  A+GE G       P IP NATL  DVELLS   V D
Sbjct  219  PALPKVLKTMKKGEKAVVTVQPQYAFGEQGRDASDGFPAIPSNATLNIDVELLSLKPVLD  278

Query  501  I  503
            +
Sbjct  279  V  279



>ref|XP_011074339.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Sesamum 
indicum]
Length=598

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +3

Query  126  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  305
            P +KVGEE+EIG  GLKKKL+K G  WETP+ GDEV VHY G+L DG+ F S+R    PF
Sbjct  29   PPLKVGEEREIGSNGLKKKLMKRGLNWETPQFGDEVTVHYVGSLSDGSIFISTRASNEPF  88

Query  306  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  485
               LG+G ++ G D GI TM++GE  +FT+PP+LAYG SG    IPPNA +Q +VELLSW
Sbjct  89   TLKLGRGDIVIGLDHGIVTMRRGEVALFTLPPELAYGASGRAG-IPPNAVVQLEVELLSW  147

Query  486  VSVKDICK  509
            ++V D+CK
Sbjct  148  ITVVDVCK  155


 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 63/117 (54%), Gaps = 4/117 (3%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVI  335
            GD  +KKK+++EG G  T   G  V V Y   L DGT F+    D   P +F   + Q I
Sbjct  273  GDLKVKKKVLREGEGTVTANEGAAVTVRYKAMLEDGTVFERKGIDGEQPLEFITDEEQTI  332

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  497
             G D+ + TMKK E  + TI P+  +G +        +PP++T+ ++VE+L +V  K
Sbjct  333  VGLDRAVSTMKKNEYALVTISPEYGFGSTEVKQDLAVVPPSSTILYEVEMLDFVREK  389


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 60/118 (51%), Gaps = 6/118 (5%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+++ G     P   DEV V+Y   L+DGT    +RD G   +F +  G     
Sbjct  156  DGGIIKKILENGEQIGPPGDLDEVRVNYKAMLVDGTIVADTRDEGV--EFYIKDGHFCPA  213

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP----PTIPPNATLQFDVELLSWVSVKDI  503
              + IKTMKKGE     + P   +GE G      P+IPP +TL    ELLS+  V DI
Sbjct  214  LVKAIKTMKKGERVNLVVQPQYGFGEVGKKSNELPSIPPKSTLSISAELLSFKRVIDI  271



>ref|XP_011397815.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Auxenochlorella protothecoides]
 gb|KFM24927.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Auxenochlorella protothecoides]
Length=561

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 98/138 (71%), Gaps = 3/138 (2%)
 Frame = +3

Query  102  DLDLPDD--NPVMKVGEEKEIG-DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTK  272
            DL L D+    V +VG+E ++  D G++K + K GAG+E PE GD+V VHYTGTL DGTK
Sbjct  6    DLALEDEFAEAVDEVGKEIDVSKDGGVRKIIKKVGAGYEVPEKGDKVTVHYTGTLEDGTK  65

Query  273  FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNA  452
            FDSSRDR  PF FTLGQGQVIKGWD  + TMKKGE     I  D  YG +GSPP IP NA
Sbjct  66   FDSSRDRDDPFTFTLGQGQVIKGWDLSVATMKKGESATVIIRGDYGYGAAGSPPKIPANA  125

Query  453  TLQFDVELLSWVSVKDIC  506
            TL FD+ELLSW S KD+ 
Sbjct  126  TLHFDIELLSWRSDKDLT  143


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 54/108 (50%), Gaps = 5/108 (5%)
 Frame = +3

Query  168  GLKKKLVKEGAGWETPEPGDEVEVHYTGTL-LDGTKFDSSRDRGTPFKFTLGQGQVIKGW  344
            G+ K+ +     W+TP  G  V + YT  L +DGT FD  R   +P         + +G 
Sbjct  260  GVVKRTLVSTDEWQTPNEGATVTLAYTARLAVDGTVFDE-RTTESPLVVETDADALPEGL  318

