BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF022M07

Length=435
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009766381.1|  PREDICTED: early light-induced protein, chlo...  65.5    2e-10   Nicotiana sylvestris
ref|XP_006363471.1|  PREDICTED: early light-induced protein, chlo...  64.3    4e-10   Solanum tuberosum [potatoes]
ref|XP_009616081.1|  PREDICTED: early light-induced protein, chlo...  63.5    1e-09   Nicotiana tomentosiformis
ref|XP_004247604.1|  PREDICTED: early light-induced protein 1, ch...  62.8    2e-09   
ref|XP_004247605.1|  PREDICTED: early light-induced protein 1, ch...  62.4    2e-09   
gb|ACB20694.1|  putative cold-inducible protein                       58.2    7e-08   Camellia sinensis [black tea]
gb|ADM72804.1|  early light-inducible protein                         56.2    2e-07   Capsicum annuum
ref|XP_007034868.1|  Early light-induced protein, putative            55.5    6e-07   
ref|XP_009778398.1|  PREDICTED: early light-induced protein, chlo...  54.7    1e-06   Nicotiana sylvestris
gb|ABU98940.1|  early light-induced protein 3                         54.3    1e-06   Rhododendron catawbiense [Catawba rosebay]
gb|ABU98938.1|  early light-induced protein 1                         53.1    3e-06   Rhododendron catawbiense [Catawba rosebay]
gb|ABU98939.1|  early light-induced protein 2                         52.0    9e-06   Rhododendron catawbiense [Catawba rosebay]
gb|AFK38527.1|  unknown                                               52.0    1e-05   Lotus japonicus
gb|ACV89760.1|  putative early light induced protein 2                51.6    1e-05   Camellia sinensis [black tea]
gb|AAO33591.1|AF479309_1  putative early light induced protein        51.2    2e-05   Arachis hypogaea [goober]
gb|AFK41568.1|  unknown                                               50.8    3e-05   Lotus japonicus
gb|ABU98942.1|  early light-induced protein 5                         48.9    1e-04   Rhododendron catawbiense [Catawba rosebay]
gb|AFK38098.1|  unknown                                               49.3    1e-04   Lotus japonicus
gb|AFK48277.1|  unknown                                               47.4    5e-04   Lotus japonicus



>ref|XP_009766381.1| PREDICTED: early light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=195

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 58/100 (58%), Gaps = 9/100 (9%)
 Frame = +1

Query  142  MASTVVMQSIL--GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  315
            M ++  MQS++   SP TSF  RNG++QFVP  YLPR Q++    V+ MSED   KEQ +
Sbjct  1    MTTSFAMQSMIVGSSPPTSFSKRNGLNQFVPGCYLPRFQKSSRLRVKCMSEDGEKKEQSS  60

Query  316  TPVTEssttapkptpppspapkvaaksstNLWDVFSFSGP  435
            +P+T              P P   AK+STN  DVFSFSG 
Sbjct  61   SPLTN-------TAATSKPTPPPPAKASTNFSDVFSFSGA  93



>ref|XP_006363471.1| PREDICTED: early light-induced protein, chloroplastic-like [Solanum 
tuberosum]
Length=197

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = +1

Query  142  MASTVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            M+++  MQSI LGSPV   ++RNG++QFVPS YLPRL R     V+ M+E+    ++ +T
Sbjct  1    MSTSFAMQSIILGSPVKLSQSRNGLNQFVPSCYLPRLHRRSPLRVKCMAEEGEKLDKAST  60

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGP  435
            P+T+    +    P P+PAP   AK STN  D+FSFSGP
Sbjct  61   PLTD----SAATVPKPTPAPFAKAKPSTNFSDIFSFSGP  95



>ref|XP_009616081.1| PREDICTED: early light-induced protein, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=199

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = +1

Query  142  MASTVVMQS-ILGSPVTS-FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  315
            MA+ V MQ+ ILGSP+ S    RNGV+QFVPS Y+PRLQRN +  V+ MSED   K Q +
Sbjct  1    MATCVGMQTMILGSPIVSNISKRNGVNQFVPSCYIPRLQRNSTLSVKCMSEDGE-KGQTS  59

