BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF022P01

Length=485
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007209941.1|  hypothetical protein PRUPE_ppa004742mg             199   3e-58   
ref|XP_007209942.1|  hypothetical protein PRUPE_ppa004742mg             199   4e-58   Prunus persica
ref|XP_007209943.1|  hypothetical protein PRUPE_ppa004742mg             199   5e-58   
ref|NP_001234549.1|  phosphoethanolamine N-methyltransferase            199   7e-58   Solanum lycopersicum
ref|XP_009616694.1|  PREDICTED: phosphoethanolamine N-methyltrans...    198   1e-57   Nicotiana tomentosiformis
ref|XP_011084235.1|  PREDICTED: phosphoethanolamine N-methyltrans...    198   1e-57   Sesamum indicum [beniseed]
ref|XP_010533969.1|  PREDICTED: phosphomethylethanolamine N-methy...    197   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_010487710.1|  PREDICTED: phosphoethanolamine N-methyltrans...    197   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008364653.1|  PREDICTED: phosphoethanolamine N-methyltrans...    197   4e-57   
ref|XP_009757363.1|  PREDICTED: phosphoethanolamine N-methyltrans...    197   5e-57   Nicotiana sylvestris
ref|XP_010506242.1|  PREDICTED: phosphoethanolamine N-methyltrans...    196   6e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008240154.1|  PREDICTED: phosphoethanolamine N-methyltrans...    196   6e-57   
ref|XP_008240152.1|  PREDICTED: phosphoethanolamine N-methyltrans...    196   9e-57   Prunus mume [ume]
ref|XP_009614862.1|  PREDICTED: phosphoethanolamine N-methyltrans...    196   1e-56   Nicotiana tomentosiformis
ref|XP_010465872.1|  PREDICTED: phosphoethanolamine N-methyltrans...    196   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_002883100.1|  N-methyltransferase 1                              196   2e-56   
ref|XP_008360927.1|  PREDICTED: phosphoethanolamine N-methyltrans...    195   3e-56   
ref|XP_002282182.1|  PREDICTED: phosphomethylethanolamine N-methy...    195   3e-56   Vitis vinifera
ref|NP_973993.1|  phosphoethanolamine N-methyltransferase 2             194   3e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KJB30121.1|  hypothetical protein B456_005G132000                    193   3e-56   Gossypium raimondii
gb|AAM13092.1|  unknown protein                                         194   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188427.2|  phosphoethanolamine N-methyltransferase 1             194   4e-56   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02720.1|  methyl transferase-like protein                        194   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487709.1|  PREDICTED: phosphoethanolamine N-methyltrans...    194   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_006297517.1|  hypothetical protein CARUB_v10013541mg             194   4e-56   Capsella rubella
gb|AAP83582.1|  phosphoethanolamine N-methyltransferase                 194   4e-56   Brassica napus [oilseed rape]
ref|XP_002891445.1|  hypothetical protein ARALYDRAFT_473996             194   5e-56   
ref|XP_002532097.1|  phosphoethanolamine n-methyltransferase, put...    194   6e-56   Ricinus communis
gb|ABX10444.1|  phosphoethanolamine N-methyltransferase                 194   6e-56   Gossypium hirsutum [American cotton]
ref|XP_009145948.1|  PREDICTED: phosphoethanolamine N-methyltrans...    194   6e-56   Brassica rapa
ref|XP_011072995.1|  PREDICTED: phosphoethanolamine N-methyltrans...    194   6e-56   Sesamum indicum [beniseed]
ref|XP_010506234.1|  PREDICTED: phosphoethanolamine N-methyltrans...    194   7e-56   Camelina sativa [gold-of-pleasure]
gb|KJB30119.1|  hypothetical protein B456_005G132000                    192   7e-56   Gossypium raimondii
gb|KHG16117.1|  Phosphoethanolamine N-methyltransferase 1 -like p...    193   8e-56   Gossypium arboreum [tree cotton]
ref|XP_006406666.1|  hypothetical protein EUTSA_v10020595mg             193   9e-56   Eutrema salsugineum [saltwater cress]
gb|KJB30123.1|  hypothetical protein B456_005G132000                    192   1e-55   Gossypium raimondii
ref|XP_009356042.1|  PREDICTED: phosphoethanolamine N-methyltrans...    193   1e-55   Pyrus x bretschneideri [bai li]
ref|XP_008393424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    193   2e-55   
ref|XP_009360079.1|  PREDICTED: phosphoethanolamine N-methyltrans...    192   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_011084227.1|  PREDICTED: phosphoethanolamine N-methyltrans...    192   2e-55   Sesamum indicum [beniseed]
ref|XP_010461752.1|  PREDICTED: phosphomethylethanolamine N-methy...    192   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_004299531.1|  PREDICTED: phosphomethylethanolamine N-methy...    192   3e-55   Fragaria vesca subsp. vesca
gb|KJB30117.1|  hypothetical protein B456_005G132000                    192   3e-55   Gossypium raimondii
gb|KJB30122.1|  hypothetical protein B456_005G132000                    192   3e-55   Gossypium raimondii
emb|CAN64744.1|  hypothetical protein VITISV_041321                     192   3e-55   Vitis vinifera
gb|KFK39125.1|  hypothetical protein AALP_AA3G204100                    192   4e-55   Arabis alpina [alpine rockcress]
ref|XP_006303987.1|  hypothetical protein CARUB_v10008968mg             192   4e-55   Capsella rubella
emb|CDO98349.1|  unnamed protein product                                192   4e-55   Coffea canephora [robusta coffee]
ref|XP_010097563.1|  hypothetical protein L484_017373                   192   4e-55   
ref|XP_010033717.1|  PREDICTED: phosphoethanolamine N-methyltrans...    192   4e-55   Eucalyptus grandis [rose gum]
ref|XP_009147956.1|  PREDICTED: phosphomethylethanolamine N-methy...    191   6e-55   Brassica rapa
ref|XP_010461683.1|  PREDICTED: phosphomethylethanolamine N-methy...    191   6e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006341528.1|  PREDICTED: phosphoethanolamine N-methyltrans...    191   6e-55   Solanum tuberosum [potatoes]
ref|XP_006376718.1|  hypothetical protein POPTR_0012s044902g            181   7e-55   
ref|XP_010519218.1|  PREDICTED: phosphoethanolamine N-methyltrans...    191   8e-55   Tarenaya hassleriana [spider flower]
gb|AER10512.1|  phosphoethanolamine N-methyltransferase                 191   8e-55   Pyrus betulifolia
ref|XP_007036803.1|  S-adenosyl-L-methionine-dependent methyltran...    191   1e-54   
gb|KFK36082.1|  hypothetical protein AALP_AA4G075100                    191   1e-54   Arabis alpina [alpine rockcress]
ref|XP_007036802.1|  S-adenosyl-L-methionine-dependent methyltran...    191   1e-54   
ref|XP_010263678.1|  PREDICTED: phosphoethanolamine N-methyltrans...    190   1e-54   Nelumbo nucifera [Indian lotus]
gb|AFW83641.1|  hypothetical protein ZEAMMB73_560974                    184   1e-54   
dbj|BAD80838.1|  phosphoethanolamine N-methyltransferase                190   2e-54   Atriplex nummularia
gb|EYU33965.1|  hypothetical protein MIMGU_mgv1a005263mg                190   2e-54   Erythranthe guttata [common monkey flower]
dbj|BAD93609.1|  hypothetical protein                                   182   2e-54   Cucumis melo [Oriental melon]
ref|XP_010519219.1|  PREDICTED: phosphoethanolamine N-methyltrans...    190   3e-54   Tarenaya hassleriana [spider flower]
gb|KDP23922.1|  hypothetical protein JCGZ_27082                         189   3e-54   Jatropha curcas
gb|EPS65842.1|  hypothetical protein M569_08933                         189   4e-54   Genlisea aurea
ref|XP_010274723.1|  PREDICTED: phosphomethylethanolamine N-methy...    189   6e-54   Nelumbo nucifera [Indian lotus]
ref|XP_003528975.2|  PREDICTED: phosphoethanolamine N-methyltrans...    189   7e-54   
gb|AFK34653.1|  unknown                                                 180   9e-54   Lotus japonicus
gb|AEY75253.1|  phosphoethanolamine N-methyltransferase                 188   1e-53   Atriplex canescens [shadscale]
ref|XP_010097561.1|  Phosphoethanolamine N-methyltransferase 1          188   1e-53   
ref|XP_008799221.1|  PREDICTED: phosphomethylethanolamine N-methy...    187   2e-53   Phoenix dactylifera
gb|KDO63824.1|  hypothetical protein CISIN_1g043471mg                   187   2e-53   Citrus sinensis [apfelsine]
ref|XP_004252273.1|  PREDICTED: phosphomethylethanolamine N-methy...    187   2e-53   Solanum lycopersicum
dbj|BAC57960.1|  phosphoethanolamine N-methyltransferase                187   2e-53   Tripolium pannonicum [sea starwort]
ref|XP_010686587.1|  PREDICTED: phosphoethanolamine N-methyltrans...    187   3e-53   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAE07178.1|  phosphoethanolamine N-methyltransferase                187   3e-53   Beta vulgaris [beet]
ref|XP_008799219.1|  PREDICTED: phosphomethylethanolamine N-methy...    187   3e-53   Phoenix dactylifera
ref|XP_006490771.1|  PREDICTED: phosphoethanolamine N-methyltrans...    187   3e-53   
ref|XP_006451624.1|  hypothetical protein CICLE_v10010749mg             187   3e-53   Citrus clementina [clementine]
ref|XP_009776424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    187   3e-53   Nicotiana sylvestris
sp|Q9M571.1|PEAMT_SPIOL  RecName: Full=Phosphoethanolamine N-meth...    186   4e-53   Spinacia oleracea
gb|AGI56231.1|  phosphoethanolamine N-methyltransferase                 186   4e-53   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_009104804.1|  PREDICTED: phosphoethanolamine N-methyltrans...    186   5e-53   Brassica rapa
emb|CDX68222.1|  BnaA07g22620D                                          186   6e-53   
ref|XP_004503268.1|  PREDICTED: phosphoethanolamine N-methyltrans...    186   6e-53   Cicer arietinum [garbanzo]
ref|XP_006346642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    186   7e-53   Solanum tuberosum [potatoes]
ref|XP_008799258.1|  PREDICTED: phosphomethylethanolamine N-methy...    184   1e-52   
emb|CDY11100.1|  BnaC06g23520D                                          186   1e-52   Brassica napus [oilseed rape]
gb|KEH21429.1|  phosphoethanolamine N-methyltransferase                 184   1e-52   Medicago truncatula
ref|XP_010678114.1|  PREDICTED: phosphoethanolamine N-methyltrans...    185   2e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH21430.1|  phosphoethanolamine N-methyltransferase                 184   2e-52   Medicago truncatula
gb|EMT21187.1|  Phosphoethanolamine N-methyltransferase 1               184   2e-52   
ref|XP_003631125.1|  Phosphoethanolamine N-methyltransferase            184   2e-52   
gb|ACV89824.1|  S-adenosyl-L-methionine:phosphoethanolamine N-met...    184   3e-52   Triticum aestivum [Canadian hard winter wheat]
gb|EMS54147.1|  Phosphoethanolamine N-methyltransferase 1               184   3e-52   Triticum urartu
gb|AET05600.2|  phosphoethanolamine N-methyltransferase                 184   3e-52   Medicago truncatula
emb|CDM83845.1|  unnamed protein product                                184   3e-52   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003631124.1|  Phosphoethanolamine N-methyltransferase            184   3e-52   
gb|EYU24136.1|  hypothetical protein MIMGU_mgv1a005261mg                184   3e-52   Erythranthe guttata [common monkey flower]
ref|XP_007152684.1|  hypothetical protein PHAVU_004G150500g             184   4e-52   Phaseolus vulgaris [French bean]
ref|NP_001148925.1|  LOC100282545                                       184   5e-52   Zea mays [maize]
ref|XP_004969638.1|  PREDICTED: phosphoethanolamine N-methyltrans...    183   6e-52   Setaria italica
ref|XP_003569614.1|  PREDICTED: phosphoethanolamine N-methyltrans...    183   8e-52   Brachypodium distachyon [annual false brome]
ref|XP_002456194.1|  hypothetical protein SORBIDRAFT_03g031950          182   1e-51   Sorghum bicolor [broomcorn]
ref|XP_006644536.1|  PREDICTED: phosphoethanolamine N-methyltrans...    182   1e-51   Oryza brachyantha
gb|AFW83642.1|  phosphoethanolamine N-methyltransferase                 182   1e-51   
ref|XP_009782224.1|  PREDICTED: phosphoethanolamine N-methyltrans...    182   1e-51   Nicotiana sylvestris
gb|ACJ83326.1|  unknown                                                 175   1e-51   Medicago truncatula
ref|XP_006843796.1|  hypothetical protein AMTR_s00007p00250490          182   2e-51   Amborella trichopoda
pir||H96762  hypothetical protein F6D5.1 [imported] - Arabidopsis...    183   2e-51
ref|XP_004137341.1|  PREDICTED: phosphoethanolamine N-methyltrans...    182   2e-51   Cucumis sativus [cucumbers]
ref|XP_010416170.1|  PREDICTED: phosphoethanolamine N-methyltrans...    182   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_004166029.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    182   3e-51   
ref|XP_010428286.1|  PREDICTED: phosphoethanolamine N-methyltrans...    181   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009385384.1|  PREDICTED: phosphoethanolamine N-methyltrans...    181   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF79704.1|AC020889_12  T1N15.22                                     173   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011039130.1|  PREDICTED: phosphomethylethanolamine N-methy...    181   4e-51   Populus euphratica
ref|XP_010921197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    181   4e-51   Elaeis guineensis
ref|XP_011014101.1|  PREDICTED: phosphomethylethanolamine N-methy...    181   4e-51   Populus euphratica
ref|XP_011008809.1|  PREDICTED: phosphomethylethanolamine N-methy...    181   5e-51   Populus euphratica
gb|KDP23923.1|  hypothetical protein JCGZ_27083                         181   5e-51   Jatropha curcas
dbj|BAJ97525.1|  predicted protein                                      181   6e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010921161.1|  PREDICTED: phosphoethanolamine N-methyltrans...    181   6e-51   Elaeis guineensis
ref|XP_011008808.1|  PREDICTED: phosphomethylethanolamine N-methy...    181   6e-51   Populus euphratica
dbj|BAH01482.1|  unnamed protein product                                181   6e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008453479.1|  PREDICTED: phosphoethanolamine N-methyltrans...    181   6e-51   Cucumis melo [Oriental melon]
ref|XP_002322102.2|  hypothetical protein POPTR_0015s04540g             181   7e-51   
ref|XP_010921188.1|  PREDICTED: phosphoethanolamine N-methyltrans...    181   9e-51   
ref|XP_009404071.1|  PREDICTED: phosphomethylethanolamine N-methy...    180   9e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001043957.1|  Os01g0695100                                       180   9e-51   
gb|AAS57723.1|  phosphoethanolamine N-methyltransferase                 180   1e-50   Oryza sativa [red rice]
gb|EEE55232.1|  hypothetical protein OsJ_03109                          180   1e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008464197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    179   2e-50   Cucumis melo [Oriental melon]
ref|XP_003567962.1|  PREDICTED: phosphomethylethanolamine N-methy...    179   2e-50   Brachypodium distachyon [annual false brome]
ref|XP_004961340.1|  PREDICTED: phosphoethanolamine N-methyltrans...    179   3e-50   Setaria italica
ref|XP_006365411.1|  PREDICTED: phosphoethanolamine N-methyltrans...    179   3e-50   Solanum tuberosum [potatoes]
ref|XP_010471422.1|  PREDICTED: phosphoethanolamine N-methyltrans...    179   4e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009595958.1|  PREDICTED: phosphoethanolamine N-methyltrans...    179   4e-50   Nicotiana tomentosiformis
ref|XP_004241642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    179   4e-50   Solanum lycopersicum
ref|XP_006302164.1|  hypothetical protein CARUB_v10020173mg             178   5e-50   Capsella rubella
ref|XP_003534138.1|  PREDICTED: phosphoethanolamine N-methyltrans...    178   6e-50   
ref|XP_004969637.1|  PREDICTED: phosphoethanolamine N-methyltrans...    178   6e-50   Setaria italica
ref|NP_177501.2|  putative phosphoethanolamine N-methyltransferase 3    178   7e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004512744.1|  PREDICTED: phosphoethanolamine N-methyltrans...    177   9e-50   Cicer arietinum [garbanzo]
ref|XP_008799222.1|  PREDICTED: phosphomethylethanolamine N-methy...    177   9e-50   
gb|AFW04224.1|  phosphoethanolamine N-methyl transferase                177   9e-50   Suaeda maritima
gb|AAM97038.1|  phosphoethanolamine N-methyltransferase, putative       175   9e-50   Arabidopsis thaliana [mouse-ear cress]
gb|ABK42071.1|  phosphoethanolamine N-methyltransferase                 177   1e-49   Suaeda liaotungensis
ref|XP_010471421.1|  PREDICTED: phosphoethanolamine N-methyltrans...    177   1e-49   Camelina sativa [gold-of-pleasure]
dbj|BAC57432.1|  phosphoethanolamine N-methyltransferase                177   1e-49   Suaeda japonica
ref|XP_004161835.1|  PREDICTED: phosphoethanolamine N-methyltrans...    177   1e-49   
ref|XP_006655550.1|  PREDICTED: phosphoethanolamine N-methyltrans...    177   2e-49   Oryza brachyantha
ref|XP_010428285.1|  PREDICTED: phosphoethanolamine N-methyltrans...    177   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006390538.1|  hypothetical protein EUTSA_v10018431mg             177   2e-49   Eutrema salsugineum [saltwater cress]
ref|XP_003525185.1|  PREDICTED: phosphoethanolamine N-methyltrans...    176   3e-49   
ref|XP_002887491.1|  predicted protein                                  176   3e-49   
ref|XP_006393388.1|  hypothetical protein EUTSA_v10012068mg             170   4e-49   
ref|NP_001169597.1|  uncharacterized LOC100383478                       176   4e-49   Zea mays [maize]
ref|XP_007160542.1|  hypothetical protein PHAVU_002G330400g             176   4e-49   Phaseolus vulgaris [French bean]
ref|XP_007160543.1|  hypothetical protein PHAVU_002G330400g             176   5e-49   Phaseolus vulgaris [French bean]
gb|KFK41794.1|  hypothetical protein AALP_AA2G173000                    176   6e-49   Arabis alpina [alpine rockcress]
ref|XP_004137500.1|  PREDICTED: phosphoethanolamine N-methyltrans...    175   7e-49   Cucumis sativus [cucumbers]
ref|XP_002441466.1|  hypothetical protein SORBIDRAFT_09g027360          175   8e-49   Sorghum bicolor [broomcorn]
ref|XP_004512745.1|  PREDICTED: phosphoethanolamine N-methyltrans...    175   8e-49   Cicer arietinum [garbanzo]
dbj|BAG50404.1|  methyltransferase                                      166   1e-48   Cardamine sp. SIM-2007
ref|NP_974139.2|  putative phosphoethanolamine N-methyltransferase 3    174   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003619836.1|  Phosphoethanolamine N-methyltransferase            174   2e-48   Medicago truncatula
