BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF022I09

Length=470
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006360794.1|  PREDICTED: FRIGIDA-like protein 4a-like            184   3e-52   Solanum tuberosum [potatoes]
ref|XP_004247354.1|  PREDICTED: FRIGIDA-like protein 4a                 184   6e-52   Solanum lycopersicum
ref|XP_009784382.1|  PREDICTED: FRIGIDA-like protein 4a                 181   7e-51   Nicotiana sylvestris
ref|XP_009610915.1|  PREDICTED: FRIGIDA-like protein 4a                 179   4e-50   Nicotiana tomentosiformis
ref|XP_002282465.1|  PREDICTED: FRIGIDA-like protein 4a                 159   6e-43   Vitis vinifera
emb|CAN69766.1|  hypothetical protein VITISV_022061                     159   1e-42   Vitis vinifera
ref|XP_011071583.1|  PREDICTED: FRIGIDA-like protein 4a                 158   2e-42   Sesamum indicum [beniseed]
ref|XP_002517136.1|  Protein FRIGIDA, putative                          154   5e-41   Ricinus communis
ref|XP_009344103.1|  PREDICTED: FRIGIDA-like protein 4a                 145   8e-41   
ref|XP_010695287.1|  PREDICTED: FRIGIDA-like protein 4a                 153   1e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP40175.1|  hypothetical protein JCGZ_02173                         153   1e-40   Jatropha curcas
gb|AEK20760.1|  FRIGIDA                                                 152   2e-40   Coffea arabica [arabica coffee]
gb|AGV54404.1|  frigida protein                                         152   2e-40   Phaseolus vulgaris [French bean]
ref|XP_007143260.1|  hypothetical protein PHAVU_007G057500g             152   3e-40   Phaseolus vulgaris [French bean]
gb|AGV54236.1|  hydroxyproline-rich glycoprotein                        152   3e-40   Phaseolus vulgaris [French bean]
gb|EYU45654.1|  hypothetical protein MIMGU_mgv1a004401mg                151   6e-40   Erythranthe guttata [common monkey flower]
ref|XP_010090919.1|  hypothetical protein L484_004461                   150   9e-40   Morus notabilis
ref|XP_003556050.1|  PREDICTED: FRIGIDA-like protein 4a-like            150   2e-39   
ref|XP_010256039.1|  PREDICTED: FRIGIDA-like protein 4a                 149   4e-39   Nelumbo nucifera [Indian lotus]
ref|XP_004299118.1|  PREDICTED: FRIGIDA-like protein 4a                 148   7e-39   Fragaria vesca subsp. vesca
ref|XP_008390891.1|  PREDICTED: FRIGIDA-like protein 4a                 148   9e-39   Malus domestica [apple tree]
ref|XP_011026525.1|  PREDICTED: FRIGIDA-like protein 4a                 147   2e-38   Populus euphratica
ref|XP_008340987.1|  PREDICTED: FRIGIDA-like protein 4a                 147   2e-38   
gb|ACJ85672.1|  unknown                                                 144   3e-38   Medicago truncatula
gb|AFP97615.1|  frigida-like protein                                    146   3e-38   Medicago sativa [alfalfa]
ref|XP_010277260.1|  PREDICTED: FRIGIDA-like protein 4a                 146   3e-38   Nelumbo nucifera [Indian lotus]
gb|KEH43877.1|  frigida-LIKE protein                                    146   4e-38   Medicago truncatula
ref|XP_003536533.1|  PREDICTED: FRIGIDA-like protein 4a-like            146   5e-38   Glycine max [soybeans]
ref|XP_010024304.1|  PREDICTED: LOW QUALITY PROTEIN: FRIGIDA-like...    145   6e-38   Eucalyptus grandis [rose gum]
gb|KFK39537.1|  hypothetical protein AALP_AA3G257000                    145   7e-38   Arabis alpina [alpine rockcress]
ref|XP_002311627.2|  hydroxyproline-rich glycoprotein                   145   7e-38   Populus trichocarpa [western balsam poplar]
ref|XP_009369844.1|  PREDICTED: FRIGIDA-like protein 4a                 145   8e-38   Pyrus x bretschneideri [bai li]
ref|XP_007034761.1|  FRIGIDA-like protein isoform 2                     140   1e-36   
ref|XP_007225712.1|  hypothetical protein PRUPE_ppa004224mg             142   1e-36   Prunus persica
ref|XP_008447152.1|  PREDICTED: FRIGIDA-like protein 4a                 141   2e-36   
ref|XP_008224458.1|  PREDICTED: FRIGIDA-like protein 4a                 141   2e-36   Prunus mume [ume]
ref|XP_007034760.1|  FRIGIDA-like protein isoform 1                     141   2e-36   
ref|XP_010511354.1|  PREDICTED: FRIGIDA-like protein 4a                 140   3e-36   Camelina sativa [gold-of-pleasure]
gb|KGN44244.1|  hypothetical protein Csa_7G234160                       140   4e-36   Cucumis sativus [cucumbers]
ref|XP_004159038.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    140   4e-36   
ref|XP_010466529.1|  PREDICTED: FRIGIDA-like protein 4a                 140   4e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002883367.1|  hydroxyproline-rich glycoprotein family protein    140   5e-36   
ref|XP_010533277.1|  PREDICTED: FRIGIDA-like protein 4a                 139   1e-35   
ref|XP_006406163.1|  hypothetical protein EUTSA_v10020440mg             139   2e-35   
ref|NP_566709.1|  FRIGIDA-like protein                                  138   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006419935.1|  hypothetical protein CICLE_v100047532mg            133   1e-34   
gb|KJB38151.1|  hypothetical protein B456_006G239300                    136   1e-34   Gossypium raimondii
gb|KJB38150.1|  hypothetical protein B456_006G239300                    135   2e-34   Gossypium raimondii
gb|KDO74580.1|  hypothetical protein CISIN_1g010192mg                   133   2e-34   Citrus sinensis [apfelsine]
gb|KDO74579.1|  hypothetical protein CISIN_1g010192mg                   134   3e-34   Citrus sinensis [apfelsine]
ref|XP_006489388.1|  PREDICTED: FRIGIDA-like protein 4a-like            134   5e-34   Citrus sinensis [apfelsine]
gb|KDO74576.1|  hypothetical protein CISIN_1g010192mg                   134   5e-34   Citrus sinensis [apfelsine]
gb|KHG22505.1|  Protein FRIGIDA -like protein                           134   6e-34   Gossypium arboreum [tree cotton]
gb|KDO74578.1|  hypothetical protein CISIN_1g010192mg                   133   6e-34   Citrus sinensis [apfelsine]
ref|XP_010488272.1|  PREDICTED: FRIGIDA-like protein 4a                 134   6e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010551726.1|  PREDICTED: FRIGIDA-like protein 4a                 132   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_006299103.1|  hypothetical protein CARUB_v10015242mg             132   3e-33   Capsella rubella
emb|CDY46317.1|  BnaC01g31510D                                          130   1e-32   Brassica napus [oilseed rape]
gb|KHG27689.1|  Protein FRIGIDA -like protein                           130   2e-32   Gossypium arboreum [tree cotton]
ref|XP_010525189.1|  PREDICTED: FRIGIDA-like protein 4a                 130   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_006414627.1|  hypothetical protein EUTSA_v10024868mg             130   2e-32   Eutrema salsugineum [saltwater cress]
gb|KFK43732.1|  hypothetical protein AALP_AA1G165500                    128   9e-32   Arabis alpina [alpine rockcress]
gb|KJB28346.1|  hypothetical protein B456_005G042900                    128   8e-31   Gossypium raimondii
ref|NP_567447.1|  FRIGIDA-like protein                                  125   1e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CAB10269.1|  hydroxyproline-rich glycoprotein homolog               125   1e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CDY34252.1|  BnaA01g24690D                                          125   1e-30   Brassica napus [oilseed rape]
ref|XP_009108852.1|  PREDICTED: FRIGIDA-like protein 4a                 125   1e-30   Brassica rapa
ref|XP_006283490.1|  hypothetical protein CARUB_v10004542mg             124   2e-30   Capsella rubella
ref|XP_002868244.1|  hydroxyproline-rich glycoprotein family protein    124   3e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_010440374.1|  PREDICTED: FRIGIDA-like protein 4b                 115   7e-27   Camelina sativa [gold-of-pleasure]
gb|EPS62727.1|  hypothetical protein M569_12062                         114   1e-26   Genlisea aurea
ref|XP_010449973.1|  PREDICTED: FRIGIDA-like protein 4b                 114   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010435051.1|  PREDICTED: FRIGIDA-like protein 4b                 114   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010909467.1|  PREDICTED: FRIGIDA-like protein 4a                 106   1e-23   Elaeis guineensis
ref|XP_004139882.1|  PREDICTED: uncharacterized protein LOC101210012    104   3e-23   
ref|XP_010906476.1|  PREDICTED: FRIGIDA-like protein 4a                 103   9e-23   Elaeis guineensis
ref|XP_008778905.1|  PREDICTED: FRIGIDA-like protein 4a                 103   1e-22   Phoenix dactylifera
gb|AAL31182.1|  AT4g14900/dl3490c                                       103   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008796767.1|  PREDICTED: FRIGIDA-like protein 4a                 102   4e-22   Phoenix dactylifera
ref|XP_009408489.1|  PREDICTED: FRIGIDA-like protein 4a               97.4    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398870.1|  PREDICTED: FRIGIDA-like protein 4b               94.0    6e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010254145.1|  PREDICTED: FRIGIDA-like protein 4a               95.5    8e-20   Nelumbo nucifera [Indian lotus]
ref|XP_009389010.1|  PREDICTED: FRIGIDA-like protein 4a               89.4    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006826275.1|  hypothetical protein AMTR_s00004p00045050        89.4    1e-17   Amborella trichopoda
emb|CDY38318.1|  BnaC05g30110D                                        89.4    1e-17   Brassica napus [oilseed rape]
gb|KCW60755.1|  hypothetical protein EUGRSUZ_H03480                   84.3    5e-16   Eucalyptus grandis [rose gum]
gb|KCW60756.1|  hypothetical protein EUGRSUZ_H03480                   84.0    8e-16   Eucalyptus grandis [rose gum]
ref|XP_008786398.1|  PREDICTED: FRIGIDA-like protein 4a               81.6    5e-15   Phoenix dactylifera
ref|XP_006842236.1|  hypothetical protein AMTR_s00078p00186900        80.1    3e-14   Amborella trichopoda
ref|XP_002281155.2|  PREDICTED: FRIGIDA-like protein 4a isoform X2    77.8    1e-13   Vitis vinifera
ref|XP_010656337.1|  PREDICTED: FRIGIDA-like protein 4a isoform X1    77.8    1e-13   Vitis vinifera
emb|CAN61251.1|  hypothetical protein VITISV_004639                   77.0    3e-13   Vitis vinifera
ref|XP_010915058.1|  PREDICTED: FRIGIDA-like protein 4b isoform X2    75.1    1e-12   Elaeis guineensis
ref|XP_010915057.1|  PREDICTED: FRIGIDA-like protein 4b isoform X1    75.1    1e-12   Elaeis guineensis
ref|XP_003532490.1|  PREDICTED: FRIGIDA-like protein 4a-like          72.4    9e-12   Glycine max [soybeans]
tpg|DAA59720.1|  TPA: hypothetical protein ZEAMMB73_037297            71.6    9e-12   
ref|XP_004287092.1|  PREDICTED: FRIGIDA-like protein 4a isoform X1    71.6    2e-11   Fragaria vesca subsp. vesca
ref|XP_008652075.1|  PREDICTED: FRIGIDA-like protein 4a               72.0    2e-11   Zea mays [maize]
ref|XP_011458926.1|  PREDICTED: FRIGIDA-like protein 4a isoform X2    71.2    2e-11   Fragaria vesca subsp. vesca
ref|XP_010228309.1|  PREDICTED: FRIGIDA-like protein 4a               71.2    2e-11   Brachypodium distachyon [annual false brome]
ref|XP_007204566.1|  hypothetical protein PRUPE_ppa003799mg           70.9    3e-11   Prunus persica
gb|AFG65514.1|  hypothetical protein UMN_3842_02                      67.0    4e-11   Pinus taeda
ref|XP_002514326.1|  conserved hypothetical protein                   70.5    5e-11   Ricinus communis
ref|XP_008242610.1|  PREDICTED: FRIGIDA-like protein 4a               69.7    8e-11   Prunus mume [ume]