Query  316  TPVTEssttapkptpppspapkvaaksstNLWDVFSFSGP  435
              + +       PTP P+P P   AK+ST   D+F+FSGP
Sbjct  60   NSLND---ITATPTPTPTPTPPPVAKTSTKFGDLFAFSGP  96



>ref|XP_004247604.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X1 [Solanum lycopersicum]
Length=192

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 59/99 (60%), Gaps = 10/99 (10%)
 Frame = +1

Query  142  MASTVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            M ++  MQSI LGSPV   +++NG++QFVPS YLPRL+R     V+ M+E+  G+++ +T
Sbjct  1    MITSFAMQSIILGSPVKLSQSKNGLNQFVPSCYLPRLRRTSRVRVKCMAEE--GEKESST  58

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGP  435
            P T+        +           K STN  D+FSFSGP
Sbjct  59   PSTD-------YSATVPKPTPAKPKPSTNFIDIFSFSGP  90



>ref|XP_004247605.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X2 [Solanum lycopersicum]
 gb|AAS92268.1| early light inducible protein [Solanum lycopersicum]
Length=191

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 57/97 (59%), Gaps = 10/97 (10%)
 Frame = +1

Query  148  STVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  324
            ++  MQSI LGSP+   +N+NG++QFVPS YLPRL R     V+ M+E+  G+++ +TP 
Sbjct  2    TSFAMQSIILGSPLKLSQNKNGLNQFVPSCYLPRLHRTSRVSVKCMAEE--GEKESSTPS  59

Query  325  TEssttapkptpppspapkvaaksstNLWDVFSFSGP  435
            T+        +           K STN  D+FSFSGP
Sbjct  60   TD-------YSATVPKPTPAKPKPSTNFIDIFSFSGP  89



>gb|ACB20694.1| putative cold-inducible protein [Camellia sinensis]
 gb|ACV89762.1| putative light-inducible protein [Camellia sinensis]
Length=190

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  148  STVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKE  306
            +T  MQSIL  PV+    R   SQF P SY+PRLQRN    VR M+EDD  K+
Sbjct  2    ATPAMQSILARPVSGVTARARFSQFTPCSYVPRLQRNAGMQVRCMAEDDQNKD  54



>gb|ADM72804.1| early light-inducible protein [Capsicum annuum]
Length=160

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +1

Query  169  ILGSPVTSF-KNRNGVSQFVPSSYLPRLQRNPSFLVRSMSE  288
            ILGSPVTS  ++RNG++QFVPSSYLPRL RN    V+ MSE
Sbjct  2    ILGSPVTSLSQSRNGLNQFVPSSYLPRLHRNTRLRVKCMSE  42



>ref|XP_007034868.1| Early light-induced protein, putative [Theobroma cacao]
 gb|EOY05794.1| Early light-induced protein, putative [Theobroma cacao]
Length=193

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = +1

Query  142  MASTVVMQSIL-GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA++  MQS+L   PVT   NR  V QF P   +PR QRN +  VR ++E++   EQPT 
Sbjct  1    MAASSAMQSLLLAGPVTGLANRGRVIQFFPVKSVPRFQRNANLHVRCLAEEEP-TEQPTK  59

Query  319  PVT  327
            PVT
Sbjct  60   PVT  62



>ref|XP_009778398.1| PREDICTED: early light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=200

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = +1

Query  142  MASTVVMQS-ILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSED  291
            MA    MQS ILGSP+ S   RNGV+QFVP  Y+PR QRN +  V+ MSED
Sbjct  1    MAICGGMQSMILGSPIVS--KRNGVNQFVPCCYIPRPQRNSTLSVKCMSED  49



>gb|ABU98940.1| early light-induced protein 3 [Rhododendron catawbiense]
Length=181

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 53/99 (54%), Gaps = 19/99 (19%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA++ VMQSIL SPVT      G+S+ +P SSYLPR  R+   LVR M++D   KE+  +
Sbjct  1    MATSSVMQSILVSPVTGVAKGAGLSRTIPRSSYLPRQGRDSGMLVRCMAKDGK-KEEVES  59

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGP  435
            PV                     AK+  + +D+ +FSGP
Sbjct  60   PVK-----------------ATVAKARIDFFDLLAFSGP  81