ref|NP_175293.1|  phosphoethanolamine N-methyltransferase 2             172   4e-48   Arabidopsis thaliana [mouse-ear cress]
gb|ABG57185.1|  phosphoethanolamine N-methyltransferase                 173   6e-48   Salicornia europaea [chicken-claws]
dbj|BAE99185.1|  putative phosphoethanolamine N-methyltransferase       173   6e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93681.1|  BnaA06g03670D                                          172   8e-48   
ref|XP_002456193.1|  hypothetical protein SORBIDRAFT_03g031940          172   8e-48   Sorghum bicolor [broomcorn]
emb|CDY40594.1|  BnaC06g02100D                                          172   9e-48   Brassica napus [oilseed rape]
ref|XP_008675146.1|  PREDICTED: phosphoethanolamine N-methyltrans...    172   1e-47   Zea mays [maize]
ref|XP_008675144.1|  PREDICTED: phosphoethanolamine N-methyltrans...    172   1e-47   
tpg|DAA57997.1|  TPA: putative phosphoethanolamine N-methyltransf...    171   2e-47   
gb|AAV67950.1|  putative phosphoethanolamine N-methyltransferase        171   2e-47   Zea mays [maize]
ref|XP_006393387.1|  hypothetical protein EUTSA_v10011451mg             171   3e-47   
gb|KJB53041.1|  hypothetical protein B456_008G289900                    167   3e-46   Gossypium raimondii
gb|AAL40895.1|  phosphoethanolamine methyltransferase                   168   3e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002317875.2|  Phosphoethanolamine N-methyltransferase 1 fa...    159   3e-46   
gb|KJB53038.1|  hypothetical protein B456_008G289900                    167   4e-46   Gossypium raimondii
gb|KJB53040.1|  hypothetical protein B456_008G289900                    167   5e-46   Gossypium raimondii
gb|KJB53039.1|  hypothetical protein B456_008G289900                    167   5e-46   Gossypium raimondii
ref|XP_010461685.1|  PREDICTED: phosphomethylethanolamine N-methy...    161   5e-46   Camelina sativa [gold-of-pleasure]
gb|AFZ78648.1|  methyl transferase                                      164   1e-44   Populus tomentosa [Chinese white poplar]
ref|XP_010921205.1|  PREDICTED: phosphoethanolamine N-methyltrans...    163   2e-44   
ref|XP_010500398.1|  PREDICTED: phosphomethylethanolamine N-methy...    163   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_001763293.1|  predicted protein                                  162   3e-44   
ref|XP_002454522.1|  hypothetical protein SORBIDRAFT_04g032625          151   2e-43   
ref|XP_010655650.1|  PREDICTED: phosphomethylethanolamine N-methy...    158   2e-42   Vitis vinifera
ref|XP_002284594.1|  PREDICTED: phosphoethanolamine N-methyltrans...    158   2e-42   Vitis vinifera
gb|ABK24808.1|  unknown                                                 155   9e-42   Picea sitchensis
emb|CDX92181.1|  BnaA05g22260D                                          155   2e-41   
gb|KJB30120.1|  hypothetical protein B456_005G132000                    154   5e-41   Gossypium raimondii
ref|XP_006306318.1|  hypothetical protein CARUB_v10012188mg             151   9e-41   
ref|XP_001768934.1|  predicted protein                                  152   1e-40   
gb|EEC79642.1|  hypothetical protein OsI_20868                          150   2e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_002969650.1|  hypothetical protein SELMODRAFT_146547             148   6e-39   Selaginella moellendorffii
ref|XP_002970912.1|  hypothetical protein SELMODRAFT_270875             148   6e-39   Selaginella moellendorffii
emb|CDX95799.1|  BnaC05g35500D                                          145   4e-38   
gb|KHN10536.1|  Phosphoethanolamine N-methyltransferase                 143   3e-37   Glycine soja [wild soybean]
gb|KDD75565.1|  hypothetical protein H632_c615p0                        139   6e-37   Helicosporidium sp. ATCC 50920
gb|KIZ00652.1|  hypothetical protein MNEG_7307                          136   3e-36   Monoraphidium neglectum
ref|XP_011399976.1|  Phosphoethanolamine N-methyltransferase            139   1e-35   Auxenochlorella protothecoides
ref|XP_006303561.1|  hypothetical protein CARUB_v10011038mg             137   6e-35   
gb|AGO59019.1|  heat responsive transcription factor protein            136   9e-35   Triticum aestivum [Canadian hard winter wheat]
emb|CBI26879.3|  unnamed protein product                                135   3e-34   Vitis vinifera
ref|XP_002730517.1|  PREDICTED: phosphoethanolamine N-methyltrans...    129   4e-34   Saccoglossus kowalevskii
ref|XP_002594091.1|  hypothetical protein BRAFLDRAFT_68467              127   1e-32   Branchiostoma floridae
gb|EPS69227.1|  hypothetical protein M569_05544                         127   8e-32   Genlisea aurea
ref|XP_002594089.1|  hypothetical protein BRAFLDRAFT_118790             129   1e-31   Branchiostoma floridae
ref|XP_004166030.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    128   1e-31   
ref|XP_004137342.1|  PREDICTED: phosphoethanolamine N-methyltrans...    128   1e-31   Cucumis sativus [cucumbers]
ref|XP_010540184.1|  PREDICTED: phosphoethanolamine N-methyltrans...    127   3e-31   Tarenaya hassleriana [spider flower]
ref|XP_002594077.1|  hypothetical protein BRAFLDRAFT_68483              124   4e-31   Branchiostoma floridae
ref|XP_009011308.1|  hypothetical protein HELRODRAFT_71964              122   7e-31   Helobdella robusta
ref|XP_005643867.1|  S-adenosyl-L-methionine-dependent methyltran...    125   9e-31   Coccomyxa subellipsoidea C-169
ref|XP_005096334.1|  PREDICTED: phosphoethanolamine N-methyltrans...    121   2e-29   Aplysia californica
gb|EWM27854.1|  phosphoethanolamine n-methyltransferase                 122   4e-29   Nannochloropsis gaditana
ref|XP_008324913.1|  PREDICTED: phosphoethanolamine N-methyltrans...    120   4e-29   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008324912.1|  PREDICTED: phosphoethanolamine N-methyltrans...    120   5e-29   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008324914.1|  PREDICTED: phosphoethanolamine N-methyltrans...    120   6e-29   Cynoglossus semilaevis [half-smooth tongue sole]
gb|ETM43048.1|  hypothetical protein L914_11412                         116   1e-28   Phytophthora parasitica
ref|XP_010231068.1|  PREDICTED: phosphomethylethanolamine N-methy...    119   2e-28   Brachypodium distachyon [annual false brome]
gb|EAY75471.1|  hypothetical protein OsI_03371                          119   2e-28   Oryza sativa Indica Group [Indian rice]
ref|NP_001096276.2|  phosphoethanolamine methyltransferase              119   2e-28   Xenopus tropicalis [western clawed frog]
ref|XP_006003521.1|  PREDICTED: phosphoethanolamine N-methyltrans...    116   3e-28   
ref|XP_008418601.1|  PREDICTED: phosphoethanolamine N-methyltrans...    118   3e-28   Poecilia reticulata
ref|XP_005855505.1|  phosphoethanolamine n-methyltransferase            119   3e-28   Nannochloropsis gaditana CCMP526
ref|XP_008418600.1|  PREDICTED: phosphoethanolamine N-methyltrans...    118   3e-28   Poecilia reticulata
emb|CDQ92053.1|  unnamed protein product                                112   3e-28   Oncorhynchus mykiss
ref|XP_008278559.1|  PREDICTED: phosphoethanolamine N-methyltrans...    118   4e-28   Stegastes partitus
gb|ETK83171.1|  hypothetical protein L915_11577                         114   4e-28   Phytophthora parasitica
ref|XP_008278560.1|  PREDICTED: phosphoethanolamine N-methyltrans...    118   4e-28   Stegastes partitus
ref|XP_007550439.1|  PREDICTED: phosphoethanolamine N-methyltrans...    118   5e-28   Poecilia formosa
ref|XP_005096335.1|  PREDICTED: phosphoethanolamine N-methyltrans...    117   7e-28   Aplysia californica
gb|ETL36539.1|  hypothetical protein L916_11495                         114   1e-27   Phytophthora parasitica
ref|XP_002898137.1|  phosphoethanolamine N-methyltransferase, put...    117   2e-27   Phytophthora infestans T30-4
ref|XP_005806845.1|  PREDICTED: phosphoethanolamine N-methyltrans...    116   2e-27   Xiphophorus maculatus
ref|XP_005723169.1|  PREDICTED: phosphoethanolamine N-methyltrans...    115   4e-27   Pundamilia nyererei
ref|XP_005723168.1|  PREDICTED: phosphoethanolamine N-methyltrans...    115   4e-27   
ref|XP_005723167.1|  PREDICTED: phosphoethanolamine N-methyltrans...    115   5e-27   Pundamilia nyererei
gb|AAI35513.1|  LOC100124841 protein                                    115   5e-27   Xenopus tropicalis [western clawed frog]
ref|XP_005467629.1|  PREDICTED: phosphoethanolamine N-methyltrans...    114   6e-27   Oreochromis niloticus
ref|XP_003444639.1|  PREDICTED: phosphoethanolamine N-methyltrans...    114   7e-27   Oreochromis niloticus
ref|XP_005467627.1|  PREDICTED: phosphoethanolamine N-methyltrans...    114   7e-27   Oreochromis niloticus
ref|XP_008620239.1|  hypothetical protein SDRG_15833                    114   8e-27   Saprolegnia diclina VS20
ref|XP_010864863.1|  PREDICTED: phosphoethanolamine N-methyltrans...    114   9e-27   Esox lucius
gb|KDO18851.1|  hypothetical protein SPRG_15850                         114   1e-26   Saprolegnia parasitica CBS 223.65
ref|XP_006781399.1|  PREDICTED: phosphoethanolamine N-methyltrans...    114   1e-26   Neolamprologus brichardi [lyretail cichlid]
ref|NP_001087172.1|  phosphoethanolamine methyltransferase              113   2e-26   Xenopus laevis [clawed frog]
ref|XP_010730440.1|  PREDICTED: phosphomethylethanolamine N-methy...    113   2e-26   
ref|XP_005913451.1|  PREDICTED: phosphoethanolamine N-methyltrans...    113   2e-26   Haplochromis burtoni
ref|XP_004545582.1|  PREDICTED: phosphoethanolamine N-methyltrans...    113   2e-26   
ref|XP_010730439.1|  PREDICTED: phosphomethylethanolamine N-methy...    113   2e-26   
ref|XP_004545581.1|  PREDICTED: phosphoethanolamine N-methyltrans...    113   2e-26   
ref|XP_005913450.1|  PREDICTED: phosphoethanolamine N-methyltrans...    113   2e-26   Haplochromis burtoni
ref|XP_008872791.1|  hypothetical protein H310_08714                    113   2e-26   Aphanomyces invadans
ref|XP_009061459.1|  hypothetical protein LOTGIDRAFT_219756             113   3e-26   Lottia gigantea
ref|NP_001167350.1|  phosphoethanolamine N-methyltransferase 3          112   3e-26   Salmo salar
ref|XP_009832411.1|  hypothetical protein H257_08283                    112   4e-26   Aphanomyces astaci
gb|AHY01341.1|  phosphoethanolamine methyltransferase                   108   5e-26   Carassius gibelio [gibel carp]
ref|XP_004073222.1|  PREDICTED: phosphoethanolamine N-methyltrans...    112   6e-26   
ref|XP_008453688.1|  PREDICTED: phosphoethanolamine N-methyltrans...    107   9e-26   Cucumis melo [Oriental melon]
gb|ETI43103.1|  hypothetical protein F443_11871                         106   4e-25   Phytophthora parasitica P1569
ref|XP_003970259.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   5e-25   
gb|ETP27600.1|  hypothetical protein F442_23122                         107   8e-25   Phytophthora parasitica P10297
gb|ETP40954.1|  hypothetical protein F442_11792                         107   8e-25   Phytophthora parasitica P10297
ref|NP_001070105.1|  phosphoethanolamine methyltransferase              108   2e-24   Danio rerio [leopard danio]
emb|CAG09731.1|  unnamed protein product                                108   2e-24   Tetraodon nigroviridis
gb|ETL89752.1|  hypothetical protein L917_11366                         106   2e-24   Phytophthora parasitica
gb|ETK83144.1|  hypothetical protein L915_11579                         106   3e-24   Phytophthora parasitica
ref|XP_007440631.1|  PREDICTED: phosphomethylethanolamine N-methy...    106   5e-24   
ref|XP_009525377.1|  hypothetical protein PHYSODRAFT_354467             105   8e-24   Phytophthora sojae
emb|CAN75113.1|  hypothetical protein VITISV_043577                     105   1e-23   Vitis vinifera
gb|EMT23240.1|  Phosphoethanolamine N-methyltransferase 1               105   2e-23   
emb|CBI26877.3|  unnamed protein product                                105   2e-23   
ref|XP_010655490.1|  PREDICTED: phosphomethylethanolamine N-methy...    105   2e-23   
ref|XP_002898136.1|  phosphoethanolamine N-methyltransferase            105   3e-23   
gb|ELU13998.1|  hypothetical protein CAPTEDRAFT_140071                99.8    7e-23   
ref|XP_009525359.1|  hypothetical protein PHYSODRAFT_345888             103   8e-23   
emb|CCA16454.1|  phosphoethanolamine Nmethyltransferase putative        103   8e-23   
emb|CCI39434.1|  unnamed protein product                                101   5e-22   
gb|ELU02022.1|  hypothetical protein CAPTEDRAFT_91785                 98.6    5e-22   
gb|EMT23241.1|  Phosphoethanolamine N-methyltransferase 1               100   3e-21   
gb|ELT87122.1|  hypothetical protein CAPTEDRAFT_189076                99.0    4e-21   
gb|ETN83758.1|  methyltransferase domain protein                      97.1    1e-20   
gb|EMT23242.1|  Putative phosphoethanolamine N-methyltransferase 2    95.5    2e-20   
ref|XP_011453570.1|  PREDICTED: phosphoethanolamine N-methyltrans...  96.3    4e-20   
ref|XP_011453569.1|  PREDICTED: phosphoethanolamine N-methyltrans...  96.3    4e-20   
emb|CDJ81011.1|  Methyltransferase type 11 domain containing protein  94.7    1e-19   
gb|EYC44164.1|  hypothetical protein Y032_0470g2031                   94.4    1e-19   
ref|XP_011453571.1|  PREDICTED: phosphoethanolamine N-methyltrans...  94.4    2e-19   
ref|NP_494990.2|  Protein PMT-1, isoform a                            94.0    2e-19   
ref|XP_003108788.1|  CRE-PMT-1 protein                                94.0    2e-19   
ref|NP_871998.1|  Protein PMT-1, isoform d                            93.6    2e-19   
ref|XP_002630685.1|  C. briggsae CBR-PMT-1 protein                    93.2    4e-19   
ref|NP_494991.1|  Protein PMT-1, isoform b                            92.8    6e-19   
ref|XP_010677350.1|  PREDICTED: phosphoethanolamine N-methyltrans...  92.4    6e-19   
gb|KFM80232.1|  Phosphoethanolamine N-methyltransferase               89.7    8e-19   
gb|EFX73213.1|  hypothetical protein DAPPUDRAFT_58148                 92.4    8e-19   
gb|EGT50464.1|  hypothetical protein CAEBREN_10892                    92.0    1e-18   
gb|EGT32041.1|  hypothetical protein CAEBREN_18341                    92.0    1e-18   
ref|XP_006824126.1|  PREDICTED: phosphoethanolamine N-methyltrans...  88.6    1e-18   
pdb|4KRG|A  Chain A, Semet Haemonchus Contortus Phosphoethanolami...  89.7    7e-18   
ref|XP_009862400.1|  PREDICTED: phosphoethanolamine N-methyltrans...  82.0    4e-16   
gb|ERG79882.1|  phosphoethanolamine n-methyltransferase               82.4    3e-15   
gb|EKE08147.1|  Phosphoethanolamine N-methyltransferase               78.2    9e-15   
gb|ETO35874.1|  phosphoethanolamine N-methyltransferase 2 (NMT2)      76.6    6e-14   
gb|AFW78992.1|  hypothetical protein ZEAMMB73_932976                  72.0    4e-13   
gb|EMT23239.1|  hypothetical protein F775_30181                       68.9    2e-12   
gb|ETO71769.1|  hypothetical protein F444_11956                       68.9    3e-12   
gb|ETP40963.1|  hypothetical protein F442_11783                       68.9    4e-12   
emb|CDY07952.1|  BnaC03g35710D                                        72.0    9e-12   
emb|CEF71262.1|  Protein of unknown function DUF858, methyltransf...  70.9    2e-11   
ref|WP_013610264.1|  Putative SAM-dependent methyltransferase         68.6    3e-11   
emb|CDX74572.1|  BnaA04g08170D                                        69.3    6e-11   
ref|WP_027370305.1|  hypothetical protein                             65.5    3e-10   
ref|WP_020209191.1|  hypothetical protein                             67.0    5e-10   
ref|XP_011403472.1|  PREDICTED: phosphoethanolamine N-methyltrans...  64.7    3e-09   
ref|XP_010481025.1|  PREDICTED: phosphomethylethanolamine N-methy...  64.7    3e-09   
emb|CDY35847.1|  BnaC09g37790D                                        62.0    2e-08   
gb|ETL89780.1|  hypothetical protein L917_11359                       55.8    1e-07   
gb|KIH63696.1|  hypothetical protein ANCDUO_06001                     55.8    2e-07   
ref|XP_794381.2|  PREDICTED: phosphoethanolamine N-methyltransfer...  58.5    3e-07   
emb|CDM83854.1|  unnamed protein product                              58.5    3e-07   
gb|KIH53398.1|  hypothetical protein ANCDUO_16477                     53.9    8e-07   
gb|AFK40181.1|  unknown                                               52.4    2e-06   
ref|XP_008908105.1|  hypothetical protein PPTG_12690                  53.1    2e-06   
gb|ETO71745.1|  hypothetical protein F444_11961                       53.5    3e-06   
gb|ETO07474.1|  hypothetical protein RFI_29918                        51.6    1e-05   
gb|ETO01952.1|  hypothetical protein RFI_35487                        50.4    2e-05   
gb|KFM98367.1|  methyltransferase small domain protein                51.6    5e-05   
ref|WP_036624290.1|  rRNA adenine methyltransferase                   51.6    5e-05   
gb|AER27603.1|  phosphoethanolamine N-methyltransferase               48.1    5e-05   
ref|WP_035774675.1|  hypothetical protein                             50.1    2e-04   
ref|WP_041268184.1|  hypothetical protein                             48.5    2e-04   
gb|ABZ87545.1|  methyltransferase type 11                             48.5    3e-04   
dbj|GAF27217.1|  methylase                                            48.5    3e-04   
emb|CAJ20397.1|  hypothetical protein TgIa.1450                       49.3    5e-04   
ref|XP_002370184.1|  calpain, putative                                49.3    5e-04   
gb|KFG31924.1|  methyltransferase domain-containing protein           48.9    5e-04   
gb|KFH03254.1|  methyltransferase domain-containing protein           48.9    5e-04   
gb|KFG59470.1|  methyltransferase domain-containing protein           48.9    5e-04   
ref|WP_027398656.1|  hypothetical protein                             48.5    5e-04   
ref|XP_010774827.1|  PREDICTED: phosphoethanolamine N-methyltrans...  48.5    6e-04   
ref|WP_002137162.1|  methyltransferase                                48.1    7e-04   
ref|XP_008884763.1|  methyltransferase domain-containing protein      48.5    7e-04   
ref|WP_040217132.1|  hypothetical protein                             47.8    8e-04   
ref|WP_038589229.1|  methyltransferase type 11                        47.8    9e-04   
ref|WP_036902511.1|  methyltransferase type 12                        45.8    0.001   



