BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF022O10

Length=462
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAC49564.1|  lectin                                                99.0    7e-23   Calystegia sepium
gb|AAG10403.1|AF233284_1  mannose-binding lectin                      98.6    1e-22   Convolvulus arvensis
pdb|1OUW|A  Chain A, Crystal Structure Of Calystegia Sepium Agglu...  94.7    3e-21   Calystegia sepium
pdb|3R50|A  Chain A, Structure Analysis Of A Wound-Inducible Lect...  60.5    2e-09   Ipomoea batatas [batate]
dbj|BAA14024.1|  ipomoelin                                            60.5    2e-09   Ipomoea batatas [batate]
ref|XP_006354454.1|  PREDICTED: probable disease resistance RPP8-...  48.5    5e-04   Solanum tuberosum [potatoes]



>gb|AAC49564.1| lectin [Calystegia sepium]
Length=153

 Score = 99.0 bits (245),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 87/115 (76%), Gaps = 5/115 (4%)
 Frame = +2

Query  65   MAISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDSL  244
            MA+  D   GP G+NGG+FWSFRP+NKI+Q I++S G G NNPI +TFSST  DGSKD++
Sbjct  1    MAVPMDTISGPWGNNGGNFWSFRPVNKINQ-IVISYGGGGNNPIALTFSSTKADGSKDTI  59

Query  245  TIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVKS  409
            T+GGGG + ++   + +NI G DEYLT ISG FG ++D   +VLRS+ FTTN+K+
Sbjct  60   TVGGGGPD-SITGTEMVNI-GTDEYLTGISGTFGIYLDN--NVLRSITFTTNLKA  110



>gb|AAG10403.1|AF233284_1 mannose-binding lectin [Convolvulus arvensis]
Length=152

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 85/123 (69%), Gaps = 6/123 (5%)
 Frame = +2

Query  65   MAISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDSL  244
            M +  D   GP G+NGG+FWSFRP+NKI+Q  I+   S  NNPI +TFS+T  DGSKD++
Sbjct  1    MTVPIDTISGPWGNNGGNFWSFRPINKINQ--IVITYSAGNNPIALTFSATKADGSKDTI  58

Query  245  TIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVKSVWAIR  424
            T+GG G + ++   DT++I GADEY+T ISG FG ++D   +VLRS+KF TN+K+     
Sbjct  59   TVGGAGPD-SITGTDTVDI-GADEYVTGISGTFGIYLDN--NVLRSIKFITNLKAYGPYG  114

Query  425  PQC  433
            P  
Sbjct  115  PNV  117



>pdb|1OUW|A Chain A, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|B Chain B, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|C Chain C, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|D Chain D, Crystal Structure Of Calystegia Sepium Agglutinin
Length=152

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 85/113 (75%), Gaps = 5/113 (4%)
 Frame = +2

Query  71   ISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDSLTI  250
            +  D   GP G+NGG+FWSFRP+NKI+Q I++S G G NNPI +TFSST  DGSKD++T+
Sbjct  2    VPMDTISGPWGNNGGNFWSFRPVNKINQ-IVISYGGGGNNPIALTFSSTKADGSKDTITV  60

Query  251  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVKS  409
            GGGG + ++   + +NI G DEYLT ISG FG ++D   +VLRS+ FTTN+K+
Sbjct  61   GGGGPD-SITGTEMVNI-GTDEYLTGISGTFGIYLDN--NVLRSITFTTNLKA  109



>pdb|3R50|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|E Chain E, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
Length=160

 Score = 60.5 bits (145),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (59%), Gaps = 12/116 (10%)
 Frame = +2

Query  65   MAISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggs--gnnnpigiTFSSTNKDGSKD  238
            +A  +D   GP+G NGG FWSFRP+  +++I++   GS     N I ITFSS       D
Sbjct  11   LAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQTLNLISITFSSN----PTD  66

Query  239  SLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVK  406
             +T+GG G E  +   +T+NIDG    + EISG    +    ++V+RS+KFTTN K
Sbjct  67   IITVGGVGPE-PLTYTETVNIDGD---IIEISGMIANY--KGYNVIRSIKFTTNKK  116


 Score = 28.1 bits (61),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +3

Query  405  RAFGPYGPNVGTPFNFQ  455
            + +GPYG N GTPFN +
Sbjct  116  KEYGPYGANAGTPFNIK  132



>dbj|BAA14024.1| ipomoelin [Ipomoea batatas]
Length=154

 Score = 60.5 bits (145),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (59%), Gaps = 12/116 (10%)
 Frame = +2

Query  65   MAISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggs--gnnnpigiTFSSTNKDGSKD  238
            +A  +D   GP+G NGG FWSFRP+  +++I++   GS     N I ITFSS       D
Sbjct  5    LAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQTLNLISITFSSN----PTD  60

Query  239  SLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVK  406
             +T+GG G E  +   +T+NIDG    + EISG    +    ++V+RS+KFTTN K
Sbjct  61   IITVGGVGPE-PLTYTETVNIDGD---IIEISGMIANY--KGYNVIRSIKFTTNKK  110


 Score = 28.1 bits (61),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +3

Query  405  RAFGPYGPNVGTPFNFQ  455
            + +GPYG N GTPFN +
Sbjct  110  KEYGPYGANAGTPFNIK  126



>ref|XP_006354454.1| PREDICTED: probable disease resistance RPP8-like protein 4-like 
[Solanum tuberosum]
Length=303

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 54/101 (53%), Gaps = 10/101 (10%)
 Frame = +2

Query  101  GHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDSLTIGGGGNETTVI  280
            G +GG  W++RP   + QI++  G   ++      F S+ ++G  +S T GG G   T  
Sbjct  161  GGSGGSHWNYRPKGVVKQIVVKHGLIIDSI----MFKSSEENGVMESKTFGGSGGHLTT-  215

Query  281  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNV  403
                INID   EYLT +SG +G +    + +++S+K  TN+
Sbjct  216  ---EINIDSPSEYLTGLSGTYGLY--GPYLIIKSIKLHTNL  251



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561614547535