>gb|ABU98938.1| early light-induced protein 1 [Rhododendron catawbiense]
Length=181

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA++ VMQSIL SPVT      G+S+ +P S YLPR  RN   LVR M++D   KE+  +
Sbjct  1    MATSSVMQSILVSPVTGVAKGAGLSRTIPRSCYLPRQGRNSGMLVRCMAKDGR-KEEVES  59

Query  319  PV  324
            P+
Sbjct  60   PI  61



>gb|ABU98939.1| early light-induced protein 2 [Rhododendron catawbiense]
Length=181

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 52/99 (53%), Gaps = 19/99 (19%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA++ VMQSIL SPVT      G+++ +P S YLPR  RN   LVR M++D   KE+  +
Sbjct  1    MATSSVMQSILVSPVTGVAKGAGLNRTIPRSCYLPRQGRNSGMLVRCMAKDGR-KEEVES  59

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGP  435
            P+                     AK  T+ +D+ +FSGP
Sbjct  60   PIE-----------------ANVAKVKTDFFDLLAFSGP  81



>gb|AFK38527.1| unknown [Lotus japonicus]
Length=193

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 2/57 (4%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFV-PSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVT  327
            MQSI+ SP+     R+ V+QF  P+ Y+P L+RN +  VRSM+E +  KEQP  PVT
Sbjct  4    MQSIISSPMIRMTTRSRVNQFTTPAVYMPSLRRNATLRVRSMAEGEP-KEQPIEPVT  59



>gb|ACV89760.1| putative early light induced protein 2 [Camellia sinensis]
 gb|ACV89763.1| putative early light induced protein 2 [Camellia sinensis]
Length=175

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSE  288
            MA++  MQS+L  PVTS   R    QF P SY+P LQ+N S  VR M++
Sbjct  1    MATSATMQSVLARPVTSVTTRARFGQFTPCSYVPYLQKNASMQVRCMAK  49



>gb|AAO33591.1|AF479309_1 putative early light induced protein [Arachis hypogaea]
Length=189

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +1

Query  148  STVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  315
            S+  MQSIL SP+T   +R+ V+QF VP+ Y+P ++RN S  VRSM+E++  KEQ T
Sbjct  4    SSYAMQSILASPMTRTPSRSRVNQFGVPALYMPNMRRNASLSVRSMAEEEQ-KEQST  59



>gb|AFK41568.1| unknown [Lotus japonicus]
Length=194

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = +1

Query  145  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  321
            +ST  MQSIL +P+     R+ V+QF +PS Y+P  +RN S  VRSM+E+   K+QP  P
Sbjct  3    SSTSAMQSILANPMIRMTTRSRVNQFTIPSVYMPSQRRNSSLRVRSMAEEP--KKQPIEP  60

Query  322  VT  327
             T
Sbjct  61   AT  62



>gb|ABU98942.1| early light-induced protein 5 [Rhododendron catawbiense]
Length=177

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 3/62 (5%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVPSS--YLPRLQRNPSFLVRSMSEDDAGKEQPT  315
            MA++ VMQSI+ SPVT      G+S+ +P S  YLPR  RN   LVR M++    KE+  
Sbjct  1    MATSSVMQSIMVSPVTGVAKGTGLSRTIPRSCCYLPRQGRNSGMLVRCMAKGGQ-KEEAG  59

Query  316  TP  321
            +P
Sbjct  60   SP  61



>gb|AFK38098.1| unknown [Lotus japonicus]
Length=188

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = +1

Query  145  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQ  309
            +ST  MQSIL +P+     R+ V+QF +PS Y+P L+RN S  VRSM+E+   KEQ
Sbjct  3    SSTSAMQSILANPMIRMTTRSRVNQFTIPSVYMPSLRRNSSLRVRSMAEEP--KEQ  56



>gb|AFK48277.1| unknown [Lotus japonicus]
Length=188

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = +1

Query  145  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQ  309
            +ST  +QSIL +P+     R+ V+QF +PS Y+P L+RN S  VRSM+E+   KEQ
Sbjct  3    SSTSAIQSILANPMIRMTTRSRVNQFTIPSVYMPSLRRNSSLRVRSMAEEP--KEQ  56



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564667271820