>ref|XP_007209941.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11140.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=463

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPD  112



>ref|XP_007209942.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11141.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=491

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPD  112



>ref|XP_007209943.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11142.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=493

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPD  112



>ref|NP_001234549.1| phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
 gb|AAG59894.1|AF328858_1 phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=491

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA  G+EREVQKSYWIEH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGK+VLEL
Sbjct  1    MAAASGQEREVQKSYWIEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKTVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAGQ+IA+DFIE  IKKNE INGH  N+KFMCADVTS +
Sbjct  61   GAGIGRFTGELAQKAGQLIALDFIEGAIKKNENINGHYKNVKFMCADVTSPN  112



>ref|XP_009616694.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=491

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA  G+EREVQKSYW+EH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAATSGQEREVQKSYWMEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELA+KAGQ+IA+DFIE  IKKNE+INGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAKKAGQLIALDFIEGAIKKNESINGHHKNVKFMCADVTSPD  112



>ref|XP_011084235.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Sesamum indicum]
Length=491

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA Q +EREVQKSYWIEHS +LT+EAMMLDSKA+DLDKEERPEVLS+LP YEGKS+LEL
Sbjct  1    MAAIQEQEREVQKSYWIEHSVDLTLEAMMLDSKASDLDKEERPEVLSLLPPYEGKSILEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELA+K+GQ+IA+DFIE+VIKKNETINGH  N+KF+CADVTS+D
Sbjct  61   GAGIGRFTGELAKKSGQLIALDFIETVIKKNETINGHHKNVKFLCADVTSRD  112



>ref|XP_010533969.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Tarenaya 
hassleriana]
Length=491

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MA+  GEERE+QKSYW+EHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MASSYGEEREIQKSYWMEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  N+KFMC DVTS D
Sbjct  61   GAGIGRFTGELAQKAGEVIAIDFIESAIKKNESVNGHYKNVKFMCMDVTSPD  112



>ref|XP_010487710.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Camelina sativa]
Length=491

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPD  112



>ref|XP_008364653.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 106/113 (94%), Gaps = 1/113 (1%)
 Frame = +3

Query  150  MAAF-QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  326
            MAAF  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+E
Sbjct  1    MAAFANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVVE  60

Query  327  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LGAGIGRFTGELA+KAGQ+ A+DFI+SVIKKNE+INGH  N+KFMCADVTS D
Sbjct  61   LGAGIGRFTGELAEKAGQLFALDFIDSVIKKNESINGHHKNVKFMCADVTSPD  113



>ref|XP_009757363.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=491

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA  G+EREVQKSYW+EH++ELTVEAMMLDSKAADLDKEERPEV+S+LP YEGKSVLEL
Sbjct  1    MAATSGQEREVQKSYWMEHTAELTVEAMMLDSKAADLDKEERPEVVSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELA+KAGQ+IA+DFIE  IKKNE+INGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAKKAGQLIALDFIEGAIKKNESINGHHKNVKFMCADVTSPD  112



>ref|XP_010506242.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Camelina sativa]
Length=491

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPD  112



>ref|XP_008240154.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Prunus mume]
Length=485

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAANGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFT ELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTAELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPD  112



>ref|XP_008240152.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Prunus mume]
Length=491

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAANGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFT ELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTAELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPD  112



>ref|XP_009614862.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=499

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +3

Query  135  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  314
            ++ +A  A  G+ER+VQK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP+YEGK
Sbjct  4    VISAATTASSGQERDVQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPSYEGK  63

Query  315  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            SVLELGAGIGRFTGELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS D
Sbjct  64   SVLELGAGIGRFTGELAKNAGQLIALDFIESAIKKNESINRHHKNVKFMCADVTSPD  120



>ref|XP_010465872.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Camelina 
sativa]
Length=491

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG++IA+DFI+SVI+KNET+NGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIEKNETVNGHYKNVKFMCADVTSPD  112



>ref|XP_002883100.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59359.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPD  112



>ref|XP_008360927.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Malus domestica]
Length=492

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +3

Query  153  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  332
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  333  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADVTS D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVTSPD  113



>ref|XP_002282182.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Vitis 
vinifera]
 emb|CBI15568.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA  G+ERE+QK+YW EHS++LTVEAMMLDSKAADLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAAQVGQEREIQKNYWAEHSADLTVEAMMLDSKAADLDKEERPEVLSLLPPFEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            GAGIGRFTGELAQKAGQVI++DFIESVIKKNE+INGH  N+KFMCADV S
Sbjct  61   GAGIGRFTGELAQKAGQVISLDFIESVIKKNESINGHYKNVKFMCADVAS  110



>ref|NP_973993.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 sp|Q944H0.2|PEAM2_ARATH RecName: Full=Phosphomethylethanolamine N-methyltransferase; 
Short=AtPMEAMT; AltName: Full=Phosphoethanolamine N-methyltransferase 
2 [Arabidopsis thaliana]
 gb|AEE32323.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=491

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MA    EER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLEL
Sbjct  1    MATPYKEERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG+VIA+DFIES I+KNE++NGH  NIKFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPD  112



>gb|KJB30121.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=422

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +3

Query  147  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  326
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  327  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS D
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPD  114



>gb|AAM13092.1| unknown protein [Arabidopsis thaliana]
Length=491

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPD  112



>ref|NP_188427.2| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
 sp|Q9FR44.1|PEAM1_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 1; Short=AtNMT1; 
Short=PEAMT 1; AltName: Full=Protein XIPOTL 1 [Arabidopsis 
thaliana]
 gb|AAG41121.1|AF197940_1 SAM:phospho-ethanolamine N-methyltransferase [Arabidopsis thaliana]
 gb|AAK32886.1|AF367299_1 AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAL25589.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAM10282.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AEE76033.1| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
Length=491

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPD  112



>dbj|BAB02720.1| methyl transferase-like protein [Arabidopsis thaliana]
Length=498

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPD  112



>ref|XP_010487709.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Camelina sativa]
Length=494

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  10   EERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLELGAGIGR  69

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS D
Sbjct  70   FTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPD  115



>ref|XP_006297517.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
 gb|EOA30415.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
Length=491

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE+INGH  N+KF+CADVTS D
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESINGHYKNVKFLCADVTSPD  112



>gb|AAP83582.1| phosphoethanolamine N-methyltransferase [Brassica napus]
Length=491

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA    ER+VQK+YWIEHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEAERDVQKNYWIEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPD  112



>ref|XP_002891445.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67704.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MA    +ER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLEL
Sbjct  1    MATPYKKERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  NIKFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIKKNESVNGHYKNIKFMCADVTSPD  112



>ref|XP_002532097.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
 gb|EEF30287.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
Length=492

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 104/112 (93%), Gaps = 1/112 (1%)
 Frame = +3

Query  150  MAAFQG-EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  326
            MAA Q  EEREVQK+YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLS+LP+YEGKSVLE
Sbjct  1    MAAAQNVEEREVQKNYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSLLPSYEGKSVLE  60

Query  327  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSK  482
             GAGIGRFTGELAQKAGQ++A+DFIESVIKKNE INGH  N+KFMCADVTS+
Sbjct  61   FGAGIGRFTGELAQKAGQLVAVDFIESVIKKNENINGHHKNVKFMCADVTSQ  112



>gb|ABX10444.1| phosphoethanolamine N-methyltransferase [Gossypium hirsutum]
Length=475

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +3

Query  147  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  326
            A   F G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGFVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  327  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS D
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPD  114



>ref|XP_009145948.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Brassica 
rapa]
Length=492

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 106/113 (94%), Gaps = 1/113 (1%)
 Frame = +3

Query  147  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  326
            A A+F+ E R+VQK+YWIEHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLE
Sbjct  2    AAASFEAE-RDVQKNYWIEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLE  60

Query  327  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LGAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS D
Sbjct  61   LGAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPD  113



>ref|XP_011072995.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Sesamum 
indicum]
Length=491

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA Q +EREVQKSYW+EHS +LT+EAMMLDS A DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAANQEQEREVQKSYWMEHSVDLTLEAMMLDSNACDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELA+KAG+++A+DFIESVIKKNETINGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAKKAGELVALDFIESVIKKNETINGHNKNVKFMCADVTSPD  112



>ref|XP_010506234.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Camelina sativa]
Length=494

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  10   EERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLELGAGIGR  69

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS D
Sbjct  70   FTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPD  115



>gb|KJB30119.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=443

 Score =   192 bits (489),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +3

Query  147  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  326
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  327  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS D
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPD  114



>gb|KHG16117.1| Phosphoethanolamine N-methyltransferase 1 -like protein [Gossypium 
arboreum]
Length=486

 Score =   193 bits (491),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +3

Query  147  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  326
            A   F G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGFVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  327  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS D
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPD  114



>ref|XP_006406666.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
 gb|ESQ48119.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
Length=491

 Score =   193 bits (491),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPFEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPD  112



>gb|KJB30123.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=464

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +3

Query  147  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  326
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  327  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS D
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPD  114



>ref|XP_009356042.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 105/113 (93%), Gaps = 1/113 (1%)
 Frame = +3

Query  150  MAAF-QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  326
            MAAF  GEER VQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+E
Sbjct  1    MAAFANGEERAVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVVE  60

Query  327  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LGAGIGRFTGELA+KAGQ+ A+DFI+SVIKKNE+INGH  N+KF+CADVTS D
Sbjct  61   LGAGIGRFTGELAEKAGQLFALDFIDSVIKKNESINGHHKNVKFICADVTSPD  113



>ref|XP_008393424.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +3

Query  153  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  332
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+S +ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSXVELG  62

Query  333  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADVTS D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVTSPD  113



>ref|XP_009360079.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +3

Query  153  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  332
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  333  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADV S D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVASPD  113



>ref|XP_011084227.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Sesamum indicum]
Length=494

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +3

Query  159  FQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAG  338
            F  +EREVQKSYWIEHS +LT+EAMMLDSKA+DLDKEERPEVLS+LP YEGKS+LELGAG
Sbjct  7    FVEQEREVQKSYWIEHSVDLTLEAMMLDSKASDLDKEERPEVLSLLPPYEGKSILELGAG  66

Query  339  IGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            IGRFTGELA+K+GQ+IA+DFIE+VIKKNETINGH  N+KF+CADVTS+D
Sbjct  67   IGRFTGELAKKSGQLIALDFIETVIKKNETINGHHKNVKFLCADVTSRD  115



>ref|XP_010461752.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Camelina 
sativa]
Length=492

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER +QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGR
Sbjct  8    EERHIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGR  67

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS D
Sbjct  68   FTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPD  113



>ref|XP_004299531.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=500

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +3

Query  141  QSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  320
            ++A A   G+ERE+QKSYW E+S+ELTVE+MMLDSKA+DLDKEERPEVL+MLP YEGKSV
Sbjct  7    RTATANGSGKEREIQKSYWEENSTELTVESMMLDSKASDLDKEERPEVLAMLPPYEGKSV  66

Query  321  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LELGAGIGRFTGELAQKAGQ+IAMDFIE+VIKKNE+ING+  N+KFMCADVTS D
Sbjct  67   LELGAGIGRFTGELAQKAGQLIAMDFIENVIKKNESINGNHKNVKFMCADVTSPD  121



>gb|KJB30117.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=494

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +3

Query  147  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  326
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  327  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS D
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPD  114



>gb|KJB30122.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=491

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 104/112 (93%), Gaps = 1/112 (1%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA  G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LEL
Sbjct  1    MAA-NGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILEL  59

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS D
Sbjct  60   GAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPD  111



>emb|CAN64744.1| hypothetical protein VITISV_041321 [Vitis vinifera]
Length=490

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 103/110 (94%), Gaps = 1/110 (1%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA QG+ERE+QK+YW EHS++LTVEAMMLDSKAADLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAA-QGQEREIQKNYWAEHSADLTVEAMMLDSKAADLDKEERPEVLSLLPPFEGKSVLEL  59

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            GAGIGRFT ELAQKAGQVI++DFIESVIKKNE+INGH  N+KFMCADV S
Sbjct  60   GAGIGRFTXELAQKAGQVISLDFIESVIKKNESINGHYKNVKFMCADVAS  109



>gb|KFK39125.1| hypothetical protein AALP_AA3G204100 [Arabis alpina]
Length=491

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA   EER++QK+YWIEHS +LTVE+MMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSVDLTVESMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG++IA+DFI+SVI KNE++NGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVINKNESVNGHYKNVKFMCADVTSPD  112



>ref|XP_006303987.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
 gb|EOA36885.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
Length=491

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MA    EER +QKSYW+EHSS+LTVEAMMLDSKA DLDKEERPEVLS++P YEGK+VLEL
Sbjct  1    MATPYKEERHIQKSYWMEHSSDLTVEAMMLDSKATDLDKEERPEVLSLIPPYEGKTVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPD  112



>emb|CDO98349.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA +G+EREVQKSYWIEH+++LTVEAMMLDS AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAVEGQEREVQKSYWIEHTADLTVEAMMLDSMAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            GAGIGRFTGELA+KAGQ++A+DFIE  IKKNE+ING+L N KF+CADVTS
Sbjct  61   GAGIGRFTGELAKKAGQIVALDFIEGAIKKNESINGNLKNTKFICADVTS  110



>ref|XP_010097563.1| hypothetical protein L484_017373 [Morus notabilis]
 gb|EXB69095.1| hypothetical protein L484_017373 [Morus notabilis]
Length=503

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +3

Query  162  QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGI  341
             G+ERE QK YW++HS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSVLELGAGI
Sbjct  10   NGQEREKQKIYWMQHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVLELGAGI  69

Query  342  GRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GRFT ELAQKAGQ++AMDFIESVIKKNE+INGH  N+KFMCADVTS D
Sbjct  70   GRFTSELAQKAGQLVAMDFIESVIKKNESINGHYKNVKFMCADVTSPD  117



>ref|XP_010033717.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW84063.1| hypothetical protein EUGRSUZ_B00946 [Eucalyptus grandis]
Length=491

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA QG+ER VQKSYW EHS+ LTVEAMMLDSKA+DLDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAAAQGDERHVQKSYWAEHSASLTVEAMMLDSKASDLDKEERPEILSLLPPYEGKTVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAGQ++A+DFI+  IKKNE+INGH  N+KF CADVTS D
Sbjct  61   GAGIGRFTGELAQKAGQLLALDFIDGAIKKNESINGHHKNVKFQCADVTSPD  112