Query  345  DQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELL  479
            +  +  MKKGE C+  +P  LAYG  GS      +P +  ++++V L+
Sbjct  319  EAAVMKMKKGEKCVVMVPAALAYGSEGSDQPMARVPADVDVEYEVTLV  366



>ref|XP_011074340.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Sesamum 
indicum]
Length=595

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +3

Query  126  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  305
            P +KVGEE+EIG  GLKKKL+K G  WETP+ GDEV VHY G+L DG+ F S+R    PF
Sbjct  29   PPLKVGEEREIGSNGLKKKLMKRGLNWETPQFGDEVTVHYVGSLSDGSIFISTRASNEPF  88

Query  306  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  485
               LG+G ++ G D GI TM++GE  +FT+PP+LAYG SG    IPPNA +Q +VELLSW
Sbjct  89   TLKLGRGDIVIGLDHGIVTMRRGEVALFTLPPELAYGASGRAG-IPPNAVVQLEVELLSW  147

Query  486  VSVKDICK  509
            ++V D+CK
Sbjct  148  ITVVDVCK  155


 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 63/117 (54%), Gaps = 4/117 (3%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVI  335
            GD  +KKK+++EG G  T   G  V V Y   L DGT F+    D   P +F   + Q I
Sbjct  273  GDLKVKKKVLREGEGTVTANEGAAVTVRYKAMLEDGTVFERKGIDGEQPLEFITDEEQTI  332

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  497
             G D+ + TMKK E  + TI P+  +G +        +PP++T+ ++VE+L +V  K
Sbjct  333  VGLDRAVSTMKKNEYALVTISPEYGFGSTEVKQDLAVVPPSSTILYEVEMLDFVREK  389


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 60/118 (51%), Gaps = 6/118 (5%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+++ G     P   DEV V+Y   L+DGT    +RD G   +F +  G     
Sbjct  156  DGGIIKKILENGEQIGPPGDLDEVRVNYKAMLVDGTIVADTRDEGV--EFYIKDGHFCPA  213

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSP----PTIPPNATLQFDVELLSWVSVKDI  503
              + IKTMKKGE     + P   +GE G      P+IPP +TL    ELLS+  V DI
Sbjct  214  LVKAIKTMKKGERVNLVVQPQYGFGEVGKKSNELPSIPPKSTLSISAELLSFKRVIDI  271



>ref|XP_010936157.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Elaeis guineensis]
Length=635

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 103/147 (70%), Gaps = 4/147 (3%)
 Frame = +3

Query  78   DMPPAEMDDLD---LPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  248
            D   AE+DD +   + +  P ++VGEE+EI   GLKKKL++ G GWETP  GDEV VH  
Sbjct  18   DTNLAELDDEEPGEVIESAPPLRVGEEREINAAGLKKKLLRAGRGWETPVSGDEVTVHCV  77

Query  249  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
            G LLDG+KFDSSR+RG P  F LG G+++ G DQGI TM KGE  +FT+P  L YG  G+
Sbjct  78   GMLLDGSKFDSSRERGEPLTFKLGHGEMVTGLDQGIVTMTKGELALFTLPSSLGYGNLGA  137

Query  429  PPTIPPNATLQFDVELLSWVSVKDICK  509
               +PP A +Q++VEL+SW++V DICK
Sbjct  138  HD-VPPGADIQYEVELVSWLTVMDICK  163


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 73/136 (54%), Gaps = 8/136 (6%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            D++L    PV+ V     +GD  + KK+++ G G+  P  G+ V + YT  L DG+ F+ 
Sbjct  267  DVELLSLKPVLDV-----MGDLKVLKKILRAGEGFRRPNDGEMVRIRYTAMLEDGSVFEK  321

Query  282  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG---SPPTIPPNA  452
                   F+F + + QVI G D  + TM KGE    T+ P+  +G      +  T+PP +
Sbjct  322  VGFDEELFEFVIDEEQVIAGLDSAVATMLKGEFSQVTVKPEYGFGNDEVKLAVTTVPPCS  381