ref|XP_003525267.2|  PREDICTED: FRIGIDA-like protein 4a-like          68.9    1e-10   Glycine max [soybeans]
ref|XP_006650719.1|  PREDICTED: FRIGIDA-like protein 4a-like          68.9    1e-10   
ref|XP_004503419.1|  PREDICTED: uncharacterized protein LOC101489761  68.6    2e-10   Cicer arietinum [garbanzo]
ref|XP_004955594.1|  PREDICTED: protein FRIGIDA-like                  68.6    2e-10   Setaria italica
gb|KDP33654.1|  hypothetical protein JCGZ_07225                       67.4    4e-10   Jatropha curcas
dbj|BAK00009.1|  predicted protein                                    67.4    4e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009336927.1|  PREDICTED: FRIGIDA-like protein 4a               67.0    6e-10   Pyrus x bretschneideri [bai li]
gb|ABK25209.1|  unknown                                               67.0    6e-10   Picea sitchensis
gb|ABR17868.1|  unknown                                               67.0    6e-10   Picea sitchensis
tpg|DAA42568.1|  TPA: hypothetical protein ZEAMMB73_160821            66.2    1e-09   
ref|XP_002461525.1|  hypothetical protein SORBIDRAFT_02g004090        65.9    1e-09   
gb|EEC76321.1|  hypothetical protein OsI_13877                        65.5    2e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001051543.1|  Os03g0794900                                     65.5    2e-09   
ref|XP_010088834.1|  hypothetical protein L484_020817                 65.1    3e-09   Morus notabilis
ref|XP_008386583.1|  PREDICTED: FRIGIDA-like protein 4a               64.7    3e-09   
ref|XP_011043451.1|  PREDICTED: FRIGIDA-like protein 4a               62.0    3e-08   Populus euphratica
dbj|BAC83627.1|  putative hydroxyproline-rich glycoprotein            61.6    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009347163.1|  PREDICTED: FRIGIDA-like protein 4a               61.6    4e-08   Pyrus x bretschneideri [bai li]
ref|XP_006451127.1|  hypothetical protein CICLE_v10007961mg           60.8    6e-08   Citrus clementina [clementine]
dbj|BAC83628.1|  putative hydroxyproline-rich glycoprotein            60.5    6e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006371900.1|  hypothetical protein POPTR_0018s05910g           60.8    6e-08   Populus trichocarpa [western balsam poplar]
gb|KDO50860.1|  hypothetical protein CISIN_1g009377mg                 60.8    6e-08   Citrus sinensis [apfelsine]
ref|NP_001059003.1|  Os07g0173200                                     60.5    8e-08   
ref|XP_007160344.1|  hypothetical protein PHAVU_002G313900g           59.7    1e-07   Phaseolus vulgaris [French bean]
gb|AAP31312.2|  ABI3-interacting protein 2                            60.1    1e-07   Callitropsis nootkatensis [Nootka cypress]
ref|XP_011010336.1|  PREDICTED: FRIGIDA-like protein 3                59.7    2e-07   Populus euphratica
ref|XP_008337438.1|  PREDICTED: FRIGIDA-like protein 4a               58.9    3e-07   
gb|EEE60086.1|  hypothetical protein OsJ_12936                        58.5    4e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KHG13959.1|  Protein FRIGIDA -like protein                         58.2    4e-07   Gossypium arboreum [tree cotton]
gb|KJB06948.1|  hypothetical protein B456_001G004500                  57.4    8e-07   Gossypium raimondii
gb|AFK43654.1|  unknown                                               57.4    9e-07   Medicago truncatula
ref|XP_003629646.1|  Protein FRIGIDA                                  57.4    9e-07   Medicago truncatula
ref|XP_011024727.1|  PREDICTED: FRIGIDA-like protein 3                57.4    1e-06   Populus euphratica
ref|XP_002320559.2|  hypothetical protein POPTR_0014s17360g           57.0    1e-06   
gb|ABK94872.1|  unknown                                               57.0    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_002303026.1|  hypothetical protein POPTR_0002s24090g           57.0    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_006375597.1|  hypothetical protein POPTR_0014s17360g           56.2    2e-06   
gb|KJB08745.1|  hypothetical protein B456_001G101100                  55.8    3e-06   Gossypium raimondii
gb|KJB08746.1|  hypothetical protein B456_001G101100                  55.8    3e-06   Gossypium raimondii
gb|KHG21752.1|  Protein FRIGIDA -like protein                         55.5    3e-06   Gossypium arboreum [tree cotton]
gb|KJB08748.1|  hypothetical protein B456_001G101100                  55.1    4e-06   Gossypium raimondii
gb|KJB08747.1|  hypothetical protein B456_001G101100                  54.7    5e-06   Gossypium raimondii
gb|KHN30845.1|  Protein FRIGIDA                                       54.7    7e-06   Glycine soja [wild soybean]
ref|XP_003521013.1|  PREDICTED: FRIGIDA-like protein 3-like           54.7    7e-06   Glycine max [soybeans]
gb|KDP45205.1|  hypothetical protein JCGZ_15070                       54.3    9e-06   Jatropha curcas
gb|AFK33866.1|  unknown                                               52.8    1e-05   Lotus japonicus
ref|XP_002527289.1|  conserved hypothetical protein                   53.9    1e-05   Ricinus communis
gb|KHN41627.1|  hypothetical protein glysoja_036371                   50.1    1e-05   Glycine soja [wild soybean]
gb|KJB10825.1|  hypothetical protein B456_001G227000                  53.5    1e-05   Gossypium raimondii
gb|KJB10822.1|  hypothetical protein B456_001G227000                  53.5    1e-05   Gossypium raimondii
ref|XP_004956399.1|  PREDICTED: protein FRIGIDA-like                  53.5    2e-05   Setaria italica
gb|KHG07809.1|  Protein FRIGIDA -like protein                         53.1    2e-05   Gossypium arboreum [tree cotton]
ref|NP_001151902.1|  ABI3-interacting protein 2                       52.8    3e-05   Zea mays [maize]
ref|XP_007134303.1|  hypothetical protein PHAVU_010G035900g           52.8    3e-05   Phaseolus vulgaris [French bean]
ref|XP_006447936.1|  hypothetical protein CICLE_v10014710mg           52.4    3e-05   Citrus clementina [clementine]
ref|XP_010037083.1|  PREDICTED: FRIGIDA-like protein 3                52.4    4e-05   Eucalyptus grandis [rose gum]
ref|XP_004510190.1|  PREDICTED: protein FRIGIDA-like                  52.4    4e-05   Cicer arietinum [garbanzo]
ref|XP_006447935.1|  hypothetical protein CICLE_v10014710mg           52.4    4e-05   Citrus clementina [clementine]
ref|XP_010277793.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     52.0    5e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010277794.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     52.0    5e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010688181.1|  PREDICTED: FRIGIDA-like protein 4a               52.0    6e-05   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW48710.1|  hypothetical protein EUGRSUZ_K02358                   51.2    8e-05   Eucalyptus grandis [rose gum]
ref|XP_003521014.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  51.2    8e-05   Glycine max [soybeans]
ref|XP_004510189.1|  PREDICTED: protein FRIGIDA-like                  51.2    8e-05   Cicer arietinum [garbanzo]
ref|XP_007049532.1|  FRIGIDA-like protein isoform 1                   51.2    1e-04   
ref|XP_007013214.1|  FRIGIDA-like protein                             50.8    1e-04   
ref|XP_003634846.1|  PREDICTED: FRIGIDA-like protein 3                50.8    1e-04   Vitis vinifera
ref|XP_009151640.1|  PREDICTED: FRIGIDA-like protein 3                50.4    1e-04   Brassica rapa
ref|XP_006599130.1|  PREDICTED: FRIGIDA-like protein 3-like           50.4    2e-04   Glycine max [soybeans]
gb|KHN30846.1|  Protein FRIGIDA                                       50.1    2e-04   Glycine soja [wild soybean]
ref|XP_006858746.1|  hypothetical protein AMTR_s00066p00134410        50.1    2e-04   Amborella trichopoda
gb|AGV54168.1|  protein FRIGIDA-like protein                          50.1    2e-04   Phaseolus vulgaris [French bean]
gb|KDO43511.1|  hypothetical protein CISIN_1g008061mg                 50.1    2e-04   Citrus sinensis [apfelsine]
gb|AIG88464.1|  FRIGIDA-like protein                                  49.7    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006395188.1|  hypothetical protein EUTSA_v10003930mg           50.1    2e-04   
gb|KDO43512.1|  hypothetical protein CISIN_1g008061mg                 50.1    2e-04   Citrus sinensis [apfelsine]
ref|XP_006426019.1|  hypothetical protein CICLE_v10025275mg           49.7    3e-04   Citrus clementina [clementine]
ref|XP_010095585.1|  hypothetical protein L484_007424                 49.3    3e-04   Morus notabilis
ref|XP_006280261.1|  hypothetical protein CARUB_v10026179mg           49.3    3e-04   
gb|AIN75614.1|  FRIGIDA3b-1                                           49.3    4e-04   Dimocarpus longan [longan]
gb|KDO43521.1|  hypothetical protein CISIN_1g008061mg                 49.3    4e-04   Citrus sinensis [apfelsine]
emb|CDX86307.1|  BnaA06g30240D                                        49.3    4e-04   
ref|XP_010493658.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     49.3    4e-04   
gb|AGV54643.1|  frigida protein                                       49.3    4e-04   Phaseolus vulgaris [French bean]
ref|XP_010442259.1|  PREDICTED: FRIGIDA-like protein 3                49.3    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010482089.1|  PREDICTED: FRIGIDA-like protein 3 isoform X2     48.9    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010482087.1|  PREDICTED: FRIGIDA-like protein 3 isoform X1     48.9    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_007134304.1|  hypothetical protein PHAVU_010G036000g           48.9    5e-04   Phaseolus vulgaris [French bean]
ref|XP_009385695.1|  PREDICTED: FRIGIDA-like protein 3                48.9    5e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001062667.1|  Os09g0248200                                     48.9    5e-04   
dbj|BAD19898.1|  putative ABI3-interacting protein 2                  48.9    5e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84154.1|  hypothetical protein OsI_30525                        48.9    5e-04   Oryza sativa Indica Group [Indian rice]
gb|KDO43513.1|  hypothetical protein CISIN_1g008061mg                 48.9    5e-04   Citrus sinensis [apfelsine]
gb|KDO43515.1|  hypothetical protein CISIN_1g008061mg                 48.5    6e-04   Citrus sinensis [apfelsine]
gb|AGV54832.1|  frigida-like protein                                  48.9    6e-04   Phaseolus vulgaris [French bean]
gb|KDO43514.1|  hypothetical protein CISIN_1g008061mg                 48.5    6e-04   Citrus sinensis [apfelsine]
gb|KDO43517.1|  hypothetical protein CISIN_1g008061mg                 48.5    6e-04   Citrus sinensis [apfelsine]
ref|XP_010551997.1|  PREDICTED: FRIGIDA-like protein 3                48.5    7e-04   Tarenaya hassleriana [spider flower]
ref|XP_010679002.1|  PREDICTED: FRIGIDA-like protein 3                48.5    8e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006366815.1|  PREDICTED: FRIGIDA-like protein 3-like isofo...  48.1    8e-04   Solanum tuberosum [potatoes]
ref|XP_010251408.1|  PREDICTED: FRIGIDA-like protein 3                48.1    9e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010547174.1|  PREDICTED: FRIGIDA-like protein 3                48.1    0.001   Tarenaya hassleriana [spider flower]
emb|CDX85335.1|  BnaC07g26460D                                        48.1    0.001   
ref|XP_002457174.1|  hypothetical protein SORBIDRAFT_03g002730        48.1    0.001   Sorghum bicolor [broomcorn]