>ref|XP_009147956.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Brassica 
rapa]
Length=489

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MA     ER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLEL
Sbjct  1    MATPYKAERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  N+KFMCADVTS D
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPD  112



>ref|XP_010461683.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=492

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER +QKSYW+EHSS+LTVEAMMLDSKA+DLD+EERPEVLS++P YEGKSVLELGAGIGR
Sbjct  8    EERHIQKSYWMEHSSDLTVEAMMLDSKASDLDREERPEVLSLIPPYEGKSVLELGAGIGR  67

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS D
Sbjct  68   FTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPD  113



>ref|XP_006341528.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341529.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=491

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            M A  G+EREVQKSYWIEH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGK+VLEL
Sbjct  1    MDAASGQEREVQKSYWIEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKTVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELA KAGQ+IA+DFIE  IKKNE ING+  N+KFMCADVTS +
Sbjct  61   GAGIGRFTGELANKAGQLIALDFIEGAIKKNENINGYHKNVKFMCADVTSPN  112



>ref|XP_006376718.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 ref|XP_006376719.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 gb|ERP54515.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 gb|ERP54516.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
Length=135

 Score =   181 bits (459),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  6    EEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  65

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS D
Sbjct  66   FTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPD  111



>ref|XP_010519218.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Tarenaya hassleriana]
Length=510

 Score =   191 bits (486),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  138  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  317
            + S+++   GEERE+QKSYW EHS +L+VEAMMLDSKAADLDKEERPE+LS+LP YEGKS
Sbjct  7    ISSSLSKHNGEEREIQKSYWTEHSVDLSVEAMMLDSKAADLDKEERPEILSILPPYEGKS  66

Query  318  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            VLE GAGIGRFTGE A KAGQVIA+DFI+SVIKKNE INGH  N+KFMCADVTS
Sbjct  67   VLEFGAGIGRFTGEFALKAGQVIAVDFIDSVIKKNENINGHHKNVKFMCADVTS  120



>gb|AER10512.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
 gb|AER10513.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
Length=492

 Score =   191 bits (485),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +3

Query  153  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  332
            A+  GEEREVQK+YW+EHS++LTVEAMMLDS A+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSNASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  333  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADV S D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVASPD  113



>ref|XP_007036803.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY21304.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=494

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +EREVQK YW+EHS +LTVEAMMLDSKAADLDKEERPEVLS+LP YEGKS+LELGAGIGR
Sbjct  9    DEREVQKDYWMEHSLDLTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSILELGAGIGR  68

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELAQKAG VIA+DFIESVIKKNE+INGH  N KF+CADVTS D
Sbjct  69   FTGELAQKAGHVIALDFIESVIKKNESINGHYKNAKFLCADVTSPD  114



>gb|KFK36082.1| hypothetical protein AALP_AA4G075100 [Arabis alpina]
Length=492

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK+VLELGAGIGR
Sbjct  8    EERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKTVLELGAGIGR  67

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELAQKAG+VIA+DFIES IKKNE+ NGH  N+KFMCADVTS D
Sbjct  68   FTGELAQKAGEVIALDFIESAIKKNESDNGHYKNVKFMCADVTSPD  113



>ref|XP_007036802.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY21303.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=493

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +EREVQK YW+EHS +LTVEAMMLDSKAADLDKEERPEVLS+LP YEGKS+LELGAGIGR
Sbjct  9    DEREVQKDYWMEHSLDLTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSILELGAGIGR  68

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELAQKAG VIA+DFIESVIKKNE+INGH  N KF+CADVTS D
Sbjct  69   FTGELAQKAGHVIALDFIESVIKKNESINGHYKNAKFLCADVTSPD  114



>ref|XP_010263678.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nelumbo 
nucifera]
Length=489

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 105/112 (94%), Gaps = 1/112 (1%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA QG ERE+QKSYWIEHS +LTVEAMMLDSKA+DLDKEERPEVLS+LP ++GKSVLEL
Sbjct  1    MAA-QGGEREIQKSYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSLLPPFKGKSVLEL  59

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELA++AGQV+A+DFIE+VIKKNE+INGH  N+KF+CADVTS D
Sbjct  60   GAGIGRFTGELAKEAGQVLALDFIENVIKKNESINGHHKNVKFLCADVTSPD  111



>gb|AFW83641.1| hypothetical protein ZEAMMB73_560974 [Zea mays]
Length=244

 Score =   184 bits (466),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  165  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  344
             EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEGKSVLELGAGIG
Sbjct  18   AEERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEGKSVLELGAGIG  77

Query  345  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            RFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+D
Sbjct  78   RFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQD  124



>dbj|BAD80838.1| phosphoethanolamine N-methyltransferase [Atriplex nummularia]
Length=503

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = +3

Query  144  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  323
            SAM     EEREV K YW+EHS +LTVEAMMLDS+A+DLDKEERPEVLSMLP YEGKSVL
Sbjct  4    SAMGV--NEEREVFKKYWVEHSVDLTVEAMMLDSQASDLDKEERPEVLSMLPPYEGKSVL  61

Query  324  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            ELGAGIGRFTGELA+KAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS
Sbjct  62   ELGAGIGRFTGELAEKAGQVIALDFIESVIKKNECINGHYKNVKFMCADVTS  113



>gb|EYU33965.1| hypothetical protein MIMGU_mgv1a005263mg [Erythranthe guttata]
Length=491

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA Q EERE+QKSYW+EHS +LT+E+MMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAVQDEEREMQKSYWVEHSVDLTLESMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            GAGIGRFTGELA+KAGQ++A+DFIE  IKKNE INGH  N+KFMCADVTS
Sbjct  61   GAGIGRFTGELAKKAGQLVALDFIEGSIKKNEIINGHHKNVKFMCADVTS  110



>dbj|BAD93609.1| hypothetical protein [Cucumis melo]
Length=211

 Score =   182 bits (462),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  323
            +   A   +ER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVL
Sbjct  5    TPAPALNDDERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVL  64

Query  324  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            ELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +
Sbjct  65   ELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPE  118



>ref|XP_010519219.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Tarenaya hassleriana]
Length=499

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 100/110 (91%), Gaps = 1/110 (1%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA+ GEERE+QKSYW EHS +L+VEAMMLDSKAADLDKEERPE+LS+LP YEGKSVLE 
Sbjct  1    MAAY-GEEREIQKSYWTEHSVDLSVEAMMLDSKAADLDKEERPEILSILPPYEGKSVLEF  59

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            GAGIGRFTGE A KAGQVIA+DFI+SVIKKNE INGH  N+KFMCADVTS
Sbjct  60   GAGIGRFTGEFALKAGQVIAVDFIDSVIKKNENINGHHKNVKFMCADVTS  109



>gb|KDP23922.1| hypothetical protein JCGZ_27082 [Jatropha curcas]
Length=510

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EERE+Q++YW+EHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP+YEGKSVLE GAGIGR
Sbjct  26   EEREIQRNYWMEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPSYEGKSVLEFGAGIGR  85

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGE+AQ AGQ++A+DFI+SVIKKNE+INGH  N+KF+CADVTS+D
Sbjct  86   FTGEIAQNAGQLVALDFIDSVIKKNESINGHYKNVKFICADVTSQD  131



>gb|EPS65842.1| hypothetical protein M569_08933, partial [Genlisea aurea]
Length=487

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +EREVQKSYWIEHS +LTVEAMMLDSKA++LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  2    QEREVQKSYWIEHSGDLTVEAMMLDSKASELDKEERPEVLSLLPSYEGKSVLELGAGIGR  61

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGE+A+KA QV+A+DFIESVIKKNE INGH  N+KFMCADVTS D
Sbjct  62   FTGEIAKKADQVVALDFIESVIKKNEIINGHHKNVKFMCADVTSSD  107



>ref|XP_010274723.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Nelumbo nucifera]
Length=489

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 102/112 (91%), Gaps = 1/112 (1%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA Q EEREVQKSYWIEHSSELT+EAMMLDSKAADLDKEERPEVLS+LP ++GK VLEL
Sbjct  1    MAA-QVEEREVQKSYWIEHSSELTIEAMMLDSKAADLDKEERPEVLSLLPPFKGKDVLEL  59

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFT E A++A QV+A+DFIESVIKKNE++NGH  N+KF+CADVTS D
Sbjct  60   GAGIGRFTSEFAKEANQVLALDFIESVIKKNESVNGHFKNVKFLCADVTSPD  111



>ref|XP_003528975.2| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN44632.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=531

 Score =   189 bits (480),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 109/125 (87%), Gaps = 2/125 (2%)
 Frame = +3

Query  117  FYLFTAIVQSAMAAFQG--EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLS  290
             +LF++  Q  MA+     +ER VQ+SYWIEH+++L+VE+MMLDS A+DLDKEERPEVLS
Sbjct  29   LFLFSSFCQPYMASLATVQDERCVQRSYWIEHTTDLSVESMMLDSNASDLDKEERPEVLS  88

Query  291  MLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCAD  470
            +LPAYEGKSV+ELGAGIGRFTGELA+KAGQ++A+DFIES IKKNE+INGH  N+KFMCAD
Sbjct  89   LLPAYEGKSVVELGAGIGRFTGELAKKAGQLLAVDFIESAIKKNESINGHHKNVKFMCAD  148

Query  471  VTSKD  485
            VTS +
Sbjct  149  VTSPN  153



>gb|AFK34653.1| unknown [Lotus japonicus]
Length=198

 Score =   180 bits (457),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EEREVQKSYWIEHSS+L++E+MMLDS A++LDKEERPEVLS+LPA E KSV+ELGAGIGR
Sbjct  15   EEREVQKSYWIEHSSDLSMESMMLDSNASNLDKEERPEVLSLLPAIESKSVIELGAGIGR  74

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA+K+GQ++A+DFIES IKKNE+INGH  N+KFMCADVTS +
Sbjct  75   FTGELAKKSGQLLAVDFIESAIKKNESINGHHKNVKFMCADVTSPN  120



>gb|AEY75253.1| phosphoethanolamine N-methyltransferase [Atriplex canescens]
Length=494

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            EREV K YW+EHS +LTVEAMMLDS+A+DLDKEERPEVLSMLP YEGKSVLELGAGIGRF
Sbjct  11   EREVFKKYWVEHSVDLTVEAMMLDSQASDLDKEERPEVLSMLPPYEGKSVLELGAGIGRF  70

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            TGELA+KAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS
Sbjct  71   TGELAEKAGQVIALDFIESVIKKNECINGHYKNVKFMCADVTS  113



>ref|XP_010097561.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
 gb|EXB69093.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
Length=519

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  162  QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGI  341
             GEERE+QK+YW E+S++LT+E+MMLDSKA+DLDKEERPEVLS+LP +EGKSVLELGAGI
Sbjct  10   NGEEREIQKTYWTENSADLTIESMMLDSKASDLDKEERPEVLSVLPPFEGKSVLELGAGI  69

Query  342  GRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GRFTGELAQKAGQV+A+DFIESVIKKNE INGH  N+KFMCADVTS +
Sbjct  70   GRFTGELAQKAGQVLALDFIESVIKKNEEINGHYENVKFMCADVTSPE  117



>ref|XP_008799221.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Phoenix dactylifera]
Length=492

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = +3

Query  150  MAAFQGEE-REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  326
            MAAF GEE R VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSVLE
Sbjct  1    MAAFSGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSVLE  60

Query  327  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LGAGIGRFTGELA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS D
Sbjct  61   LGAGIGRFTGELAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPD  113



>gb|KDO63824.1| hypothetical protein CISIN_1g043471mg [Citrus sinensis]
Length=485

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ERE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GAGIGRF
Sbjct  9    EREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRF  68

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            TGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS D
Sbjct  69   TGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPD  113



>ref|XP_004252273.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Solanum lycopersicum]
Length=500

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  165  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  344
            G+ER++QK+YW+EH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLELGAGIG
Sbjct  15   GQERDIQKNYWMEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLELGAGIG  74

Query  345  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            RFT ELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS D
Sbjct  75   RFTSELAKNAGQLIALDFIESAIKKNESINKHHKNVKFMCADVTSPD  121



>dbj|BAC57960.1| phosphoethanolamine N-methyltransferase [Aster tripolium]
Length=493

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +3

Query  162  QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGI  341
             G+ERE+QK+YW+EHS +LTVE+MMLDS A+DLDKEERPEVLS+LP+YEGK VLELGAGI
Sbjct  6    NGDEREIQKNYWVEHSVDLTVESMMLDSMASDLDKEERPEVLSLLPSYEGKRVLELGAGI  65

Query  342  GRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GRFTGELA+ AG+VIA+DFIESV+KKNE+INGH  N+KFMCADVTS D
Sbjct  66   GRFTGELAKTAGEVIALDFIESVVKKNESINGHCKNVKFMCADVTSPD  113



>ref|XP_010686587.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +EREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   QEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            FTG+LA+KAGQVIA+DFIES IKKNE +NGH  N+KFMCADVTS
Sbjct  70   FTGDLAKKAGQVIALDFIESAIKKNECVNGHYKNVKFMCADVTS  113



>dbj|BAE07178.1| phosphoethanolamine N-methyltransferase [Beta vulgaris]
Length=494

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +EREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   QEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            FTG+LA+KAGQVIA+DFIES IKKNE +NGH  N+KFMCADVTS
Sbjct  70   FTGDLAKKAGQVIALDFIESAIKKNECVNGHYKNVKFMCADVTS  113



>ref|XP_008799219.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Phoenix dactylifera]
Length=494

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 101/115 (88%), Gaps = 3/115 (3%)
 Frame = +3

Query  150  MAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  320
            MAAF G   EER VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSV
Sbjct  1    MAAFSGAGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSV  60

Query  321  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LELGAGIGRFTGELA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS D
Sbjct  61   LELGAGIGRFTGELAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPD  115



>ref|XP_006490771.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Citrus sinensis]
Length=489

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ERE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GAGIGRF
Sbjct  6    EREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRF  65

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            TGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS D
Sbjct  66   TGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPD  110



>ref|XP_006451624.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
 ref|XP_006490770.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Citrus sinensis]
 gb|ESR64864.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
Length=492

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ERE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GAGIGRF
Sbjct  9    EREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRF  68

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            TGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS D
Sbjct  69   TGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPD  113



>ref|XP_009776424.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
sylvestris]
Length=499

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +ER+VQK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  15   QERDVQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPSYEGKSVLELGAGIGR  74

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FT ELA+ AGQ++A+DFIES IKKNE+IN H  N+KFMCADVTS D
Sbjct  75   FTSELAKNAGQLLALDFIESAIKKNESINSHHKNVKFMCADVTSPD  120



>sp|Q9M571.1|PEAMT_SPIOL RecName: Full=Phosphoethanolamine N-methyltransferase [Spinacia 
oleracea]
 gb|AAF61950.1|AF237633_1 phosphoethanolamine N-methyltransferase [Spinacia oleracea]
Length=494

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = +3

Query  144  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  323
            SAM   Q  EREV K YWIEHS +LTVEAMMLDS+A+DLDK ERPEVLSMLP YEGKSVL
Sbjct  4    SAMGVLQ--EREVFKKYWIEHSVDLTVEAMMLDSQASDLDKVERPEVLSMLPPYEGKSVL  61

Query  324  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            ELGAGIGRFTGELA+KA QVIA+DFIESVIKKNE+INGH  N+KFMCADVTS
Sbjct  62   ELGAGIGRFTGELAEKASQVIALDFIESVIKKNESINGHYKNVKFMCADVTS  113



>gb|AGI56231.1| phosphoethanolamine N-methyltransferase [Lycium barbarum]
Length=498

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +ER++QK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  15   QERDIQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLELGAGIGR  74

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FT ELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS D
Sbjct  75   FTSELAKNAGQLIALDFIESAIKKNESINKHHKNVKFMCADVTSPD  120



>ref|XP_009104804.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 [Brassica 
rapa]
Length=506

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  135  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  314
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  315  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D
Sbjct  70   TVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPD  126



>emb|CDX68222.1| BnaA07g22620D [Brassica napus]
Length=506

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  135  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  314
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  315  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D
Sbjct  70   TVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPD  126



>ref|XP_004503268.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cicer 
arietinum]
Length=490

 Score =   186 bits (472),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +ERE+QKSYW++H ++L+VEAMMLDSKA+DLDKEERPEVLS+LPAYEGKSV+ELGAGIGR
Sbjct  6    DEREIQKSYWVQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPAYEGKSVIELGAGIGR  65

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS +
Sbjct  66   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPN  111



>ref|XP_006346642.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Solanum 
tuberosum]
Length=500

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  165  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  344
            GEER++QK+YW+EH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLELGAGIG
Sbjct  15   GEERDIQKNYWMEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLELGAGIG  74

Query  345  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            RFT ELA+ AGQ+IA+DFI+S IKKN++IN H  N+KFMCADVTS D
Sbjct  75   RFTSELAKNAGQLIALDFIDSAIKKNKSINKHHKNVKFMCADVTSPD  121



>ref|XP_008799258.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Phoenix dactylifera]
Length=447

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 4/116 (3%)
 Frame = +3

Query  150  MAAFQG----EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  317
            MAA  G    EER VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS
Sbjct  1    MAAINGGGGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKS  60

Query  318  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            VLELGAGIGRFTGELA++AG V+A+DFIE+VIKKNE+ NGHL NI F+CADVTS D
Sbjct  61   VLELGAGIGRFTGELAKEAGHVLALDFIENVIKKNESANGHLKNISFVCADVTSPD  116



>emb|CDY11100.1| BnaC06g23520D [Brassica napus]
Length=506

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  135  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  314
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  315  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
             VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D
Sbjct  70   KVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPD  126