Query  453  TLQFDVELLSWVSVKD  500
            TL ++VEL+ ++  K+
Sbjct  382  TLIYEVELVDFIKEKE  397


 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 65/121 (54%), Gaps = 12/121 (10%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGD--EVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  335
            D G+ KK++   +G +  + GD  EV V Y   LLDG+    + + G   +F + +G + 
Sbjct  164  DGGIVKKVL---SGCDDRQTGDLDEVTVKYQVRLLDGSVVAETAEGG--LEFYINEGHLC  218

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKD  500
                + +KTMKKGE  + T+ P  A+GE G       P IP NATL  DVELLS   V D
Sbjct  219  PALPKVLKTMKKGEKAVVTVQPQYAFGEQGRDASDGFPAIPSNATLNIDVELLSLKPVLD  278

Query  501  I  503
            +
Sbjct  279  V  279



>ref|XP_010327743.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Solanum 
lycopersicum]
Length=523

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 100/141 (71%), Gaps = 5/141 (4%)
 Frame = +3

Query  96   MDDLDLPDDNPV---MKVGEEKEI--GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  260
            M D +    N V    K+ + +EI  G +GL+KK++++G  W+TP  GDE++VHY   L 
Sbjct  1    MGDFNSKKSNKVNFETKIQDSQEIVIGKEGLRKKILQKGNSWKTPFHGDEIQVHYRVKLQ  60

Query  261  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI  440
            DG  FDSS DRG  F F LGQG+VIKGWD+GI TMKK E  I TIPP+LAYGE GSPP I
Sbjct  61   DGEFFDSSYDRGKTFTFKLGQGEVIKGWDEGIATMKKSERAILTIPPNLAYGEIGSPPLI  120

Query  441  PPNATLQFDVELLSWVSVKDI  503
            PPN+ L F++EL+SW S++DI
Sbjct  121  PPNSILIFEIELISWNSIRDI  141


 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 60/120 (50%), Gaps = 8/120 (7%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
            GD G+ KK++KEG GW TP   DEV V Y  +  DG     S D     +F+L +G +  
Sbjct  143  GDGGILKKIIKEGQGWATPRDVDEVLVKYVASSADGKILSQSDD---AVEFSLMEGHLYP  199

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGES-----GSPPTIPPNATLQFDVELLSWVSVKDI  503
               + +KTM+KGE     + P   +G S     G       N+ L   +EL+SW SV D+
Sbjct  200  AMKKSLKTMRKGEIVELIVKPPYYFGNSSFDGDGIGILQSSNSNLIIHLELISWKSVVDV  259


 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +3

Query  156  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  335
            IGD  + KKL+K G G++ P  G   +V Y G LLDGT F+       PF++   +GQ+ 
Sbjct  260  IGDNKVLKKLIKAGEGYDHPNEGSLAKVVYIGKLLDGTIFERKGSHEEPFEYVCLEGQLN  319

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGE  419
            +  D+ I TMKKGE  I TI     + E
Sbjct  320  EYVDRAIMTMKKGEEAIVTINSHSMFYE  347



>ref|XP_002302401.1| peptidyl-prolyl cis-trans isomerase FKBP-type family protein 
[Populus trichocarpa]
 gb|EEE81674.1| peptidyl-prolyl cis-trans isomerase FKBP-type family protein 
[Populus trichocarpa]
Length=573

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 104/147 (71%), Gaps = 6/147 (4%)
 Frame = +3

Query  69   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  248
            ED D  P E     + +  P +KVGEE+E+G+ G+KKKL+K G GWETPE  DEV VHY 
Sbjct  16   EDLDEEPGE-----VIESAPPLKVGEERELGNSGIKKKLLKRGLGWETPEFNDEVTVHYV  70