>ref|XP_006360794.1| PREDICTED: FRIGIDA-like protein 4a-like [Solanum tuberosum]
Length=514

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 113/135 (84%), Gaps = 4/135 (3%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ADPGE+   S  P     SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQD+L+KSE
Sbjct  1    MGSLADPGELD--SVEPPQQQPSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDILKKSE  58

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            ALKAK+QTLD++TK SLEVLE+RETS+  S+SI L+KV E+K+AA++ F    G E+PEV
Sbjct  59   ALKAKIQTLDSETKASLEVLEQRETSMNVSLSIALQKVVENKKAAILAFDE--GVEQPEV  116

Query  424  DNSAGLLLKLRSFCV  468
            D+S GLLLKL+SFCV
Sbjct  117  DDSTGLLLKLKSFCV  131



>ref|XP_004247354.1| PREDICTED: FRIGIDA-like protein 4a [Solanum lycopersicum]
Length=514

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 4/135 (3%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ADPGE+   S  P P   SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQD+L+KSE
Sbjct  1    MGSLADPGELD--SVEPPPQQPSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDILKKSE  58

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            ALKAK+QTLD++TK SLEVLE+RETS+  S+SI L+KV E+KRAA++      G E+PEV
Sbjct  59   ALKAKIQTLDSETKASLEVLEQRETSMNVSLSIALQKVVENKRAAILALDE--GVEQPEV  116

Query  424  DNSAGLLLKLRSFCV  468
            D+S GLLLKL+SFCV
Sbjct  117  DDSTGLLLKLKSFCV  131



>ref|XP_009784382.1| PREDICTED: FRIGIDA-like protein 4a [Nicotiana sylvestris]
Length=516

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 112/135 (83%), Gaps = 7/135 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ADPGE+   +        SFD+FQRQTSLMTSCTLLWKELSDHFTSLEQD+L+KSE
Sbjct  1    MGSLADPGELDSVAPS-----PSFDDFQRQTSLMTSCTLLWKELSDHFTSLEQDILKKSE  55

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            ALKAK+QTLD++TK SL+VLEKRE S+  S+SI+L+KV E+K+AA++  G   G+E+PEV
Sbjct  56   ALKAKIQTLDSETKASLDVLEKRENSMNVSLSISLQKVLENKQAAILALGE--GAEQPEV  113