>gb|KEH21429.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=469

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTS  114



>ref|XP_010678114.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EEREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   EEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            FTG+LA KA QVIA+DFIES IKKNE +NGH  N+KFMCADVTS
Sbjct  70   FTGDLANKADQVIALDFIESAIKKNECVNGHYKNVKFMCADVTS  113



>gb|KEH21430.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=456

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTS  114



>gb|EMT21187.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=503

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  20   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  79

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS D
Sbjct  80   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPD  125



>ref|XP_003631125.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AET05601.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=488

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  5    DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  64

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS
Sbjct  65   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTS  108



>gb|ACV89824.1| S-adenosyl-L-methionine:phosphoethanolamine N-methyltransferase 
[Triticum aestivum]
Length=505

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  22   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  81

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS D
Sbjct  82   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPD  127



>gb|EMS54147.1| Phosphoethanolamine N-methyltransferase 1 [Triticum urartu]
Length=504

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  21   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  80

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS D
Sbjct  81   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPD  126



>gb|AET05600.2| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=494

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTS  114



>emb|CDM83845.1| unnamed protein product [Triticum aestivum]
Length=504

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  21   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  80

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS D
Sbjct  81   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPD  126



>ref|XP_003631124.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=495

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTS  114



>gb|EYU24136.1| hypothetical protein MIMGU_mgv1a005261mg [Erythranthe guttata]
Length=491

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA   +EREVQK+YW+EHS  LT+E MMLDSKA+DLDKEERPEVL+MLP YEGKS+LEL
Sbjct  1    MAAITEQEREVQKNYWVEHSVNLTLEDMMLDSKASDLDKEERPEVLAMLPPYEGKSILEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELA+KAG V A+DFIESVIKKNE IN H  N++FMCADVTS D
Sbjct  61   GAGIGRFTGELAKKAGHVTALDFIESVIKKNEAINKHHKNVEFMCADVTSPD  112



>ref|XP_007152684.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
 gb|ESW24678.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
Length=497

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 104/117 (89%), Gaps = 3/117 (3%)
 Frame = +3

Query  144  SAMAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  314
            +++A  QG   +ER VQKSYWIEH++EL+VE+MMLDS A+ LDKEERPEVLS+LPAYEGK
Sbjct  2    ASLAMVQGGGVDERCVQKSYWIEHTTELSVESMMLDSNASHLDKEERPEVLSLLPAYEGK  61

Query  315  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            SVLELGAGIGRFTGELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +
Sbjct  62   SVLELGAGIGRFTGELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPN  118



>ref|NP_001148925.1| LOC100282545 [Zea mays]
 gb|ACG33501.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +3

Query  132  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  311
            A V S       EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEG
Sbjct  7    ATVVSLNGKMGAEERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEG  66

Query  312  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            KSVLELGAGIGRFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+D
Sbjct  67   KSVLELGAGIGRFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQD  124



>ref|XP_004969638.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   183 bits (465),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  16   EERQAQKSYWEEHSRDLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLELGAGIGR  75

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+D
Sbjct  76   FTGELAKTAGNVLALDFIESAIKKNESINGHFKNASFMCADVTSQD  121



>ref|XP_003569614.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Brachypodium 
distachyon]
Length=502

 Score =   183 bits (465),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EERE QK YW EHS +LTVEAMMLDS AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  19   EEREAQKKYWEEHSRDLTVEAMMLDSHAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  78

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS D
Sbjct  79   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPD  124



>ref|XP_002456194.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
 gb|EES01314.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
Length=501

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  129  TAIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYE  308
            TA V S       EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP++E
Sbjct  5    TAAVVSVNGKMGVEERQAQKSYWEEHSRNLTVEAMMLDSRAADLDKEERPEVLSLLPSFE  64

Query  309  GKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GKSVLELGAGIGRFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+D
Sbjct  65   GKSVLELGAGIGRFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSED  123



>ref|XP_006644536.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=499

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER+ QKSYW EHS +LTVEAMMLDS+A DLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRATDLDKEERPEILSLLPSYEGKSVLELGAGIGR  75

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS D
Sbjct  76   FTGELAKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTSPD  121



>gb|AFW83642.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  19   EERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEGKSVLELGAGIGR  78

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+D
Sbjct  79   FTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQD  124



>ref|XP_009782224.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=496

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            +AA   +ERE+QKSYW+E ++ELT+EAMMLDS+A+DLDKE+RPEVLS+LP+YEGKSVLEL
Sbjct  6    IAAAPEQEREIQKSYWMEQAAELTLEAMMLDSEASDLDKEDRPEVLSLLPSYEGKSVLEL  65

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTG+LA+KAGQ+ A+DF+E VIKKNE+INGH  N+KFMCADVTS D
Sbjct  66   GAGIGRFTGDLAEKAGQLTALDFVEGVIKKNESINGHHKNVKFMCADVTSPD  117



>gb|ACJ83326.1| unknown [Medicago truncatula]
Length=221

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +EREVQ+SYW EH   L+VE+MMLDS A+ LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  13   DEREVQRSYWKEHCVNLSVESMMLDSNASHLDKEERPEVLSLLPSYEGKSVLELGAGIGR  72

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FT ELAQKAGQ++A+DFIES IKKNE  NGH  N+KFMCADVTS +
Sbjct  73   FTAELAQKAGQLLAVDFIESAIKKNENTNGHHKNVKFMCADVTSPN  118



>ref|XP_006843796.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
 gb|ERN05471.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
Length=489

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 102/110 (93%), Gaps = 2/110 (2%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA QGE RE+QKSYWIEHSS+LTVEAMMLDSKAA+LDKEERPEVLS+LP ++GK+VLEL
Sbjct  1    MAA-QGE-REIQKSYWIEHSSDLTVEAMMLDSKAAELDKEERPEVLSLLPPFKGKNVLEL  58

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            GAGIGRFTGELA++AG V A+DFI+SVIKKNE INGH  NIKF+CADVTS
Sbjct  59   GAGIGRFTGELAKEAGHVTALDFIKSVIKKNEKINGHYKNIKFVCADVTS  108



>pir||H96762 hypothetical protein F6D5.1 [imported] - Arabidopsis thaliana
 gb|AAG51806.1|AC079676_1 phosphoethanolamine N-methyltransferase, putative; 6854-3993 
[Arabidopsis thaliana]
Length=555

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 109/137 (80%), Gaps = 2/137 (1%)
 Frame = +3

Query  78   FSV-RIAFPGFLDFFYLFTAIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAA  254
            FS+ R  +P      +LF ++    MA++ GEERE+QK+YW EHS  L+VEAMMLDSKA+
Sbjct  41   FSIHRFHYPREKIVSFLFPSVFSRIMASY-GEEREIQKNYWKEHSVGLSVEAMMLDSKAS  99

Query  255  DLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETIN  434
            DLDKEERPE+L+ LP  EG +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE IN
Sbjct  100  DLDKEERPEILAFLPPIEGTTVLEFGAGIGRFTTELAQKAGQVIAVDFIESVIKKNENIN  159

Query  435  GHLGNIKFMCADVTSKD  485
            GH  N+KF+CADVTS +
Sbjct  160  GHYKNVKFLCADVTSPN  176



>ref|XP_004137341.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cucumis 
sativus]
Length=500

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  144  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  323
            +   A   EER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVL
Sbjct  5    TPAPALNDEERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVL  64

Query  324  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            ELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS
Sbjct  65   ELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTS  116



>ref|XP_010416170.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Camelina 
sativa]
Length=490

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 99/112 (88%), Gaps = 1/112 (1%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA+ GEERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  1    MAAY-GEEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  59

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D
Sbjct  60   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKNINGHYRNVKFMCADVTSPD  111



>ref|XP_004166029.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase-like 
[Cucumis sativus]
Length=500

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  144  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  323
            +   A   EER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVL
Sbjct  5    TPAPALNDEERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVL  64

Query  324  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            ELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS
Sbjct  65   ELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTS  116



>ref|XP_010428286.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Camelina sativa]
Length=492

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 99/112 (88%), Gaps = 1/112 (1%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA+ GEERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  3    MAAY-GEEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  61

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D
Sbjct  62   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKYINGHYKNVKFMCADVTSPD  113



>ref|XP_009385384.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=497

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  165  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  344
            GEEREVQK YWIEHS ELTVEAMMLDS A++LDKEERPEVLS+LP Y+GKSVLELGAGIG
Sbjct  12   GEEREVQKIYWIEHSKELTVEAMMLDSHASELDKEERPEVLSLLPPYKGKSVLELGAGIG  71

Query  345  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            RFTGELA++AG V+A+DFIESVI+KNE++NGH  N  FMCADV+S D
Sbjct  72   RFTGELAKEAGHVLALDFIESVIEKNESLNGHYKNTSFMCADVSSPD  118



>gb|AAF79704.1|AC020889_12 T1N15.22 [Arabidopsis thaliana]
Length=180

 Score =   173 bits (438),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  198  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  377
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFTGELAQKAG  60

Query  378  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            +VIA+DFIES I+KNE++NGH  NIKFMCADVTS D
Sbjct  61   EVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPD  96



>ref|XP_011039130.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Populus 
euphratica]
Length=490

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 100/112 (89%), Gaps = 1/112 (1%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA Q EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAA-QVEEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLEL  59

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS D
Sbjct  60   GAGIGRFTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPD  111



>ref|XP_010921197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Elaeis guineensis]
Length=499

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER VQKS+W+EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGR
Sbjct  10   EERTVQKSFWMEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGR  69

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA++AG V+A+DFIE VIKKNE++NGH  NI FMCADVTS D
Sbjct  70   FTGELAKEAGHVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPD  115



>ref|XP_011014101.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Populus euphratica]
Length=490

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 100/112 (89%), Gaps = 1/112 (1%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA Q EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAA-QVEEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLEL  59

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS D
Sbjct  60   GAGIGRFTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPD  111



>ref|XP_011008809.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X2 [Populus euphratica]
Length=490

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  6    EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  65

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS D
Sbjct  66   FTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPD  111



>gb|KDP23923.1| hypothetical protein JCGZ_27083 [Jatropha curcas]
Length=491

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA   EERE+QK+YWIE+S  LTVEAMMLDS A+ LDKEERPEVLSMLP YEGKSVLE 
Sbjct  1    MAAAHVEEREIQKNYWIENSDGLTVEAMMLDSNASLLDKEERPEVLSMLPPYEGKSVLEF  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTGE+AQ AGQ++A+DFI++VIKKNE INGH  N+KF+CADVTS+D
Sbjct  61   GAGIGRFTGEIAQNAGQLVAVDFIDNVIKKNERINGHHKNVKFICADVTSED  112



>dbj|BAJ97525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  25   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  84

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA+ AG V+AMDFI SVIKKNE+INGH  N  FMCADVTS D
Sbjct  85   FTGELAKTAGHVLAMDFIGSVIKKNESINGHYENASFMCADVTSPD  130



>ref|XP_010921161.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Elaeis 
guineensis]
Length=494

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 3/115 (3%)
 Frame = +3

Query  150  MAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  320
            MAA  G   EER VQKSYW+EHS +LTV AMMLDS+A +LDKEERPEVLS+LP Y+GKSV
Sbjct  1    MAAVSGAGEEERMVQKSYWMEHSKDLTVAAMMLDSRATNLDKEERPEVLSLLPPYKGKSV  60

Query  321  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LELGAGIGRFTGELA++AG V+A+DFIE+VIKKNE+INGH  N  FMCADVTS D
Sbjct  61   LELGAGIGRFTGELAKEAGHVLALDFIENVIKKNESINGHFTNTSFMCADVTSPD  115



>ref|XP_011008808.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Populus euphratica]
Length=506

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  22   EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  81

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS D
Sbjct  82   FTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPD  127



>dbj|BAH01482.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64589.1| hypothetical protein OsJ_19441 [Oryza sativa Japonica Group]
Length=495

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ER+ Q+SYW EHS +LTVEAMMLDS+AADLDKEERPEVLS+LP+Y+GKSVLELGAGIGRF
Sbjct  13   ERKAQRSYWEEHSKDLTVEAMMLDSRAADLDKEERPEVLSVLPSYKGKSVLELGAGIGRF  72

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            TGELA++AG V+A+DFIESVIKKNE INGH  NI FMCADVTS D
Sbjct  73   TGELAKEAGHVLALDFIESVIKKNENINGHHKNITFMCADVTSPD  117



>ref|XP_008453479.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=500

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  144  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  323
            +   A   +ER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVL
Sbjct  5    TPAPALNDDERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVL  64

Query  324  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            ELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS
Sbjct  65   ELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTS  116



>ref|XP_002322102.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
 gb|EEF06229.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
Length=516

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  22   EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  81

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS D
Sbjct  82   FTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPD  127



>ref|XP_010921188.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Elaeis guineensis]
Length=537

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER VQKS+W+EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGR
Sbjct  48   EERTVQKSFWMEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGR  107

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA++AG V+A+DFIE VIKKNE++NGH  NI FMCADVTS D
Sbjct  108  FTGELAKEAGHVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPD  153



>ref|XP_009404071.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=497

 Score =   180 bits (457),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EEREVQKSYW+EHS +LT+EAMMLDS+A++LDKEERPEVLS+LP Y+GKSVLELGAGIGR
Sbjct  13   EEREVQKSYWMEHSRDLTLEAMMLDSRASELDKEERPEVLSLLPPYKGKSVLELGAGIGR  72

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FT ELA++AG V+A+DFIESVIKKNE++NGH  N  FMCADVTS D
Sbjct  73   FTSELAKEAGHVLALDFIESVIKKNESLNGHYKNTSFMCADVTSPD  118



>ref|NP_001043957.1| Os01g0695100 [Oryza sativa Japonica Group]
 dbj|BAF05871.1| Os01g0695100 [Oryza sativa Japonica Group]
Length=499

 Score =   180 bits (457),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  D
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPD  121



>gb|AAS57723.1| phosphoethanolamine N-methyltransferase [Oryza sativa]
Length=499

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  D
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPD  121



>gb|EEE55232.1| hypothetical protein OsJ_03109 [Oryza sativa Japonica Group]
Length=509

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  D
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPD  121



>ref|XP_008464197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=493

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  165  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  344
            G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPE+LS+LP Y+GK+VLELGAGIG
Sbjct  8    GQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEILSLLPPYDGKTVLELGAGIG  67

Query  345  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            RFTGELAQKAG VIA+DFIE+ IKKNE IN H  N+KF+CADVTS
Sbjct  68   RFTGELAQKAGNVIALDFIENAIKKNERINSHHKNVKFVCADVTS  112



>ref|XP_003567962.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Brachypodium distachyon]
Length=501

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +3

Query  132  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  311
            A++      F G ER+VQKSYW EHS +LTVE+MMLDS+A DLDKEERPEVLS+LP+YEG
Sbjct  5    AVIAVVENGFVGVERKVQKSYWEEHSRDLTVESMMLDSRAKDLDKEERPEVLSILPSYEG  64

Query  312  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHL-GNIKFMCADVTS  479
            K+VLELGAGIGRFTGELA++AG V+A+DFI+SVIKKNE INGH+  NI FMCADVTS
Sbjct  65   KTVLELGAGIGRFTGELAKEAGHVLALDFIDSVIKKNEEINGHIHNNITFMCADVTS  121



>ref|XP_004961340.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=498

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ER+VQKSYW EHS  LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVLELGAGIGRF
Sbjct  16   ERKVQKSYWEEHSKSLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVLELGAGIGRF  75

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            TG+LA++AG V+A+DFIESVIKKNE+INGH  NI FMCADVTS +
Sbjct  76   TGDLAKEAGHVLALDFIESVIKKNESINGHHKNITFMCADVTSPN  120



>ref|XP_006365411.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Solanum 
tuberosum]
Length=494

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  323
            +A+A   G+ERE+QKSYW+E ++EL +EAMMLDS A+DLDKE+RPEVLS+LP+YEGKSVL
Sbjct  2    AAIAPGVGQEREIQKSYWMEQTTELNLEAMMLDSAASDLDKEDRPEVLSLLPSYEGKSVL  61

Query  324  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            ELGAGIGRFTG++A+KAG+++ +DFIE VIKKNE+INGH  N+KF+CADVTS D
Sbjct  62   ELGAGIGRFTGDIAEKAGELVTVDFIEEVIKKNESINGHHKNVKFVCADVTSPD  115



>ref|XP_010471422.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Camelina sativa]
Length=490

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 98/112 (88%), Gaps = 1/112 (1%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MAA+  EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  1    MAAYV-EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  59

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D
Sbjct  60   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKNINGHYKNVKFMCADVTSPD  111



>ref|XP_009595958.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=496

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            +AA   +ERE+QKSYWIE ++ELT++AMMLDS+A+DLDKE+RPEVLS+LP YEGKSVLEL
Sbjct  6    IAAAPEQEREIQKSYWIEQAAELTLKAMMLDSEASDLDKEDRPEVLSLLPPYEGKSVLEL  65

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFTG LA+KAGQ+  +DF+E VIKKNE+INGH  N+KFMCADVTS D
Sbjct  66   GAGIGRFTGGLAEKAGQLTTLDFVEDVIKKNESINGHHKNVKFMCADVTSPD  117



>ref|XP_004241642.1| PREDICTED: phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=494

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  144  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  323
            +A+A   GEERE+QKSYW+E +SEL +EAMM DS A+DLDKE+RPEVLS+LP+YEGKSVL
Sbjct  2    AAIAPEVGEEREIQKSYWMEQTSELNLEAMMRDSAASDLDKEDRPEVLSLLPSYEGKSVL  61

Query  324  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            ELGAGIGRFTG+LA+KAG+++A+DFIE V KKNE+INGH  N+KF+CADVTS D
Sbjct  62   ELGAGIGRFTGDLAEKAGELVAVDFIEEVTKKNESINGHHKNVKFVCADVTSPD  115