Query  249  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  428
            GTLLDGTKFDS+RDR +     LGQG+V+ G D GI TMKKGE  +FT+PP+L +G +G 
Sbjct  71   GTLLDGTKFDSTRDRDSSVIMKLGQGEVVAGLDHGIITMKKGERALFTLPPELGFGVTGR  130

Query  429  PPTIPPNATLQFDVELLSWVSVKDICK  509
               +P N+ ++++VEL+SW+ V D+ K
Sbjct  131  -DAVPTNSFVRYEVELVSWIKVVDVSK  156


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 71/136 (52%), Gaps = 9/136 (7%)
 Frame = +3

Query  102  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  281
            DL+L    PV+ V      GD  + KK++KEG G      G  V + YT  L DGT F+ 
Sbjct  261  DLELTSFKPVIDV-----TGDAKVFKKILKEGEGSLVANEGATVTISYTARLEDGTVFER  315

Query  282  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  449
               D G P +F   + QVI G D+ + TMKKGE  I T+ P+  +G   +      +PP+
Sbjct  316  KGIDDGQPLQFITDEEQVIAGLDRAVATMKKGEYAILTVKPEYGFGNVETKRDLAIVPPS  375

Query  450  ATLQFDVELLSWVSVK  497
            + L ++VE+  ++  K
Sbjct  376  SILVYEVEMSDFIKEK  391


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 7/120 (6%)
 Frame = +3

Query  162  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  341
            D G+ KK+V++G   + P   DEV V Y   L DGT    + + G   +F +  G +   
Sbjct  157  DGGIIKKIVEKGDKHDRPGDLDEVLVKYQVALADGTIVAKTLEEG--IEFYVKDGHLCPA  214

Query  342  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  506
              +   TMK+GE     + P  A+G+ G   +     +PPN+TL  D+EL S+  V D+ 
Sbjct  215  LPKATMTMKRGEKVKLVVQPQYAFGQEGKDASDAICPVPPNSTLYIDLELTSFKPVIDVT  274



>ref|XP_004493326.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Cicer arietinum]
Length=527

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  150  KEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQ  329
            +EIG+QGL K++++ G  W+TP  GD+VEVH+ G + +G   +SS D+G+ F F LG G+
Sbjct  17   REIGNQGLTKRILRNGITWQTPFSGDQVEVHFRGQVENGPSLESSYDKGSSFHFKLGHGE  76

Query  330  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  503
            VIKGWD+G+ TMKKGE  I  IPP+LAYGE GSPP IPPNATL FD+E+LSW +++D+
Sbjct  77   VIKGWDEGVATMKKGERAILKIPPNLAYGEVGSPPLIPPNATLIFDIEMLSWSTIRDL  134


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 58/114 (51%), Gaps = 0/114 (0%)
 Frame = +3

Query  156  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  335
            +GD+ + KK+   G G++ P  G +V+V Y     DG   ++   +  PF+FT  + QV 
Sbjct  251  VGDKKILKKINIAGEGFDRPNEGSQVKVIYFCKGEDGNIIETKGSKEEPFEFTTQEEQVN  310

Query  336  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  497
            +G ++ I TMKK E  + T+  +     S        N  L ++VEL+ ++  K
Sbjct  311  EGLERAIMTMKKAEHALVTVNAEYFRDHSNLQGNKTNNKILHYEVELVDFIKEK  364


 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 57/122 (47%), Gaps = 12/122 (10%)
 Frame = +3

Query  159  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  338
             D G+ KK++K+G GW TP+  DEV V Y   L +G    S +      +F +  G +  
Sbjct  136  SDGGIMKKIIKDGEGWATPKELDEVLVKYEARLENGKLMKSDK----CVEFNVSDGYLCP  191

Query  339  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  500
                 +KTM+KGE     +   L+YG + +         +P    +   +EL+SW  V D
Sbjct  192  AMSIAVKTMRKGEVAELALK--LSYGLTQNSNRAIELDGLPDPNLISIKLELVSWKVVTD  249

Query  501  IC  506
            I 
Sbjct  250  IV  251



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510