Query  424  DNSAGLLLKLRSFCV  468
            D+S GL LKL+SFCV
Sbjct  114  DDSTGLYLKLKSFCV  128



>ref|XP_009610915.1| PREDICTED: FRIGIDA-like protein 4a [Nicotiana tomentosiformis]
Length=516

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 112/135 (83%), Gaps = 7/135 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ADPGE+   + P      SFD+FQRQTSLMTSCTLLWKELSDHFTSLEQD+++KSE
Sbjct  1    MGSLADPGELDSVAPP-----PSFDDFQRQTSLMTSCTLLWKELSDHFTSLEQDIIKKSE  55

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            ALKAK+QTLD++TK SLEVLEKRE S+  S+SI+L+KV E+K+AA++      G+E+PEV
Sbjct  56   ALKAKIQTLDSETKASLEVLEKRENSMNVSLSISLQKVLENKQAAILALNE--GAEQPEV  113

Query  424  DNSAGLLLKLRSFCV  468
            D+S GL LKL+SFCV
Sbjct  114  DDSTGLYLKLKSFCV  128



>ref|XP_002282465.1| PREDICTED: FRIGIDA-like protein 4a [Vitis vinifera]
Length=522

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 102/135 (76%), Gaps = 7/135 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPG+++           SFD+FQ+QTSLMTSCTLLWKELSDHFTSLEQ+L +KSE
Sbjct  1    MGSIPDPGDIS-----GELNQPSFDDFQKQTSLMTSCTLLWKELSDHFTSLEQNLQKKSE  55

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            ALK K QTLD  TK+SL VL+KRE +I  S+ I L KV+ES+ AAL+      G+++ EV
Sbjct  56   ALKNKFQTLDHHTKESLGVLKKREVTIDGSVEIALGKVEESREAALIAL--LKGAQDGEV  113

Query  424  DNSAGLLLKLRSFCV  468
            D+S GLLLKL+SFC+
Sbjct  114  DDSEGLLLKLKSFCL  128



>emb|CAN69766.1| hypothetical protein VITISV_022061 [Vitis vinifera]
Length=524

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 102/135 (76%), Gaps = 7/135 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPG+++           SFD+FQ+QTSLMTSCTLLWKELSDHFTSLEQ+L +KSE
Sbjct  1    MGSIPDPGDIS-----GELNXPSFDDFQKQTSLMTSCTLLWKELSDHFTSLEQNLQKKSE  55

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            ALK K QTLD  TK+SL VL+KRE +I  S+ I L KV+ES+ AAL+      G+++ EV
Sbjct  56   ALKNKFQTLDHHTKESLGVLKKREVTIDGSVEIALGKVEESREAALIAL--LKGAQDGEV  113

Query  424  DNSAGLLLKLRSFCV  468
            D+S GLLLKL+SFC+
Sbjct  114  DDSEGLLLKLKSFCL  128



>ref|XP_011071583.1| PREDICTED: FRIGIDA-like protein 4a [Sesamum indicum]
Length=520

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 106/136 (78%), Gaps = 6/136 (4%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ DPGE+T    PP     SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQDL++KS+
Sbjct  1    MGSLPDPGELTHPPPPP----PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQDLIKKSD  56

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRA--ALVEFGNAGGSEEP  417
            ALKAK Q L+ +T+QSL+ L+ RE+SI+ S+SI L+ ++++ +   +L   G    +EEP
Sbjct  57   ALKAKFQALNNETQQSLQALDTRESSISKSMSIVLESLEKTTKMSISLAAPGAESQTEEP  116

Query  418  EVDNSAGLLLKLRSFC  465
            EVD+S GLL+KL+SFC
Sbjct  117  EVDDSEGLLMKLKSFC  132



>ref|XP_002517136.1| Protein FRIGIDA, putative [Ricinus communis]
 gb|EEF45299.1| Protein FRIGIDA, putative [Ricinus communis]
Length=520

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 99/138 (72%), Gaps = 9/138 (7%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KSE
Sbjct  1    MGSIPDPGELTELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEE-P-  417
            ALK K+QTLDTQTK SL  L KRE +I  S+ I L+++DE K AAL    N    ++ P 
Sbjct  55   ALKQKIQTLDTQTKASLANLRKREVTIDGSVEIALERLDEHKEAALKSLENPDSCDDHPD  114

Query  418  -EVDNSAGLLLKLRSFCV  468
             EVDN  GLL  L+S C+
Sbjct  115  GEVDNGEGLLQILKSLCL  132



>ref|XP_009344103.1| PREDICTED: FRIGIDA-like protein 4a, partial [Pyrus x bretschneideri]
Length=138

 Score =   145 bits (365),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 98/136 (72%), Gaps = 7/136 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGEVT+ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQ+LL+KSE
Sbjct  1    MGSIPDPGEVTELTP------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQNLLKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEE-PE  420
            A+K K+Q L+ +TK SL+ LE+RE SI     + L KV++SK AAL     A   +E  E
Sbjct  55   AIKLKIQNLEHETKASLDELEQREVSIRDIFEVALGKVEKSKEAALKVLKRARSDDEYGE  114

Query  421  VDNSAGLLLKLRSFCV  468
            VD+  GLL+ L+S C+
Sbjct  115  VDDGEGLLMNLKSLCL  130



>ref|XP_010695287.1| PREDICTED: FRIGIDA-like protein 4a [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   153 bits (387),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 83/139 (60%), Positives = 102/139 (73%), Gaps = 10/139 (7%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE TQ ++       SF+EFQ+QTSLMTSCTLLWKELSDHF +LE+D+ RKSE
Sbjct  1    MGSIPDPGESTQLNS------PSFEEFQKQTSLMTSCTLLWKELSDHFNTLEEDIRRKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL----VEFGNAGGSE  411
            ALK K+QTLD QTKQSLEVL+KRE +I  S+ I + + +ESK+ AL    VE        
Sbjct  55   ALKRKIQTLDHQTKQSLEVLKKREVTIEGSVEIAIGRAEESKKVALSLGVVEERENVRVG  114

Query  412  EPEVDNSAGLLLKLRSFCV  468
            E EVD+  GLL+KL+SFC+
Sbjct  115  EGEVDDGEGLLMKLKSFCI  133



>gb|KDP40175.1| hypothetical protein JCGZ_02173 [Jatropha curcas]
Length=520

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 97/136 (71%), Gaps = 7/136 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQ+L +KSE
Sbjct  1    MGSIPDPGELTELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQNLQKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAG-GSEEPE  420
            ALK K QTLD QTK SL  L+KRE +I  S+ I LK+V++ + AAL    N      + E
Sbjct  55   ALKNKFQTLDHQTKTSLASLKKREVTIDGSVEIALKRVEQHREAALKSLDNPNFDHPDGE  114

Query  421  VDNSAGLLLKLRSFCV  468
            VDN  GLL  L+SFC+
Sbjct  115  VDNGDGLLQLLKSFCL  130



>gb|AEK20760.1| FRIGIDA [Coffea arabica]
Length=532

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 107/141 (76%), Gaps = 6/141 (4%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSIADPGE+TQ   PP  PP SFD+FQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KS 
Sbjct  1    MGSIADPGELTQTQPPPPQPPPSFDDFQRQTSLMTSCTLLWKELSDHFTSLEQNLEKKSA  60

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGG------  405
            ALKAKL+TLD QT  SL+ L +RE++++  +S+ L+KV++SK  A++      G      
Sbjct  61   ALKAKLKTLDFQTNTSLDELNRRESTLSTVLSMALEKVEKSKAGAILSVAQQNGVSNGAE  120

Query  406  SEEPEVDNSAGLLLKLRSFCV  468
            S E EVD+S G+ LKL++FC+
Sbjct  121  SGEGEVDDSLGVFLKLKTFCI  141



>gb|AGV54404.1| frigida protein [Phaseolus vulgaris]
Length=525

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 102/139 (73%), Gaps = 13/139 (9%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLE+DL  KSE
Sbjct  1    MGSIPDPGELSELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEEDLKHKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF----GNAGGSE  411
            ALK K++TLDT T  SL +L++RETS+ A++ I L+ +D  + AAL  F     + GG  
Sbjct  55   ALKGKMRTLDTATSDSLRLLDRRETSLDATLQIALRTLDTRRTAALSSFLDDHADDGGG-  113

Query  412  EPEVDNSAGLLLKLRSFCV  468
              EVD++ GL+LKL+SFC+
Sbjct  114  --EVDDATGLVLKLKSFCL  130



>ref|XP_007143260.1| hypothetical protein PHAVU_007G057500g [Phaseolus vulgaris]
 gb|ESW15254.1| hypothetical protein PHAVU_007G057500g [Phaseolus vulgaris]
Length=525