>ref|XP_006302164.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
 gb|EOA35062.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
Length=503

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+L++LP  EGK+VLE GAGIGR
Sbjct  19   EEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILALLPPIEGKTVLEFGAGIGR  78

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D
Sbjct  79   FTTELAQKAGQLIAVDFIESVIKKNKKINGHYKNVKFMCADVTSPD  124



>ref|XP_003534138.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN43631.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=490

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 101/112 (90%), Gaps = 1/112 (1%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MA  Q +ER VQKSYWIEH+++L+VE+MMLDS A+DLDKEERPEVLS+LP YEGKSV+EL
Sbjct  1    MAMVQ-DERCVQKSYWIEHTTDLSVESMMLDSNASDLDKEERPEVLSLLPPYEGKSVVEL  59

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFT ELA+KAGQ++A+DFIES IKKNE+INGH  N+KFMCADVTS +
Sbjct  60   GAGIGRFTVELAKKAGQLLAVDFIESAIKKNESINGHHKNVKFMCADVTSPN  111



>ref|XP_004969637.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER+ Q+SYW EHS +LTVEAMMLDS+AA+LDKE+RPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  16   EERKAQRSYWEEHSRDLTVEAMMLDSRAAELDKEDRPEVLSLLPSYEGKSVLELGAGIGR  75

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA+ AG V A+DFIESVIKKNE+ NGH  N  FMCADVTS D
Sbjct  76   FTGELAKTAGHVFALDFIESVIKKNESTNGHYKNTSFMCADVTSPD  121



>ref|NP_177501.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 sp|Q9C6B9.2|PEAM3_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35481.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=490

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 1/112 (1%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MA++ GEERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE 
Sbjct  1    MASY-GEEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEF  59

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS +
Sbjct  60   GAGIGRFTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPN  111



>ref|XP_004512744.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   177 bits (450),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +3

Query  147  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  326
            AM   + +EREVQ++YW EH + L+VE+MMLDS A+ LDKEERPEVLS+LPAYEGKS+LE
Sbjct  6    AMTQVEEDEREVQRNYWREHCANLSVESMMLDSNASHLDKEERPEVLSLLPAYEGKSILE  65

Query  327  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LGAGIGRFT ELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +
Sbjct  66   LGAGIGRFTSELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPN  118



>ref|XP_008799222.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X3 [Phoenix dactylifera]
Length=482

 Score =   177 bits (450),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  180  VQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGE  359
            VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSVLELGAGIGRFTGE
Sbjct  2    VQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSVLELGAGIGRFTGE  61

Query  360  LAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS D
Sbjct  62   LAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPD  103



>gb|AFW04224.1| phosphoethanolamine N-methyl transferase [Suaeda maritima]
Length=494

 Score =   177 bits (450),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTS  113



>gb|AAM97038.1| phosphoethanolamine N-methyltransferase, putative [Arabidopsis 
thaliana]
Length=376

 Score =   175 bits (443),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEFGAGIGR  79

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS +
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPN  125



>gb|ABK42071.1| phosphoethanolamine N-methyltransferase [Suaeda liaotungensis]
Length=494

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTS  113



>ref|XP_010471421.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Camelina sativa]
Length=504

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE GAGIGR
Sbjct  20   EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEFGAGIGR  79

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D
Sbjct  80   FTTELAQKAGQLIAVDFIESVIKKNKNINGHYKNVKFMCADVTSPD  125



>dbj|BAC57432.1| phosphoethanolamine N-methyltransferase [Suaeda japonica]
Length=494

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTS  113



>ref|XP_004161835.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
1 [Cucumis sativus]
Length=527

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +3

Query  159  FQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAG  338
            F G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPEVLS+LP  +GK+VLELGAG
Sbjct  40   FTGQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEVLSLLPPCDGKTVLELGAG  99

Query  339  IGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            IGRFTGELAQKAG VIA+DFIE+ IKKNE+ N H  N+KF+CADVTS +
Sbjct  100  IGRFTGELAQKAGNVIALDFIENAIKKNESTNSHHKNVKFVCADVTSSE  148



>ref|XP_006655550.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=495

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ER+ Q+SYW EHS  LTVEAMMLDS+AADLDKEERPE+LS+LP+Y+GKSVLELGAGIGRF
Sbjct  13   ERKAQRSYWEEHSKALTVEAMMLDSRAADLDKEERPEILSVLPSYKGKSVLELGAGIGRF  72

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            TGELA++AG V+A+DFIESVIKKNE  NGH  NI FMCADVTS D
Sbjct  73   TGELAKEAGHVLALDFIESVIKKNENTNGHHKNITFMCADVTSAD  117



>ref|XP_010428285.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Camelina sativa]
Length=504

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE GAGIGR
Sbjct  20   EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEFGAGIGR  79

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D
Sbjct  80   FTTELAQKAGQLIAVDFIESVIKKNKYINGHYKNVKFMCADVTSPD  125



>ref|XP_006390538.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
 gb|ESQ27824.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
Length=504

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +3

Query  138  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  317
            + S+ +    EERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+L++LP  +G++
Sbjct  10   IASSFSKNSWEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILALLPPIDGRT  69

Query  318  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            VLE GAGIGRFT ELAQKAG+VIA+DFI+SVIKKNE INGH  N++FMCADVTS D
Sbjct  70   VLEFGAGIGRFTSELAQKAGKVIAVDFIDSVIKKNENINGHYKNVEFMCADVTSPD  125



>ref|XP_003525185.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
Length=488

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +ER +QKSYW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP +EGKSV+ELGAGIGR
Sbjct  2    DERHIQKSYWLQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPFEGKSVIELGAGIGR  61

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA KAGQ++A+DFI++ IKKNETINGH  ++KF+CADVTS +
Sbjct  62   FTGELALKAGQLLAVDFIDTAIKKNETINGHHNHVKFLCADVTSPN  107



>ref|XP_002887491.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63750.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  156  AFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGA  335
            A  GEERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L++LP  EGK+VLE GA
Sbjct  2    AVYGEEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILALLPPIEGKTVLEFGA  61

Query  336  GIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GIGRFT  LA KAGQ+IA+DFIESVIKKN+ INGH  N+KF+CADVTS D
Sbjct  62   GIGRFTTNLAHKAGQLIAVDFIESVIKKNQNINGHYKNVKFLCADVTSPD  111



>ref|XP_006393388.1| hypothetical protein EUTSA_v10012068mg, partial [Eutrema salsugineum]
 gb|ESQ30674.1| hypothetical protein EUTSA_v10012068mg, partial [Eutrema salsugineum]
Length=258

 Score =   170 bits (431),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  150  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  329
            MA    EER +QKSY  E+SS+LTVEA+MLDSK +D DKEERPEVLS++P YEGK+VLEL
Sbjct  1    MATPYKEERVIQKSYLKENSSDLTVEAIMLDSKDSDPDKEERPEVLSLIPPYEGKTVLEL  60

Query  330  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            GAGIG FTGELAQKAG+VIA+DFIES IKKN ++NGH  N+KFMCADV S D
Sbjct  61   GAGIGHFTGELAQKAGEVIALDFIESAIKKNASVNGHYKNVKFMCADVRSPD  112



>ref|NP_001169597.1| uncharacterized LOC100383478 [Zea mays]
 gb|ABF83429.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
 gb|ACN34220.1| unknown [Zea mays]
 gb|AFW78993.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
Length=501

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ER+VQKSYW EHS  LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVLELGAGIGRF
Sbjct  19   ERKVQKSYWEEHSKCLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVLELGAGIGRF  78

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            TG+LA++AG V+A+DFIESVIKKN++INGH  NI F CADVTS D
Sbjct  79   TGDLAKEAGHVLALDFIESVIKKNQSINGHHKNITFRCADVTSND  123



>ref|XP_007160542.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32536.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=496

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ER++QK YW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP  EGKSV+ELGAGIGRF
Sbjct  11   ERDMQKLYWVQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPCEGKSVIELGAGIGRF  70

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            TGELAQKAGQ++A+DFIES IKKNE+INGH  N+KF+CADVTS +
Sbjct  71   TGELAQKAGQLLAVDFIESAIKKNESINGHHKNVKFLCADVTSPN  115



>ref|XP_007160543.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32537.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=517

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ER++QK YW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP  EGKSV+ELGAGIGRF
Sbjct  11   ERDMQKLYWVQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPCEGKSVIELGAGIGRF  70

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            TGELAQKAGQ++A+DFIES IKKNE+INGH  N+KF+CADVTS +
Sbjct  71   TGELAQKAGQLLAVDFIESAIKKNESINGHHKNVKFLCADVTSPN  115



>gb|KFK41794.1| hypothetical protein AALP_AA2G173000 [Arabis alpina]
Length=505

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  135  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  314
            ++ S+     GEERE+QK+YW EHS++L+VE+MMLDS+AADLDKEERPE++++LP  EGK
Sbjct  10   MISSSFPKNLGEEREIQKNYWKEHSADLSVESMMLDSQAADLDKEERPEIVALLPPIEGK  69

Query  315  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            +VLE GAGIGRFT ELA+KAG VIA+DFI++ IKKN+ INGH  N+KFMCADVTS D
Sbjct  70   TVLEFGAGIGRFTTELARKAGHVIAVDFIDNAIKKNQNINGHYKNVKFMCADVTSPD  126



>ref|XP_004137500.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004161836.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
2 [Cucumis sativus]
 gb|KGN64173.1| hypothetical protein Csa_1G042800 [Cucumis sativus]
Length=493

 Score =   175 bits (444),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +3

Query  165  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  344
            G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPEVLS+LP  +GK+VLELGAGIG
Sbjct  8    GQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEVLSLLPPCDGKTVLELGAGIG  67

Query  345  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            RFTGELAQKAG VIA+DFIE+ IKKNE+ N H  N+KF+CADVTS
Sbjct  68   RFTGELAQKAGNVIALDFIENAIKKNESTNSHHKNVKFVCADVTS  112



>ref|XP_002441466.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
 gb|EES19896.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
Length=510

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ER+VQKSYW EHS +LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVLELGAGIGRF
Sbjct  28   ERKVQKSYWEEHSKDLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVLELGAGIGRF  87

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            TG+LA++AG V+A+DFIESVIKKN++INGH  NI F CADVTS
Sbjct  88   TGDLAKEAGHVLALDFIESVIKKNQSINGHHKNITFKCADVTS  130



>ref|XP_004512745.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Cicer arietinum]
Length=496

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +EREVQ++YW EH + L+VE+MMLDS A+ LDKEERPEVLS+LPAYEGKS+LELGAGIGR
Sbjct  12   DEREVQRNYWREHCANLSVESMMLDSNASHLDKEERPEVLSLLPAYEGKSILELGAGIGR  71

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FT ELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +
Sbjct  72   FTSELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPN  117



>dbj|BAG50404.1| methyltransferase [Cardamine sp. SIM-2007]
Length=148

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +3

Query  204  HSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQV  383
            HS++LTVEAMMLDS+A+DLDKEERP VLS+LP+YEGKSVLELGAGIGRFT ELAQKAG++
Sbjct  1    HSADLTVEAMMLDSRASDLDKEERPGVLSLLPSYEGKSVLELGAGIGRFTSELAQKAGEL  60

Query  384  IAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            IA+DFI+SVIKKNE+INGH  N+KFMCADVTS D
Sbjct  61   IALDFIDSVIKKNESINGHYKNVKFMCADVTSPD  94



>ref|NP_974139.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35480.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=504

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEFGAGIGR  79

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS +
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPN  125



>ref|XP_003619836.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AES76054.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=497

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +EREVQ+SYW EH   L+VE+MMLDS A+ LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  13   DEREVQRSYWKEHCVNLSVESMMLDSNASHLDKEERPEVLSLLPSYEGKSVLELGAGIGR  72

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FT ELAQKAGQ++A+DFIES IKKNE  NGH  N+KFMCADVTS +
Sbjct  73   FTAELAQKAGQLLAVDFIESAIKKNENTNGHHKNVKFMCADVTSPN  118



>ref|NP_175293.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 gb|AAL16223.1|AF428454_1 At1g48600/T1N15_20 [Arabidopsis thaliana]
 gb|AAL36222.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AAM91745.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AEE32324.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=475

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  198  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  377
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFTGELAQKAG  60

Query  378  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            +VIA+DFIES I+KNE++NGH  NIKFMCADVTS D
Sbjct  61   EVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPD  96



>gb|ABG57185.1| phosphoethanolamine N-methyltransferase [Salicornia europaea]
Length=494

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER V K YW+EH+++LTVE+MMLDS+A+DLDKEERPE+LS+LP  EGK VLELGAGIGR
Sbjct  10   EERNVFKKYWVEHTTDLTVESMMLDSQASDLDKEERPEILSLLPNLEGKCVLELGAGIGR  69

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            FTGELA+KAGQVIA+DFI+  IKKNE I+GH  N+KFMCADVTS
Sbjct  70   FTGELAEKAGQVIALDFIDKAIKKNEYIDGHYKNVKFMCADVTS  113



>dbj|BAE99185.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
Length=504

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG + LE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTALEFGAGIGR  79

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS +
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPN  125



>emb|CDX93681.1| BnaA06g03670D [Brassica napus]
Length=473

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  198  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  377
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLELGAGIGRFTGELAQKAG  60

Query  378  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS D
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPD  96



>ref|XP_002456193.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
 gb|EES01313.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
Length=499

 Score =   172 bits (437),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
             ER+ Q+SYW EHS ELT+EAMMLDS+AA+LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  16   HERKAQRSYWEEHSGELTLEAMMLDSRAAELDKEERPEVLSLLPSYEGKSVLELGAGIGR  75

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA+ +G V A+DFIES IKKNE+ NGH  N  FMCADVTS +
Sbjct  76   FTGELAKTSGHVFAVDFIESAIKKNESTNGHYDNTSFMCADVTSPN  121



>emb|CDY40594.1| BnaC06g02100D [Brassica napus]
Length=473

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  198  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  377
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLELGAGIGRFTGELAQKAG  60

Query  378  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS D
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPD  96



>ref|XP_008675146.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Zea mays]
Length=483

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +3

Query  138  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  317
            V  ++      ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS
Sbjct  8    VNGSLDRLDVHERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKS  67

Query  318  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            +LELGAGIGRFTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS D
Sbjct  68   ILELGAGIGRFTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTD  123



>ref|XP_008675144.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Zea mays]
 ref|XP_008675145.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Zea mays]
Length=501

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +3

Query  138  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  317
            V  ++      ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS
Sbjct  8    VNGSLDRLDVHERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKS  67

Query  318  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            +LELGAGIGRFTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS D
Sbjct  68   ILELGAGIGRFTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTD  123



>tpg|DAA57997.1| TPA: putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=498

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
             ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS+LELGAGIGR
Sbjct  15   HERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKSILELGAGIGR  74

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS D
Sbjct  75   FTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTD  120



>gb|AAV67950.1| putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=495

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
             ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS+LELGAGIGR
Sbjct  12   HERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKSILELGAGIGR  71

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS D
Sbjct  72   FTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSPD  117



>ref|XP_006393387.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
 gb|ESQ30673.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
Length=475

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  198  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  377
            +E+SS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK+VLELGAGIGRFTGELAQKAG
Sbjct  1    MENSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKTVLELGAGIGRFTGELAQKAG  60

Query  378  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS+D
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSQD  96



>gb|KJB53041.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=448

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS D
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPD  110



>gb|AAL40895.1| phosphoethanolamine methyltransferase [Triticum aestivum]
Length=498

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 1/104 (1%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ER+VQKSYW EHS +LTVE+MMLDS+A DLDKEERPEVL++LP+Y GK+VLELGAGIGRF
Sbjct  15   ERKVQKSYWEEHSKDLTVESMMLDSRAKDLDKEERPEVLAILPSYAGKTVLELGAGIGRF  74

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHL-GNIKFMCADVTS  479
            TGELA++AG VIA+DFI+SVIKKNE ING +  NI FMCADVTS
Sbjct  75   TGELAKEAGHVIALDFIDSVIKKNEEINGDIYKNITFMCADVTS  118



>ref|XP_002317875.2| Phosphoethanolamine N-methyltransferase 1 family protein, partial 
[Populus trichocarpa]
 gb|EEE96095.2| Phosphoethanolamine N-methyltransferase 1 family protein, partial 
[Populus trichocarpa]
Length=129

 Score =   159 bits (401),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +3

Query  198  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  377
            +++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGRFTGELAQKA 
Sbjct  1    MDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGRFTGELAQKAS  60

Query  378  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            QV+A+DFIES IKKNE INGH  N+KFMCADV S D
Sbjct  61   QVVALDFIESAIKKNENINGHYKNVKFMCADVKSPD  96



>gb|KJB53038.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=480

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS D
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPD  110



>gb|KJB53040.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=489

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS D
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPD  110



>gb|KJB53039.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=488

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  5    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  64

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS D
Sbjct  65   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPD  109



>ref|XP_010461685.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
 ref|XP_010461686.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=234

 Score =   161 bits (408),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 89/97 (92%), Gaps = 1/97 (1%)
 Frame = +3

Query  198  IEHSSELTVEAMMLDSKAADLDKEERPE-VLSMLPAYEGKSVLELGAGIGRFTGELAQKA  374
            +EHSS+LTVEAMMLDSKA+DLDKEERPE VLS++P YEGKSVLELGAGIGRFT ELAQKA
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEEVLSLVPPYEGKSVLELGAGIGRFTVELAQKA  60

Query  375  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            G+VIA+DFIES I+KNE+INGH   +KFMCADVTS D
Sbjct  61   GEVIAVDFIESDIQKNESINGHYKKVKFMCADVTSPD  97



>gb|AFZ78648.1| methyl transferase [Populus tomentosa]
Length=485

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  198  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  377
            ++++S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGRFTGELAQKAG
Sbjct  1    MDNTSDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGRFTGELAQKAG  60