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 102/139 (73%), Gaps = 13/139 (9%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLE+DL  KSE
Sbjct  1    MGSIPDPGELSELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEEDLKHKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF----GNAGGSE  411
            ALK K++TLDT T  SL +L++RETS+ A++ I L+ +D  + AAL  F     + GG  
Sbjct  55   ALKGKMRTLDTATSDSLRLLDRRETSLDATLQIALRTLDTRRTAALSSFLDDHADDGGG-  113

Query  412  EPEVDNSAGLLLKLRSFCV  468
              EVD++ GL+LKL+SFC+
Sbjct  114  --EVDDATGLVLKLKSFCL  130



>gb|AGV54236.1| hydroxyproline-rich glycoprotein [Phaseolus vulgaris]
Length=523

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 102/139 (73%), Gaps = 13/139 (9%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLE+DL  KSE
Sbjct  1    MGSIPDPGELSELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEEDLKHKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF----GNAGGSE  411
            ALK K++TLDT T  SL +L++RETS+ A++ I L+ +D  + AAL  F     + GG  
Sbjct  55   ALKGKMRTLDTATSDSLRLLDRRETSLDATLQIALRTLDTRRTAALSSFLDDHADDGGG-  113

Query  412  EPEVDNSAGLLLKLRSFCV  468
              EVD++ GL+LKL+SFC+
Sbjct  114  --EVDDATGLVLKLKSFCL  130



>gb|EYU45654.1| hypothetical protein MIMGU_mgv1a004401mg [Erythranthe guttata]
Length=529

 Score =   151 bits (382),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 104/140 (74%), Gaps = 11/140 (8%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ DPGE+T    PP     SFD+FQRQTSLMTSCTLLWKELSDHF+SLEQD+++KS+
Sbjct  1    MGSLPDPGELTHPPPPP----PSFDDFQRQTSLMTSCTLLWKELSDHFSSLEQDIIKKSD  56

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGS-----  408
             LKAKLQ L+ +T+QSL+ LE RE+SI+ S++I    ++++ + + V F     +     
Sbjct  57   DLKAKLQALNNETQQSLQALETRESSISKSMAIVFDNLEKTAKMS-VSFSVPSAAADDAQ  115

Query  409  -EEPEVDNSAGLLLKLRSFC  465
             EEPEVD++ GLL+KLRSFC
Sbjct  116  IEEPEVDDTEGLLMKLRSFC  135



>ref|XP_010090919.1| hypothetical protein L484_004461 [Morus notabilis]
 gb|EXB41291.1| hypothetical protein L484_004461 [Morus notabilis]
Length=519

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 91/125 (73%), Gaps = 6/125 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLL+KSE
Sbjct  1    MGSIPDPGELTELTP------PSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            A+K K+QTLD +TK+SL  LEKRE +I  S+ I L KV+ SK  AL+      G E  EV
Sbjct  55   AMKRKIQTLDNETKESLHELEKRENTIEGSVKIALGKVEVSKEVALMAMERIFGDENGEV  114

Query  424  DNSAG  438
            D+  G
Sbjct  115  DDGEG  119



>ref|XP_003556050.1| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=524

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 98/137 (72%), Gaps = 8/137 (6%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQDL  KSE
Sbjct  1    MGSIPDPGELSELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQDLNHKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEP--  417
            ALK K+ TLD  T  SL +L+ RETS+ A++ I L+ +D  + AAL    +      P  
Sbjct  55   ALKRKIHTLDNSTSDSLRLLDHRETSLDATLQIALRTLDTRRTAALSALLHDADDTSPDG  114

Query  418  EVDNSAGLLLKLRSFCV  468
            EVD++AGL+LKL+SFC+
Sbjct  115  EVDDTAGLVLKLKSFCL  131



>ref|XP_010256039.1| PREDICTED: FRIGIDA-like protein 4a [Nelumbo nucifera]
Length=522

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 98/134 (73%), Gaps = 11/134 (8%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS A PGE+ Q         TSF++FQ+QTSLMTSCTLLWKELSDHF+SLEQDLL+KSE
Sbjct  1    MGSAALPGEMLQ---------TSFEDFQQQTSLMTSCTLLWKELSDHFSSLEQDLLKKSE  51

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            ALK K++ LD +TK++L+VLEKRE SI  ++   L KV+E K AAL+     GG EE   
Sbjct  52   ALKEKIKNLDNKTKETLDVLEKREVSIDGTVEQALAKVEERKEAALIAM-QKGGKEE-FG  109

Query  424  DNSAGLLLKLRSFC  465
            D   G+LLKLRSFC
Sbjct  110  DGEDGVLLKLRSFC  123



>ref|XP_004299118.1| PREDICTED: FRIGIDA-like protein 4a [Fragaria vesca subsp. vesca]
Length=584

 Score =   148 bits (374),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 83/136 (61%), Positives = 106/136 (78%), Gaps = 4/136 (3%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +APP     SFDEFQRQTSLMTSCTLLWKELSDHF SLEQ+LL+KSE
Sbjct  1    MGSIPDPGELTELTAPPP---ASFDEFQRQTSLMTSCTLLWKELSDHFLSLEQNLLQKSE  57

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEE-PE  420
            A+K K+Q L+ +TK+SL+ LE+RE +I  S+ I L KV+E+K+AAL     A   +E  E
Sbjct  58   AIKRKIQALEHETKESLDELEQREITINLSVEIALVKVEETKKAALKVLKRARSDDEYGE  117

Query  421  VDNSAGLLLKLRSFCV  468
            VDNS GLL++++S C+
Sbjct  118  VDNSEGLLMEMKSLCL  133



>ref|XP_008390891.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=522

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 100/136 (74%), Gaps = 7/136 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+++        SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQ+LL+KSE
Sbjct  1    MGSIPDPGELTESTP------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQNLLKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEE-PE  420
            A+K K+QTL+ +TK SL+ LE+RE SI     + L KV++SK AAL     A   +E  E
Sbjct  55   AIKLKIQTLEHETKASLDELEQREVSIRDIFEVALGKVEKSKEAALKVLKRARSDDEYGE  114

Query  421  VDNSAGLLLKLRSFCV  468
            VD+  GLL+ L+S C+
Sbjct  115  VDDGEGLLMNLKSLCL  130



>ref|XP_011026525.1| PREDICTED: FRIGIDA-like protein 4a [Populus euphratica]
Length=521

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 98/140 (70%), Gaps = 15/140 (11%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KSE
Sbjct  1    MGSIPDPGELTELTR------PSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL-----VEFGNAGGS  408
            ALK K+QTLDTQTK SL  L+KRE +I  S+ I L++V+E +  AL      ++ N  G 
Sbjct  55   ALKHKIQTLDTQTKASLASLKKREVTIDGSVEIALERVEERRELALKSLSDPDYENPDG-  113

Query  409  EEPEVDNSAGLLLKLRSFCV  468
               EVD+  G  + L+S C+
Sbjct  114  ---EVDDGDGSFMVLKSLCL  130



>ref|XP_008340987.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=521

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 98/136 (72%), Gaps = 7/136 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQ+LL+KSE
Sbjct  1    MGSIPDPGELTELTP------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQNLLKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEE-PE  420
            A+K K+QTL+  TK SL+ LE+RE +I  S  I L KV++SK AAL         +E  E
Sbjct  55   AIKLKIQTLEQXTKASLDELEQREVTIRDSFEIALGKVEKSKEAALKVLKRGRSDDEYGE  114

Query  421  VDNSAGLLLKLRSFCV  468
            VD+  GLL+ L+S C+
Sbjct  115  VDDGEGLLMNLKSLCL  130



>gb|ACJ85672.1| unknown [Medicago truncatula]
Length=353

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 95/138 (69%), Gaps = 9/138 (7%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFD+FQRQTSLMTSCTLLWKELSDHF+SLEQDLL KSE
Sbjct  1    MGSIPDPGELTELTQ------PSFDDFQRQTSLMTSCTLLWKELSDHFSSLEQDLLNKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEP--  417
            AL  K+++LD QT +SL +L  RE+++  ++ I L+ +D    AAL          E   
Sbjct  55   ALNRKIRSLDNQTNESLNLLRHRESTLDDALQIALRDIDNRTEAALAALSRVREDVEDGD  114

Query  418  -EVDNSAGLLLKLRSFCV  468
             EVDN  GL+LKL+SFC+
Sbjct  115  GEVDNGEGLMLKLKSFCL  132



>gb|AFP97615.1| frigida-like protein [Medicago sativa]
Length=519

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 98/144 (68%), Gaps = 21/144 (15%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFD+FQRQTSLMTSCTLLWKELSDHF+SLEQDLL KSE
Sbjct  1    MGSIPDPGELTELTQ------PSFDDFQRQTSLMTSCTLLWKELSDHFSSLEQDLLNKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL---------VEFGN  396
            AL  K+++LD QT +SL +L  RE+++  ++ I L+ +D    AAL         VE G+
Sbjct  55   ALNRKIRSLDNQTNESLNLLRHRESTLDDALQIALRDIDNRTEAALAALSRVREDVEDGD  114

Query  397  AGGSEEPEVDNSAGLLLKLRSFCV  468
                   EVDN  GL+LKL+SFC+
Sbjct  115  G------EVDNGEGLMLKLKSFCL  132



>ref|XP_010277260.1| PREDICTED: FRIGIDA-like protein 4a [Nelumbo nucifera]
Length=534

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 97/134 (72%), Gaps = 11/134 (8%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI  PGE+ Q         TSF++FQRQ +LMTSCTLLWKELSDHF+SLEQDL +KSE
Sbjct  1    MGSIPLPGEMLQ---------TSFEDFQRQATLMTSCTLLWKELSDHFSSLEQDLQKKSE  51

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            AL+ K QTLD +TK++L+ LEKRE SI  S+   L KV+E K AAL+     GG EE + 
Sbjct  52   ALREKFQTLDDRTKETLDGLEKREVSIEGSVEQALVKVEERKEAALIAL-QKGGKEEFD-  109

Query  424  DNSAGLLLKLRSFC  465
            D+  G+LLKLRSFC
Sbjct  110  DSDEGVLLKLRSFC  123



>gb|KEH43877.1| frigida-LIKE protein [Medicago truncatula]
Length=519

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 98/144 (68%), Gaps = 21/144 (15%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFD+FQRQTSLMTSCTLLWKELSDHF+SLEQDLL KSE
Sbjct  1    MGSIPDPGELTELTQ------PSFDDFQRQTSLMTSCTLLWKELSDHFSSLEQDLLNKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL---------VEFGN  396
            AL  K+++LD QT +SL +L  RE+++  ++ I L+ +D    AAL         VE G+
Sbjct  55   ALNRKIRSLDNQTNESLNLLRHRESTLDDALQIALRDIDNRTEAALAALSRVREDVEDGD  114

Query  397  AGGSEEPEVDNSAGLLLKLRSFCV  468
                   EVDN  GL+LKL+SFC+
Sbjct  115  G------EVDNGEGLMLKLKSFCL  132



>ref|XP_003536533.1| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=530

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 99/140 (71%), Gaps = 11/140 (8%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQDL  KSE
Sbjct  1    MGSIPDPGELSELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQDLNHKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGN-----AGGS  408
            ALK K++TLD  T  SL +L++RETS+ A++ I L+ +D  + AAL             S
Sbjct  55   ALKRKIRTLDNTTSDSLRLLDRRETSLDATLQIALRTLDTRRTAALSALLTDADDIINSS  114

Query  409  EEPEVDNSAGLLLKLRSFCV  468
             + EVD++ GL+LKL+SFC+
Sbjct  115  PDGEVDDTTGLILKLKSFCL  134



>ref|XP_010024304.1| PREDICTED: LOW QUALITY PROTEIN: FRIGIDA-like protein 4a [Eucalyptus 
grandis]
Length=530

 Score =   145 bits (367),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 81/141 (57%), Positives = 104/141 (74%), Gaps = 8/141 (6%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DP    + +    PP  SF++FQ+QTSLMTSCTLLWKELS HF+SLEQ+L++KSE
Sbjct  1    MGSIPDPS--GEPACQLQPPAASFEDFQKQTSLMTSCTLLWKELSXHFSSLEQNLMKKSE  58

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSE-EP-  417
            ALK KL+ LD QTK++L VL++RET+I  S+ I L+KV++SK AAL      GG + EP 
Sbjct  59   ALKQKLRALDDQTKKTLTVLDERETTIDGSVEIVLEKVEKSKEAALGALERGGGRDVEPG  118

Query  418  ----EVDNSAGLLLKLRSFCV  468
                EVD+  GLL+KLRSFC+
Sbjct  119  SPGGEVDDGEGLLMKLRSFCL  139



>gb|KFK39537.1| hypothetical protein AALP_AA3G257000 [Arabis alpina]
Length=529

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 97/137 (71%), Gaps = 8/137 (6%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ DPGE+T+ +        SF+EFQRQ+SLMTSCTLLW ELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELAQ------PSFEEFQRQSSLMTSCTLLWNELSDHFTSLEQNLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGGSEEP  417
            ALK  ++TLD QT+ SLE L++RE +I  S+ I   KV E  RAAL  +E    GG +  
Sbjct  55   ALKQMIETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDGGDDSG  114

Query  418  EVDNSAGLLLKLRSFCV  468
            EVD+  GLL  L+S C+
Sbjct  115  EVDDDEGLLTALKSLCL  131



>ref|XP_002311627.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE88994.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=521

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 97/140 (69%), Gaps = 15/140 (11%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KSE
Sbjct  1    MGSIPDPGELTELTR------PSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL-----VEFGNAGGS  408
            ALK K+QTLD QTK SL  L+KRE +I  S+ I L++V+E +  AL      ++ N  G 
Sbjct  55   ALKHKIQTLDNQTKASLASLKKREVTIDGSVEIALERVEEHRELALKSLSDPDYENPDG-  113

Query  409  EEPEVDNSAGLLLKLRSFCV  468
               EVD+  G  + L+S C+
Sbjct  114  ---EVDDGDGSFMVLKSLCL  130



>ref|XP_009369844.1| PREDICTED: FRIGIDA-like protein 4a [Pyrus x bretschneideri]
Length=521

 Score =   145 bits (366),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 99/136 (73%), Gaps = 7/136 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHF+SLEQ+LL+KSE
Sbjct  1    MGSIPDPGELTELTP------PSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQNLLKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEE-PE  420
            A+K K+QTL+ +TK SL+ LE+RE +I  S  I L KV+++K +AL         +E  E
Sbjct  55   AIKLKIQTLEQETKASLDELEQREVTIRDSFEIALGKVEKTKESALKVLKRGRSDDEYGE  114

Query  421  VDNSAGLLLKLRSFCV  468
            VD+  GLL+ L+S C+
Sbjct  115  VDDGEGLLMNLKSLCL  130



>ref|XP_007034761.1| FRIGIDA-like protein isoform 2 [Theobroma cacao]
 gb|EOY05687.1| FRIGIDA-like protein isoform 2 [Theobroma cacao]
Length=375

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 97/136 (71%), Gaps = 7/136 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDH  SLEQ+L+R+SE
Sbjct  1    MGSIPDPGELTELTH------PSFDEFQRQTSLMTSCTLLWKELSDHINSLEQNLMRQSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFG-NAGGSEEPE  420
            ALK K++TLD++TK SL+ L+KRE SI  S+ I L +V+   +AAL     +   + + E
Sbjct  55   ALKRKIETLDSETKASLDSLKKREHSIEGSVKIALDRVEFHTKAALKTLSDDVEDNPDGE  114

Query  421  VDNSAGLLLKLRSFCV  468
            VDN  GLL  L+S C+
Sbjct  115  VDNGDGLLQLLKSTCL  130



>ref|XP_007225712.1| hypothetical protein PRUPE_ppa004224mg [Prunus persica]
 gb|EMJ26911.1| hypothetical protein PRUPE_ppa004224mg [Prunus persica]
Length=522

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 9/137 (7%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+LL+KSE
Sbjct  1    MGSIPDPGELTELTP------PSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLLKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGGSEEP  417
            A+K K+Q L+ +TK+SL+ LE+RE +I  S+ I + KV++SK AAL  ++ G +   +  
Sbjct  55   AIKRKIQNLEQETKESLDELEQREVTIMESVEIAVGKVEKSKEAALKVLKRGRSDDDDGE  114

Query  418  EVDNSAGLLLKLRSFCV  468
              DN  GLL+ L+S C+
Sbjct  115  VDDNE-GLLMNLKSLCL  130



>ref|XP_008447152.1| PREDICTED: FRIGIDA-like protein 4a [Cucumis melo]
Length=517

 Score =   141 bits (356),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 85/135 (63%), Positives = 103/135 (76%), Gaps = 7/135 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MG+I+DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFT+LEQDLL+KSE
Sbjct  1    MGTISDPGELSELTH------PSFDEFQRQTSLMTSCTLLWKELSDHFTNLEQDLLKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            AL+ K+QTLD QTK+SL+ LEKRE SI  S+ I L KV++S  AAL       G E  EV
Sbjct  55   ALRHKIQTLDHQTKESLDELEKREVSIQGSVQIALGKVEKSMEAALKAL-EKDGDENGEV  113

Query  424  DNSAGLLLKLRSFCV  468
            D+  GLLLKL+SFC+
Sbjct  114  DDDDGLLLKLKSFCL  128



>ref|XP_008224458.1| PREDICTED: FRIGIDA-like protein 4a [Prunus mume]
Length=497

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 9/137 (7%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+LL+KSE
Sbjct  1    MGSIPDPGELTELTP------PSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLLKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGGSEEP  417
            A+K K+Q L+ +TK+SL+ LE+RE +I  S+ I + KV++SK AAL  ++ G +   +  
Sbjct  55   AIKRKIQNLEQETKESLDELEQREVTIMESVEIAVGKVEKSKEAALKVLKRGRSDDDDGE  114