Query  378  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            QV+A+DFIES IKKNE INGH  N+KFMCADVTS D
Sbjct  61   QVVALDFIESAIKKNENINGHYKNVKFMCADVTSPD  96



>ref|XP_010921205.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921212.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921222.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921230.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921238.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
Length=480

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +3

Query  198  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  377
            +EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGRFTGELA++AG
Sbjct  1    MEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGRFTGELAKEAG  60

Query  378  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
             V+A+DFIE VIKKNE++NGH  NI FMCADVTS D
Sbjct  61   HVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPD  96



>ref|XP_010500398.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=474

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +3

Query  198  IEHSSELTVEAMMLDSKAADLDKEERPE-VLSMLPAYEGKSVLELGAGIGRFTGELAQKA  374
            +EHSS+LTVEAMMLDSKA+DLDKEERPE VLS++P YEGKSVLELGAGIGRFTGELAQKA
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEEVLSLIPPYEGKSVLELGAGIGRFTGELAQKA  60

Query  375  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            G+VIA+DFIES I+KNE++NG   N+KF+CADVTS D
Sbjct  61   GEVIALDFIESAIQKNESVNGQYKNVKFICADVTSPD  97



>ref|XP_001763293.1| predicted protein [Physcomitrella patens]
 gb|EDQ71823.1| predicted protein [Physcomitrella patens]
Length=491

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ER +Q +YW EHS E +VEAMMLDS+A+ LDKEERPE+LS+LP YE K V+ELGAGIGRF
Sbjct  6    ERSLQSTYWKEHSVEPSVEAMMLDSQASKLDKEERPEILSLLPPYENKDVMELGAGIGRF  65

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            TGELA+ AG V+AMDF+E++IKKNE +NGH  NI F CADVTS D
Sbjct  66   TGELAKHAGHVLAMDFMENLIKKNEDVNGHYNNIDFKCADVTSPD  110



>ref|XP_002454522.1| hypothetical protein SORBIDRAFT_04g032625 [Sorghum bicolor]
 gb|EES07498.1| hypothetical protein SORBIDRAFT_04g032625 [Sorghum bicolor]
Length=136

 Score =   151 bits (382),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +3

Query  216  LTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMD  395
            LTVEAMMLDS+AADL++EERPEVLS+LP+YEGKSVLELGAGIG FTGELA+ AG V+A+D
Sbjct  19   LTVEAMMLDSRAADLNREERPEVLSLLPSYEGKSVLELGAGIGHFTGELAKIAGNVLALD  78

Query  396  FIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FIES IKKNE+INGH  N  FMCA VTS+D
Sbjct  79   FIESAIKKNESINGHYNNASFMCAYVTSED  108



>ref|XP_010655650.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Vitis vinifera]
Length=494

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  165  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  344
            GEER+VQKSYW+EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIG
Sbjct  5    GEERDVQKSYWMEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIG  64

Query  345  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            RFTGELA++AGQV+A+DFIESVI++NE ING   N KF+CADVTS D
Sbjct  65   RFTGELAKQAGQVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPD  111



>ref|XP_002284594.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Vitis vinifera]
Length=490

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  165  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  344
            GEER+VQKSYW+EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIG
Sbjct  5    GEERDVQKSYWMEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIG  64

Query  345  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            RFTGELA++AGQV+A+DFIESVI++NE ING   N KF+CADVTS D
Sbjct  65   RFTGELAKQAGQVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPD  111



>gb|ABK24808.1| unknown [Picea sitchensis]
Length=472

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ER +Q +YW EHS  L++EAMMLDS+A+ LD+EERPE++S+LP  EGKSV+ELGAGIGR+
Sbjct  6    ERALQLNYWKEHSVVLSLEAMMLDSQASKLDQEERPEIISLLPPLEGKSVIELGAGIGRY  65

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            T ELAQKA  ++AMDFIES IKKNE  NGH  N++FMCADVTS D
Sbjct  66   TVELAQKADHILAMDFIESAIKKNEETNGHFKNVEFMCADVTSAD  110



>emb|CDX92181.1| BnaA05g22260D [Brassica napus]
Length=464

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  231  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  410
            MMLDS+AADLDKEERPEVLS+LP YEGKSVLELGAGIGRFTGELAQKAG++IA+DFI+SV
Sbjct  1    MMLDSRAADLDKEERPEVLSLLPPYEGKSVLELGAGIGRFTGELAQKAGELIALDFIDSV  60

Query  411  IKKNETINGHLGNIKFMCADVTSKD  485
            IKKN+++NGH  N+KFMCADVTS D
Sbjct  61   IKKNKSVNGHYKNVKFMCADVTSPD  85



>gb|KJB30120.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=465

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  231  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  410
            MMLDSKAAD+DKEERPEVLS+LP YEGK++LELGAGIGRFTG+LA+KAG VIA+DFIE+V
Sbjct  1    MMLDSKAADIDKEERPEVLSLLPPYEGKTILELGAGIGRFTGDLAKKAGHVIALDFIENV  60

Query  411  IKKNETINGHLGNIKFMCADVTSKD  485
            IKKNETINGH  N+KF+CADVTS D
Sbjct  61   IKKNETINGHYKNVKFLCADVTSPD  85



>ref|XP_006306318.1| hypothetical protein CARUB_v10012188mg, partial [Capsella rubella]
 gb|EOA39216.1| hypothetical protein CARUB_v10012188mg, partial [Capsella rubella]
Length=354

 Score =   151 bits (381),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 3/99 (3%)
 Frame = +3

Query  198  IEHSSELTVEAMMLDS-KAADLDKEE--RPEVLSMLPAYEGKSVLELGAGIGRFTGELAQ  368
            +EHSS+LT EAMMLDS +A+DLD+EE  RPEVLS++P YEGKSVLELGAGI RF GE+AQ
Sbjct  1    MEHSSDLTAEAMMLDSTEASDLDEEEERRPEVLSLIPPYEGKSVLELGAGIDRFIGEVAQ  60

Query  369  KAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            KAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS D
Sbjct  61   KAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPD  99



>ref|XP_001768934.1| predicted protein [Physcomitrella patens]
 gb|EDQ66288.1| predicted protein [Physcomitrella patens]
Length=431

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ER +Q +YW EHS   +VE MMLDS+A  LD EERPE+LS+LP Y+GK V+ELGAGIGRF
Sbjct  17   ERTLQSNYWKEHSVNPSVETMMLDSQAPKLDLEERPEILSLLPPYKGKDVIELGAGIGRF  76

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            TG+LA+ AG V+AMDF+E++IKKNE ++GH+ NI F CADVTS
Sbjct  77   TGDLAKSAGHVLAMDFMENLIKKNEDVHGHMNNIDFKCADVTS  119



>gb|EEC79642.1| hypothetical protein OsI_20868 [Oryza sativa Indica Group]
Length=504

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 88/114 (77%), Gaps = 9/114 (8%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERP---------EVLSMLPAYEGKSVL  323
            ER+ Q+SYW EHS +LTVEAMMLDS+     +   P         +VLS+LP+Y+GKSVL
Sbjct  13   ERKAQRSYWEEHSKDLTVEAMMLDSRPRRPRQGGAPRGLIGTVDAQVLSVLPSYKGKSVL  72

Query  324  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            ELGAGIGRFTGELA++AG V+A+DFIESVIKKNE INGH  NI FMCADVTS D
Sbjct  73   ELGAGIGRFTGELAKEAGHVLALDFIESVIKKNENINGHHKNITFMCADVTSPD  126



>ref|XP_002969650.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
 gb|EFJ29738.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
Length=495

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ER+ Q SYW EHS+ LTVE M+LDS+AA LD+EERPE+LSMLP  EG SV+ELGAGIGRF
Sbjct  9    ERDAQLSYWKEHSTALTVEEMLLDSQAAKLDQEERPEILSMLPPLEGISVVELGAGIGRF  68

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            TG+LA+ A  V+AMDF++SVI KN+ +NG   N++F+CADVTS
Sbjct  69   TGDLAKSAKHVVAMDFVQSVIDKNKEVNGCHKNVEFLCADVTS  111



>ref|XP_002970912.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
 gb|EFJ28238.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
Length=495

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ER+ Q SYW EHS+ LTVE M+LDS+AA LD+EERPE+LSMLP  EG SV+ELGAGIGRF
Sbjct  9    ERDAQLSYWKEHSTALTVEEMLLDSQAAKLDQEERPEILSMLPPLEGISVVELGAGIGRF  68

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
            TG+LA+ A  V+AMDF++SVI KN+ +NG   N++F+CADVTS
Sbjct  69   TGDLAKSAKHVVAMDFVQSVIDKNKEVNGCHRNVEFLCADVTS  111



>emb|CDX95799.1| BnaC05g35500D [Brassica napus]
Length=481

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 81/102 (79%), Gaps = 17/102 (17%)
 Frame = +3

Query  231  MMLDSKAADLDKEERPE-----------------VLSMLPAYEGKSVLELGAGIGRFTGE  359
            MMLDS+AADLDKEERPE                 VLS+LP YEGKSVLELGAGIGRFTGE
Sbjct  1    MMLDSRAADLDKEERPEEMFSLSLSLLRFRESDGVLSLLPPYEGKSVLELGAGIGRFTGE  60

Query  360  LAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            LAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS D
Sbjct  61   LAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPD  102



>gb|KHN10536.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=466

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  231  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  410
            MMLDSKAA LDKEERPEVLS+LP +EGKSV+ELGAGIGRFTGELA KAGQ++A+DFI++ 
Sbjct  1    MMLDSKAAHLDKEERPEVLSLLPPFEGKSVIELGAGIGRFTGELALKAGQLLAVDFIDTA  60

Query  411  IKKNETINGHLGNIKFMCADVTSKD  485
            IKKNETINGH  ++KF+CADVTS +
Sbjct  61   IKKNETINGHHNHVKFLCADVTSPN  85



>gb|KDD75565.1| hypothetical protein H632_c615p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=278

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  171  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  350
            ER VQK YWIEHS+  TVE MMLDSKAAD+DK ERPEVL +L + EGK V+ELGAGIGRF
Sbjct  10   ERAVQKQYWIEHSANATVETMMLDSKAADIDKMERPEVLELLGSVEGKDVVELGAGIGRF  69

Query  351  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVT  476
            T  LA  A  V+A+DF+E++I++N   N H GNI F C D T
Sbjct  70   TAPLASTAKSVVALDFMENLIEENRRTNSHYGNIDFRCGDAT  111



>gb|KIZ00652.1| hypothetical protein MNEG_7307 [Monoraphidium neglectum]
Length=252

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +EREVQ +YW+EHS E TVEAMMLDSKA+++D+ ERPEVLS L + +GK VLELGAGIGR
Sbjct  10   QEREVQLNYWLEHSKEPTVEAMMLDSKASEIDQMERPEVLSTLGSIKGKRVLELGAGIGR  69

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVT  476
            FTGE+A+ A  V+A DF+E  I +N   NGHL N+ F  ADVT
Sbjct  70   FTGEIAKTASSVLACDFMEVSIDENRRRNGHLPNVDFRVADVT  112



>ref|XP_011399976.1| Phosphoethanolamine N-methyltransferase [Auxenochlorella protothecoides]
 gb|KFM27020.1| Phosphoethanolamine N-methyltransferase [Auxenochlorella protothecoides]
Length=503

 Score =   139 bits (350),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            +ERE QKSYW EHSS  TVE+MMLDS+AAD+DK ERPEVL +L + +G  V+ELGAGIGR
Sbjct  5    QEREAQKSYWAEHSSNATVESMMLDSQAADIDKLERPEVLKLLGSVDGLDVVELGAGIGR  64

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FT  LA++A  V+A+DF+ ++I++N   NGHLGNI F C D T  D
Sbjct  65   FTRPLAEEARSVVALDFMPNLIEQNRVDNGHLGNIDFRCGDATELD  110



>ref|XP_006303561.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
 gb|EOA36459.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
Length=475

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 83/97 (86%), Gaps = 5/97 (5%)
 Frame = +3

Query  198  IEHSSELTVEAMMLDSKAADLDKEERP-EVLSMLPAYEGKSVLELGAGIGRFTGELAQKA  374
            +EHSS++ V++    ++A+DLDKEE P E+L ++P YEGK+VLELGAGIGRFTGELAQKA
Sbjct  1    MEHSSDVMVDS----TEASDLDKEELPHELLCLIPPYEGKTVLELGAGIGRFTGELAQKA  56

Query  375  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            G+VIA+DFIES I KNE++NGH  N+KFMCADVTS D
Sbjct  57   GEVIALDFIESAIHKNESVNGHYKNVKFMCADVTSPD  93



>gb|AGO59019.1| heat responsive transcription factor protein, partial [Triticum 
aestivum]
Length=460

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = +3

Query  231  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  410
            MMLDS+A DLDKEERPEVL++LP+Y GK+VLELGAGIGRFTGELA++AG VIA+DFI+SV
Sbjct  1    MMLDSRAKDLDKEERPEVLAILPSYAGKTVLELGAGIGRFTGELAKEAGHVIALDFIDSV  60

Query  411  IKKNETINGHL-GNIKFMCADVTS  479
            IKKNE ING +  NI FMCADVTS
Sbjct  61   IKKNEEINGDIYKNITFMCADVTS  84



>emb|CBI26879.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +3

Query  198  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  377
            +EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIGRFTGELA++AG
Sbjct  1    MEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIGRFTGELAKQAG  60

Query  378  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            QV+A+DFIESVI++NE ING   N KF+CADVTS D
Sbjct  61   QVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPD  96



>ref|XP_002730517.1| PREDICTED: phosphoethanolamine N-methyltransferase-like, partial 
[Saccoglossus kowalevskii]
Length=160

 Score =   129 bits (323),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +3

Query  165  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  344
             E R+V  SYW++HS + ++E MMLD++A  L + E PE+LS+LP YEGK ++ELGAGIG
Sbjct  4    NEVRQVMSSYWMDHSKDASLEEMMLDTQAESLAQSEHPEILSLLPPYEGKRIIELGAGIG  63

Query  345  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVT  476
            RFTG LA+KA  V A+DF+ES IKKN+  N H  N+ F  ADVT
Sbjct  64   RFTGVLAKKASHVTAVDFMESFIKKNKDANSHHKNVDFKQADVT  107



>ref|XP_002594091.1| hypothetical protein BRAFLDRAFT_68467 [Branchiostoma floridae]
 gb|EEN50102.1| hypothetical protein BRAFLDRAFT_68467 [Branchiostoma floridae]
Length=242

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +3

Query  174  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  353
            R+    +W EHSS+ ++E MMLD  A +L K+E PE+LS+LP  EGK++LELGAGIGR+T
Sbjct  10   RDKMSQFWREHSSQASIEEMMLDDAAKELSKDELPEILSLLPGIEGKTILELGAGIGRYT  69

Query  354  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVT  476
              LAQ+A  V A+DF+E  I+KNE +NGH  N++FM ADVT
Sbjct  70   APLAQQAKHVTAVDFMEPFIRKNEEVNGHHKNVRFMQADVT  110



>gb|EPS69227.1| hypothetical protein M569_05544 [Genlisea aurea]
Length=333

 Score =   127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  216  LTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMD  395
            L++E MM D+KA+DLD+EERPEVLS++P Y+GKS+LELGAG+GRFT E A+ A Q++A++
Sbjct  69   LSIEDMMADTKASDLDREERPEVLSLVPPYDGKSILELGAGVGRFTAEFAKTAAQIVAVE  128

Query  396  FIESVIKKNETINGHLGNIKFMCADVTSKD  485
             IES  +KNE  NGH  N KF+CADV S D
Sbjct  129  LIESAAEKNEITNGHHKNAKFICADVRSPD  158



>ref|XP_002594089.1| hypothetical protein BRAFLDRAFT_118790 [Branchiostoma floridae]
 gb|EEN50100.1| hypothetical protein BRAFLDRAFT_118790 [Branchiostoma floridae]
Length=577

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 84/115 (73%), Gaps = 6/115 (5%)
 Frame = +3

Query  150  MAAFQGEEREVQKS------YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  311
            M++ QGE  E + +      +W EHSS+ ++E MMLD  A +L K+E PE+LS+LP  EG
Sbjct  1    MSSDQGESAEYEATRDKMSQFWREHSSKASLEEMMLDDNAKELSKDELPEILSLLPGIEG  60

Query  312  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVT  476
            K++LELGAGIGR+T  LAQ+A  V A+DF+ES I+KNE +NGH  N++FM ADVT
Sbjct  61   KTILELGAGIGRYTAPLAQQAKHVTAVDFMESFIRKNEEVNGHHKNVRFMQADVT  115



>ref|XP_004166030.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase 
1-like [Cucumis sativus]
Length=468

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  222  VEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFI  401
            +E+MM+DS + +LD EE  EV+S+LP YEGK+V+ELGAGIGRFT ELAQ+A QVIA+DF+
Sbjct  1    MESMMVDSDSHELDSEETAEVISLLPPYEGKTVVELGAGIGRFTSELAQRAAQVIAVDFV  60

Query  402  ESVIKKNETINGHLGNIKFMCADVT  476
            E VI+KNE+INGH  N+KF CADVT
Sbjct  61   EDVIRKNESINGHHKNVKFQCADVT  85



>ref|XP_004137342.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 gb|KGN63873.1| hypothetical protein Csa_1G025050 [Cucumis sativus]
Length=468

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  222  VEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFI  401
            +E+MM+DS + +LD EE  EV+S+LP YEGK+V+ELGAGIGRFT ELAQ+A QVIA+DF+
Sbjct  1    MESMMVDSDSHELDSEETAEVISLLPPYEGKTVVELGAGIGRFTSELAQRAAQVIAVDFV  60

Query  402  ESVIKKNETINGHLGNIKFMCADVT  476
            E VI+KNE+INGH  N+KF CADVT
Sbjct  61   EDVIRKNESINGHHKNVKFQCADVT  85