Query  418  EVDNSAGLLLKLRSFCV  468
              DN  GLL+ L+S C+
Sbjct  115  VDDNE-GLLMNLKSLCL  130



>ref|XP_007034760.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
 gb|EOY05686.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
Length=520

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 97/136 (71%), Gaps = 7/136 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDH  SLEQ+L+R+SE
Sbjct  1    MGSIPDPGELTELTH------PSFDEFQRQTSLMTSCTLLWKELSDHINSLEQNLMRQSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFG-NAGGSEEPE  420
            ALK K++TLD++TK SL+ L+KRE SI  S+ I L +V+   +AAL     +   + + E
Sbjct  55   ALKRKIETLDSETKASLDSLKKREHSIEGSVKIALDRVEFHTKAALKTLSDDVEDNPDGE  114

Query  421  VDNSAGLLLKLRSFCV  468
            VDN  GLL  L+S C+
Sbjct  115  VDNGDGLLQLLKSTCL  130



>ref|XP_010511354.1| PREDICTED: FRIGIDA-like protein 4a [Camelina sativa]
Length=530

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 96/140 (69%), Gaps = 11/140 (8%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ DPGE+T+ +        SF+EFQ+QTSLMTSCTLLW+ELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF-----GNAGGS  408
            ALK  ++TLD QT+ SLE L++RE +I  S+ I   KV E  RAAL        G+    
Sbjct  55   ALKQMIETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDGDGAND  114

Query  409  EEPEVDNSAGLLLKLRSFCV  468
            +  EVD+  GLL  L+S C+
Sbjct  115  DSGEVDDEEGLLSALKSLCL  134



>gb|KGN44244.1| hypothetical protein Csa_7G234160 [Cucumis sativus]
Length=518

 Score =   140 bits (354),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 85/135 (63%), Positives = 102/135 (76%), Gaps = 7/135 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MG+I DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFT+LEQDLL+KSE
Sbjct  1    MGTIPDPGELSELTH------PSFDEFQRQTSLMTSCTLLWKELSDHFTNLEQDLLKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            AL+ K+QTLD QTK+SL+ LEKRE SI  S+ I L KV++S  AAL       G E  EV
Sbjct  55   ALRHKIQTLDHQTKESLDELEKREVSIQGSVQIALGKVEKSMEAALKAL-EKDGDENGEV  113

Query  424  DNSAGLLLKLRSFCV  468
            D+  GLLLKL+SFC+
Sbjct  114  DDDDGLLLKLKSFCL  128



>ref|XP_004159038.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101210012 
[Cucumis sativus]
Length=518

 Score =   140 bits (353),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 85/135 (63%), Positives = 102/135 (76%), Gaps = 7/135 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MG+I DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFT+LEQDLL+KSE
Sbjct  1    MGTIPDPGELSELTH------PSFDEFQRQTSLMTSCTLLWKELSDHFTNLEQDLLKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            AL+ K+QTLD QTK+SL+ LEKRE SI  S+ I L KV++S  AAL       G E  EV
Sbjct  55   ALRHKIQTLDHQTKESLDELEKREVSIQGSVQIALGKVEKSMEAALKAL-EKDGDENGEV  113

Query  424  DNSAGLLLKLRSFCV  468
            D+  GLLLKL+SFC+
Sbjct  114  DDDDGLLLKLKSFCL  128



>ref|XP_010466529.1| PREDICTED: FRIGIDA-like protein 4a [Camelina sativa]
Length=533

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 98/142 (69%), Gaps = 13/142 (9%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ DPGE+T+ +        SF+EFQ+QTSLMTSCTLLW+ELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGGSE--  411
            ALK  ++TLD QT+ SLE L++RE +I  S+ I   KV E  RAAL  +E    GG E  
Sbjct  55   ALKQMIETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDGGGEGA  114

Query  412  ---EPEVDNSAGLLLKLRSFCV  468
                 EVD+  GLL  L+S C+
Sbjct  115  NDDSGEVDDEEGLLSALKSLCL  136



>ref|XP_002883367.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59626.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=531

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 96/141 (68%), Gaps = 12/141 (9%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ DPGE+T+ +        SF+EFQ+QTSLMTSCTLLW+ELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF------GNAGG  405
            ALK  ++TLD QT+ SLE L++RE +I  S+ I   KV E  RAAL         G+   
Sbjct  55   ALKQMIETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDGGDGSN  114

Query  406  SEEPEVDNSAGLLLKLRSFCV  468
             +  EVD+  GLL  L+S C+
Sbjct  115  DDSGEVDDEEGLLSALKSLCL  135



>ref|XP_010533277.1| PREDICTED: FRIGIDA-like protein 4a [Tarenaya hassleriana]
Length=539

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 99/140 (71%), Gaps = 11/140 (8%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +         FDEFQRQTSLMTSCTL WKELSDHFTSLEQ+L++KSE
Sbjct  1    MGSIPDPGELTELAE------PGFDEFQRQTSLMTSCTLRWKELSDHFTSLEQNLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF-----GNAGGS  408
            ALK  ++TLD QT+ SLE L+ RE +I  S+ I L KV+ES +AALV       G +G  
Sbjct  55   ALKQMIETLDNQTQASLESLKHREVTIDDSVEIALGKVEESAKAALVSLEKAGGGGSGAE  114

Query  409  EEPEVDNSAGLLLKLRSFCV  468
            +  EV++  GLL  L+SFC+
Sbjct  115  DGGEVEDGDGLLSLLKSFCL  134



>ref|XP_006406163.1| hypothetical protein EUTSA_v10020440mg [Eutrema salsugineum]
 gb|ESQ47616.1| hypothetical protein EUTSA_v10020440mg [Eutrema salsugineum]
Length=552

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 97/141 (69%), Gaps = 12/141 (9%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ DPGE+T+ +        SF+EFQRQTSLMTSCTLLWKELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELTQ------PSFEEFQRQTSLMTSCTLLWKELSDHFTSLEQNLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGGSE--  411
            ALK  ++TLD QT+ SLE L++RE +I  S+ I   KV E  RAAL  +E     GS   
Sbjct  55   ALKQMIETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDCGSNVD  114

Query  412  --EPEVDNSAGLLLKLRSFCV  468
                EVD+  GLL  L+S C+
Sbjct  115  DSSGEVDDDEGLLSALKSLCL  135



>ref|NP_566709.1| FRIGIDA-like protein [Arabidopsis thaliana]
 sp|Q9LUV4.1|FRL4A_ARATH RecName: Full=FRIGIDA-like protein 4a [Arabidopsis thaliana]
 dbj|BAB01784.1| hydroxyproline-rich glycoprotein [Arabidopsis thaliana]
 gb|AAK92705.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20275.1| putative hydroxyproline-rich glycoprotein [Arabidopsis thaliana]
 gb|AAM61695.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 gb|AEE76640.1| FRIGIDA-like protein [Arabidopsis thaliana]
Length=532

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 96/142 (68%), Gaps = 13/142 (9%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ DPGE+T+ +        SF+EFQ+QTSLMTSCTLLW+ELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF-------GNAG  402
            ALK  ++TLD QT+ SLE L++RE +I  S+ I   KV E  RAAL          G+  
Sbjct  55   ALKQMIETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDGCGDGS  114

Query  403  GSEEPEVDNSAGLLLKLRSFCV  468
              +  +VD+  GLL  L+S C+
Sbjct  115  NDDSGDVDDEEGLLSALKSLCL  136



>ref|XP_006419935.1| hypothetical protein CICLE_v100047532mg, partial [Citrus clementina]
 gb|ESR33175.1| hypothetical protein CICLE_v100047532mg, partial [Citrus clementina]
Length=297

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 6/135 (4%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KS 
Sbjct  1    MGSIPDPGELSELNPL------SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSA  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            AL+ K+QTLDTQTK SL+VL+KRE +I  S+ I ++K+++   A L          + EV
Sbjct  55   ALRHKIQTLDTQTKASLDVLKKREVTIDGSVEIAMEKLEDRTEATLNSISRGQELGDGEV  114

Query  424  DNSAGLLLKLRSFCV  468
            D+  GLL+ L S+C+
Sbjct  115  DDGDGLLMILMSYCL  129



>gb|KJB38151.1| hypothetical protein B456_006G239300 [Gossypium raimondii]
Length=520

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 97/136 (71%), Gaps = 7/136 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDH  SLEQ+L+++SE
Sbjct  1    MGSIPDPGELTELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHINSLEQNLMKQSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFG-NAGGSEEPE  420
             LK K++ LD++TK SL+ L+KRE SI  S+ I L +V+ + +AA+   G +   + + E
Sbjct  55   TLKRKIEALDSETKASLDSLKKRELSIEDSVKIALSRVEFNTKAAMRTLGDDVEDNPDGE  114