>ref|XP_010540184.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Tarenaya hassleriana]
Length=457

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  270  ERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGN  449
            ERPE+LS+LP +EGKSVLE GAGIGRFTGE AQ+A QVIA+DFIESVIKKNE INGH  N
Sbjct  6    ERPEILSVLPPFEGKSVLEFGAGIGRFTGEFAQRASQVIAVDFIESVIKKNEDINGHHKN  65

Query  450  IKFMCADVTSKD  485
            +KFMCADVTS D
Sbjct  66   VKFMCADVTSPD  77



>ref|XP_002594077.1| hypothetical protein BRAFLDRAFT_68483 [Branchiostoma floridae]
 gb|EEN50088.1| hypothetical protein BRAFLDRAFT_68483 [Branchiostoma floridae]
Length=274

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  192  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  371
            +W E S + +++ MMLD  A +LD+EERPE+L+MLP  +GK VLELGAGIGRFT  LA++
Sbjct  56   FWREQSHDGSLQEMMLDENADELDQEERPEILAMLPDLKGKRVLELGAGIGRFTPSLARQ  115

Query  372  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            A  V A+DF+ES IKKNE  N HLGNI F+ ADVT  D
Sbjct  116  ADHVTAVDFMESFIKKNEEANRHLGNINFLQADVTRLD  153



>ref|XP_009011308.1| hypothetical protein HELRODRAFT_71964 [Helobdella robusta]
 gb|ESO11039.1| hypothetical protein HELRODRAFT_71964 [Helobdella robusta]
Length=215

 Score =   122 bits (305),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  186  KSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELA  365
            +++W EHS++   E MMLDS A  L +EE PE+LS+LP  EGKSVLELGAGIGRF+G +A
Sbjct  2    QNFWKEHSTKANEEEMMLDSDADTLGREEVPEILSLLPGLEGKSVLELGAGIGRFSGRIA  61

Query  366  QKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADV  473
             KA  V+A+DF+E+ IK NE+ NGH GNI+F+ ADV
Sbjct  62   AKAKSVVAVDFMENFIKCNESTNGHHGNIQFVQADV  97



>ref|XP_005643867.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE19323.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=498

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            EER  QKSYW +HS+  +VEAMMLDS+A+ +DKEERPEVL+ML   EG  ++ELGAGIGR
Sbjct  16   EERAAQKSYWADHSATASVEAMMLDSQASVIDKEERPEVLTMLGCVEGARIVELGAGIGR  75

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVT  476
            FTGELA  A  V+A+DF+E++I +N   N H  N+++   D T
Sbjct  76   FTGELAVAARSVLAVDFMENLIAENRRANSHRRNVRWQVGDAT  118



>ref|XP_005096334.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Aplysia californica]
Length=494

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            E R+V  +YW EHS + +VE MMLD+ A +L KEE PE+LS LP Y GK V+ELGAGIGR
Sbjct  4    EVRQVMAAYWKEHSKQGSVEEMMLDNTAEELSKEELPEILSYLPEYAGKDVIELGAGIGR  63

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            FT E+A+KA  V A+DF+E  I KN+  N +  NI+++ ADVT  D
Sbjct  64   FTTEIAKKAKSVAAVDFMEEFINKNKKTNQNFNNIEYVVADVTKLD  109



>gb|EWM27854.1| phosphoethanolamine n-methyltransferase [Nannochloropsis gaditana]
Length=597

 Score =   122 bits (305),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 58/120 (48%), Positives = 79/120 (66%), Gaps = 4/120 (3%)
 Frame = +3

Query  126  FTAIVQSAMAAFQ--GEEREVQKSYWIEHSSE--LTVEAMMLDSKAADLDKEERPEVLSM  293
            F ++    M +F    EER VQ+ YW EHS +   ++E MMLD  A+ LD  +RPE+LSM
Sbjct  58   FLSLFDINMTSFSLTEEERTVQREYWQEHSKKHGSSMENMMLDDSASKLDLMDRPEILSM  117

Query  294  LPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADV  473
            LP Y    +LEL +GIGRFTG LA KAG V+ ++F+E  + KN+ ++ H GN  F+CADV
Sbjct  118  LPTYSDIRILELASGIGRFTGSLASKAGSVVTVEFMEEFVAKNKELHNHFGNCDFLCADV  177



>ref|XP_008324913.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Cynoglossus semilaevis]
Length=491

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  174  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  353
            R    ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T
Sbjct  5    RNNMAAFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYT  64

Query  354  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVT  476
             +L  KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT
Sbjct  65   SQLLTKAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVT  105



>ref|XP_008324912.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Cynoglossus semilaevis]
Length=495

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  174  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  353
            R    ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T
Sbjct  5    RNNMAAFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYT  64

Query  354  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVT  476
             +L  KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT
Sbjct  65   SQLLTKAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVT  105



>ref|XP_008324914.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324916.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324917.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
Length=488

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +3

Query  189  SYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQ  368
            ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T +L  
Sbjct  3    AFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYTSQLLT  62

Query  369  KAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVT  476
            KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT
Sbjct  63   KAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVT  98



>gb|ETM43048.1| hypothetical protein L914_11412, partial [Phytophthora parasitica]
Length=244

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  353
            R++ K+YW  HSS  TVE MMLDS A  L + E PE+L   P+ E K VLEL AGIGR+T
Sbjct  5    RDLMKAYWEGHSSSATVETMMLDSHAKTLTELEVPEILDKAPSMEHKDVLELAAGIGRYT  64

Query  354  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADV  473
              +A KA  V A++FIE  IK NE  NGHLGNIKF+C DV
Sbjct  65   SVIATKAKSVTAVEFIEDFIKVNEDKNGHLGNIKFLCKDV  104



>ref|XP_010231068.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Brachypodium distachyon]
Length=472

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 1/78 (1%)
 Frame = +3

Query  249  AADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNET  428
            AA+LD E    VLS+LP+YEGK+VLELGAGIGRFTGELA++AG V+A+DFI+SVIKKNE 
Sbjct  15   AAELDPESDQWVLSILPSYEGKTVLELGAGIGRFTGELAKEAGHVLALDFIDSVIKKNEE  74

Query  429  INGHL-GNIKFMCADVTS  479
            INGH+  NI FMCADVTS
Sbjct  75   INGHIHNNITFMCADVTS  92



>gb|EAY75471.1| hypothetical protein OsI_03371 [Oryza sativa Indica Group]
Length=456

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  249  AADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNET  428
             ADLD      +LS+LP YEGKSVLELGAGIGRFTGEL + AG V+AMDFIESVIKKNE+
Sbjct  8    TADLDIVASHRILSLLPPYEGKSVLELGAGIGRFTGELVKTAGHVLAMDFIESVIKKNES  67

Query  429  INGHLGNIKFMCADVTSKD  485
            INGH  N  FMCADVT  D
Sbjct  68   INGHHKNASFMCADVTCPD  86



>ref|NP_001096276.2| phosphoethanolamine methyltransferase [Xenopus (Silurana) tropicalis]
Length=494

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  347
            + R+V   +W EHS + TVE MMLDS A  L  EE+PE++ +LP  +G SVLELGAGIGR
Sbjct  4    DTRQVMTQFWEEHSRDATVEEMMLDSSAKLLSLEEKPEIILLLPCLDGHSVLELGAGIGR  63

Query  348  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            +TG LA+ A  V A+DF+++ I+KN+  NG  GNI F+ ADVT+ D
Sbjct  64   YTGHLAKLASHVTAVDFMQNFIEKNQKDNGFRGNITFLQADVTNLD  109



>ref|XP_006003521.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Latimeria chalumnae]
Length=264

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  186  KSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELA  365
            K +W EHS E +VE MMLDS A  + +E+R E+++MLP  EGK VLELGAGIGRF+G+LA
Sbjct  2    KQFWEEHSKEASVEEMMLDSNAQAIAEEDRSEIIAMLPCVEGKDVLELGAGIGRFSGQLA  61

Query  366  QKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            +KA +V A+DF+++ ++KN  +N   GN+ F+ ADVT+ D
Sbjct  62   KKARRVTAVDFMKTFMEKNREVNKVYGNVTFLQADVTNLD  101



>ref|XP_008418601.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Poecilia reticulata]
Length=491

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = +3

Query  192  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  371
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  10   FWKEHSKAATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  69

Query  372  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D
Sbjct  70   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLD  107



>ref|XP_005855505.1| phosphoethanolamine n-methyltransferase [Nannochloropsis gaditana 
CCMP526]
 gb|EKU20863.1| phosphoethanolamine n-methyltransferase [Nannochloropsis gaditana 
CCMP526]
Length=536

 Score =   119 bits (297),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/104 (53%), Positives = 73/104 (70%), Gaps = 2/104 (2%)
 Frame = +3

Query  168  EEREVQKSYWIEHSSEL--TVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGI  341
            EER VQ+ YW EHS +   ++E MMLD  A+ LD  +RPE+LSMLP Y    +LEL +GI
Sbjct  9    EERTVQREYWQEHSKKQGSSMENMMLDDSASKLDLMDRPEILSMLPTYSDIRILELASGI  68

Query  342  GRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADV  473
            GRFTG LA KAG V+ ++F+E  + KN+ ++ H GN  F+CADV
Sbjct  69   GRFTGSLASKAGSVVTVEFMEEFVAKNKELHNHFGNCDFLCADV  112



>ref|XP_008418600.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Poecilia reticulata]
Length=492

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = +3

Query  192  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  371
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  70

Query  372  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLD  108



>emb|CDQ92053.1| unnamed protein product [Oncorhynchus mykiss]
Length=135

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 67/98 (68%), Gaps = 0/98 (0%)
 Frame = +3

Query  192  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  371
            +W EHS + TVE MMLDS A +L   E PE+LS+LP+  G+ VLELGAGIGR+T  L  +
Sbjct  4    FWKEHSRQATVEEMMLDSHAQELTLHELPEILSLLPSLSGQRVLELGAGIGRYTSHLLTQ  63

Query  372  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            A  V A+DF+ES ++KN   N H GN  F+ ADVT  D
Sbjct  64   ASHVTAVDFMESFVEKNRQDNSHHGNASFLQADVTKLD  101



>ref|XP_008278559.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Stegastes partitus]
Length=510

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +3

Query  174  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  353
            R     +W EHSSE TVE MMLDS+A +L  +E PE+LSMLP+ +G  VLELGAGIGR+T
Sbjct  23   RSNMTEFWKEHSSEATVEKMMLDSQARELTTQELPEILSMLPSLDGCRVLELGAGIGRYT  82

Query  354  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
              L  KAG V A+DF+ES +++N   NGH  N+  + ADVT  D
Sbjct  83   SHLLTKAGHVTAVDFMESFVERNRKENGHHSNVSIIQADVTKMD  126



>gb|ETK83171.1| hypothetical protein L915_11577 [Phytophthora parasitica]
Length=185

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  353
            R++ K+YW  HSS  TVE MMLDS A  L + E PE+L   P+ E K VLEL AGIGR+T
Sbjct  5    RDLMKAYWEGHSSSATVETMMLDSHAKTLTELEVPEILDKAPSMEHKDVLELAAGIGRYT  64

Query  354  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADV  473
              +A  A  V A++FIE  IK NE  NGHLGNIKF+C DV
Sbjct  65   SVIATMAKSVTAVEFIEDFIKVNEDKNGHLGNIKFLCKDV  104



>ref|XP_008278560.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
 ref|XP_008278561.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
Length=492

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +3

Query  174  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  353
            R     +W EHSSE TVE MMLDS+A +L  +E PE+LSMLP+ +G  VLELGAGIGR+T
Sbjct  5    RSNMTEFWKEHSSEATVEKMMLDSQARELTTQELPEILSMLPSLDGCRVLELGAGIGRYT  64

Query  354  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
              L  KAG V A+DF+ES +++N   NGH  N+  + ADVT  D
Sbjct  65   SHLLTKAGHVTAVDFMESFVERNRKENGHHSNVSIIQADVTKMD  108



>ref|XP_007550439.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Poecilia 
formosa]
Length=492

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = +3

Query  192  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  371
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKGATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  70

Query  372  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLD  108



>ref|XP_005096335.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Aplysia californica]
 ref|XP_005096336.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Aplysia californica]
Length=486

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = +3

Query  189  SYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQ  368
            +YW EHS + +VE MMLD+ A +L KEE PE+LS LP Y GK V+ELGAGIGRFT E+A+
Sbjct  3    AYWKEHSKQGSVEEMMLDNTAEELSKEELPEILSYLPEYAGKDVIELGAGIGRFTTEIAK  62

Query  369  KAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            KA  V A+DF+E  I KN+  N +  NI+++ ADVT  D
Sbjct  63   KAKSVAAVDFMEEFINKNKKTNQNFNNIEYVVADVTKLD  101



>gb|ETL36539.1| hypothetical protein L916_11495, partial [Phytophthora parasitica]
Length=244

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  353
            R++ K+YW  HSS  TVE MMLDS A  L + E PE+L   P+ E K VLEL AGIGR+T
Sbjct  5    RDLMKAYWEGHSSSATVETMMLDSHAKTLTELEVPEILDKAPSMEHKDVLELAAGIGRYT  64

Query  354  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADV  473
              +A  A  V A++FIE  IK NE  NGHLGNIKF+C DV
Sbjct  65   SVIATMAKSVTAVEFIEDFIKVNEDKNGHLGNIKFLCKDV  104



>ref|XP_002898137.1| phosphoethanolamine N-methyltransferase, putative [Phytophthora 
infestans T30-4]
 gb|EEY63550.1| phosphoethanolamine N-methyltransferase, putative [Phytophthora 
infestans T30-4]
Length=531

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = +3

Query  174  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  353
            RE+ K+YW  HSS  TVE MMLDS A  L + E PE+L+  P  E K VLEL AGIGR+T
Sbjct  45   RELMKAYWEGHSSSATVETMMLDSHAKTLTELELPEILNKAPCLENKDVLELAAGIGRYT  104

Query  354  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTS  479
              +A KA  V A++FIE  IK N   NGHLGNIKF+C DV +
Sbjct  105  SVIATKAKSVTAVEFIEDFIKVNADNNGHLGNIKFLCKDVVN  146



>ref|XP_005806845.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Xiphophorus 
maculatus]
Length=492

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 67/98 (68%), Gaps = 0/98 (0%)
 Frame = +3

Query  192  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  371
            +W EHS   TVE MMLDS+A  L + E PE+LSMLP  EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSQAKKLTEHELPEILSMLPPLEGRRVLELGAGIGRFTSHLLTK  70

Query  372  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLD  108



>ref|XP_005723169.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Pundamilia nyererei]
Length=485

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +3

Query  192  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  371
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  4    FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  63

Query  372  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT  D
Sbjct  64   AAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTKLD  101



>ref|XP_005723168.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Pundamilia nyererei]
Length=491

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = +3

Query  174  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  353
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T
Sbjct  4    RSNMTEFWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYT  63

Query  354  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
              L  KA  V A+DF+ES I+KN   NGH  N  F+ ADVT  D
Sbjct  64   KHLLTKAAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTKLD  107



>ref|XP_005723167.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Pundamilia nyererei]
Length=492

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = +3

Query  174  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  353
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T
Sbjct  5    RSNMTEFWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYT  64

Query  354  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
              L  KA  V A+DF+ES I+KN   NGH  N  F+ ADVT  D
Sbjct  65   KHLLTKAAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTKLD  108



>gb|AAI35513.1| LOC100124841 protein [Xenopus (Silurana) tropicalis]
Length=486

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +3

Query  192  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  371
            +W EHS + TVE MMLDS A  L  EE+PE++ +LP  +G SVLELGAGIGR+TG LA+ 
Sbjct  4    FWEEHSRDATVEEMMLDSSAKLLSLEEKPEIILLLPCLDGHSVLELGAGIGRYTGHLAKL  63

Query  372  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            A  V A+DF+++ I+KN+  NG  GNI F+ ADVT+ D
Sbjct  64   ASHVTAVDFMQNFIEKNQKDNGFRGNITFLQADVTNLD  101



>ref|XP_005467629.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X4 [Oreochromis niloticus]
Length=485

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +3

Query  192  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  371
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  4    FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  63

Query  372  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT  D
Sbjct  64   AAHVTAVDFMESFIEKNRQENGHHSNGTFLQADVTKLD  101



>ref|XP_003444639.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Oreochromis niloticus]
Length=493

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = +3

Query  174  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  353
            R     +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T
Sbjct  6    RSNMTEFWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYT  65

Query  354  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
              L  KA  V A+DF+ES I+KN   NGH  N  F+ ADVT  D
Sbjct  66   KHLLTKAAHVTAVDFMESFIEKNRQENGHHSNGTFLQADVTKLD  109



>ref|XP_005467627.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Oreochromis niloticus]
 ref|XP_005467628.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Oreochromis niloticus]
Length=492

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +3

Query  192  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  371
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  70

Query  372  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKD  485
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT  D
Sbjct  71   AAHVTAVDFMESFIEKNRQENGHHSNGTFLQADVTKLD  108



>ref|XP_008620239.1| hypothetical protein SDRG_15833 [Saprolegnia diclina VS20]
 gb|EQC26346.1| hypothetical protein SDRG_15833 [Saprolegnia diclina VS20]
Length=498

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  353
            R   KSYW EHS E T+E MMLDS A  L + E PE+L+ LP  + K VLE+ AGIGR+T
Sbjct  12   RNDMKSYWSEHSQETTIETMMLDSNAKVLHELEIPEILAKLPDVKDKDVLEMAAGIGRYT  71

Query  354  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADV  473
            G +A +A  + A++FIE   K NE  NGH GN+ F+CADV
Sbjct  72   GRIADEAASITAVEFIEDFHKANEKANGHRGNVSFLCADV  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562360051550