Query  421  VDNSAGLLLKLRSFCV  468
            VD+  GLL  L+S C+
Sbjct  115  VDDGDGLLQHLKSTCL  130



>gb|KJB38150.1| hypothetical protein B456_006G239300 [Gossypium raimondii]
Length=391

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 97/136 (71%), Gaps = 7/136 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDH  SLEQ+L+++SE
Sbjct  1    MGSIPDPGELTELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHINSLEQNLMKQSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFG-NAGGSEEPE  420
             LK K++ LD++TK SL+ L+KRE SI  S+ I L +V+ + +AA+   G +   + + E
Sbjct  55   TLKRKIEALDSETKASLDSLKKRELSIEDSVKIALSRVEFNTKAAMRTLGDDVEDNPDGE  114

Query  421  VDNSAGLLLKLRSFCV  468
            VD+  GLL  L+S C+
Sbjct  115  VDDGDGLLQHLKSTCL  130



>gb|KDO74580.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=312

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 6/135 (4%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KS 
Sbjct  1    MGSIPDPGELSELNPL------SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSA  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            AL+ K+QTLDTQTK SL+VL+KRE +I  S+ I ++K+++   A L          + EV
Sbjct  55   ALRHKIQTLDTQTKASLDVLKKREVTIDGSVEIAMEKLEDRTEATLNSISRGQELGDGEV  114

Query  424  DNSAGLLLKLRSFCV  468
            D+  GLL+ L S+C+
Sbjct  115  DDGDGLLMILMSYCL  129



>gb|KDO74579.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=364

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 6/135 (4%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KS 
Sbjct  1    MGSIPDPGELSELNPL------SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSA  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            AL+ K+QTLDTQTK SL+VL+KRE +I  S+ I ++K+++   A L          + EV
Sbjct  55   ALRHKIQTLDTQTKASLDVLKKREVTIDGSVEIAMEKLEDRTEATLNSISRGQELGDGEV  114

Query  424  DNSAGLLLKLRSFCV  468
            D+  GLL+ L S+C+
Sbjct  115  DDGDGLLMILMSYCL  129



>ref|XP_006489388.1| PREDICTED: FRIGIDA-like protein 4a-like [Citrus sinensis]
 gb|KDO74577.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=515

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 6/135 (4%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KS 
Sbjct  1    MGSIPDPGELSELNPL------SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSA  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            AL+ K+QTLDTQTK SL+VL+KRE +I  S+ I ++K+++   A L          + EV
Sbjct  55   ALRHKIQTLDTQTKASLDVLKKREVTIDGSVEIAMEKLEDRTEATLNSISRGQELGDGEV  114

Query  424  DNSAGLLLKLRSFCV  468
            D+  GLL+ L S+C+
Sbjct  115  DDGDGLLMILMSYCL  129



>gb|KDO74576.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=511

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 6/135 (4%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KS 
Sbjct  1    MGSIPDPGELSELNP------LSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSA  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            AL+ K+QTLDTQTK SL+VL+KRE +I  S+ I ++K+++   A L          + EV
Sbjct  55   ALRHKIQTLDTQTKASLDVLKKREVTIDGSVEIAMEKLEDRTEATLNSISRGQELGDGEV  114

Query  424  DNSAGLLLKLRSFCV  468
            D+  GLL+ L S+C+
Sbjct  115  DDGDGLLMILMSYCL  129



>gb|KHG22505.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=520

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 97/136 (71%), Gaps = 7/136 (5%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SF+EFQRQTSLMTSCTLLWKELSDH  SLEQ+L+++SE
Sbjct  1    MGSIPDPGELTELTQ------PSFEEFQRQTSLMTSCTLLWKELSDHINSLEQNLMKQSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFG-NAGGSEEPE  420
             LK K++ LD++TK SL+ L+KRE SI  S+ I L +V+ + +AA+   G +   + + E
Sbjct  55   TLKRKIEALDSETKASLDSLKKRELSIEDSVKIALSRVEFNTKAAMRTLGDDVEDNPDGE  114

Query  421  VDNSAGLLLKLRSFCV  468
            VD+  GLL  L+S C+
Sbjct  115  VDDGDGLLQHLKSTCL  130



>gb|KDO74578.1| hypothetical protein CISIN_1g010192mg [Citrus sinensis]
Length=412

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 6/135 (4%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+++ +        SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQ+L +KS 
Sbjct  1    MGSIPDPGELSELNPL------SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQNLQKKSA  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            AL+ K+QTLDTQTK SL+VL+KRE +I  S+ I ++K+++   A L          + EV
Sbjct  55   ALRHKIQTLDTQTKASLDVLKKREVTIDGSVEIAMEKLEDRTEATLNSISRGQELGDGEV  114

Query  424  DNSAGLLLKLRSFCV  468
            D+  GLL+ L S+C+
Sbjct  115  DDGDGLLMILMSYCL  129



>ref|XP_010488272.1| PREDICTED: FRIGIDA-like protein 4a [Camelina sativa]
Length=539

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 95/142 (67%), Gaps = 13/142 (9%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ DPGE+T+ +        SF+EFQ+QTSLMTSCTLLW+ELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNA-------G  402
            ALK  ++TLD QT+ SLE L++RE +I  S+ I   KV E  RAAL     A        
Sbjct  55   ALKQMIETLDNQTQTSLESLKRREVTIDHSVEIVAGKVGERARAALESLEKARDGGGDGA  114

Query  403  GSEEPEVDNSAGLLLKLRSFCV  468
              +  EVD+  GLL  L++ C+
Sbjct  115  NDDSGEVDDEEGLLSALKALCL  136



>ref|XP_010551726.1| PREDICTED: FRIGIDA-like protein 4a [Tarenaya hassleriana]
Length=525

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 84/107 (79%), Gaps = 6/107 (6%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTL+WKELSDHFTSLEQ+L+++S+
Sbjct  1    MGSIIDPGELTELTP------PSFDEFQRQTSLMTSCTLMWKELSDHFTSLEQNLMKRSD  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALV  384
            ALK  ++TLD QT+ SLE L++RE +I  S+ I + KV E+ +AALV
Sbjct  55   ALKQMIETLDNQTQASLESLKRREVTIDDSVEIAMGKVKENAKAALV  101



>ref|XP_006299103.1| hypothetical protein CARUB_v10015242mg [Capsella rubella]
 gb|EOA32001.1| hypothetical protein CARUB_v10015242mg [Capsella rubella]
Length=533

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 94/143 (66%), Gaps = 14/143 (10%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ DPGE+T+ +        SF+EFQ+QTSLMTSCTLLW+ELSDHFTSLEQ+L++KSE
Sbjct  1    MGSVPDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNA--------  399
            ALK  +++LD QT+ SLE L +RE +I  S+ I   KV E  RAAL     A        
Sbjct  55   ALKQMIESLDNQTQTSLESLNRREVTIDHSVEIVAGKVGERARAALESLEKARDGGGGDG  114

Query  400  GGSEEPEVDNSAGLLLKLRSFCV  468
               +  EVD+  GLL  L++ C+
Sbjct  115  SNDDSGEVDDEEGLLSALKALCL  137



>emb|CDY46317.1| BnaC01g31510D [Brassica napus]
Length=525

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 93/135 (69%), Gaps = 10/135 (7%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS++DPGE+T+ +        SF+EFQ+QTSLMTSCTLLWKELSDHFT+LE++L++KSE
Sbjct  1    MGSVSDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWKELSDHFTTLEENLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            ALK  +  LD+QT+ SLE L++RE +I  S+ I  +   ES   A     N GG    EV
Sbjct  55   ALKEMIGALDSQTQSSLESLKRREATIERSVEIRARAALESLEKARDGGDNGGG----EV  110

Query  424  DNSAGLLLKLRSFCV  468
            D+  GLL  L+S C+
Sbjct  111  DDEEGLLSALKSLCL  125



>gb|KHG27689.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=516

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 93/137 (68%), Gaps = 12/137 (9%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQ QTSLMT CTL+WKELSDH +SLE +L+R+SE
Sbjct  1    MGSIPDPGELTELTH------PSFDEFQHQTSLMTGCTLMWKELSDHISSLEANLIRQSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFG--NAGGSEEP  417
            ALK K++ LD++TK SL+ L+KRE SI  S+ I + +V+  K+ AL      N  G    
Sbjct  55   ALKRKIEALDSETKTSLDSLKKRELSIDDSVKIAVNRVELLKKDALKTLNDDNPDG----  110

Query  418  EVDNSAGLLLKLRSFCV  468
            EVDN  GLL  L+S C+
Sbjct  111  EVDNGDGLLQILKSTCL  127



>ref|XP_010525189.1| PREDICTED: FRIGIDA-like protein 4a [Tarenaya hassleriana]
Length=548

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 82/107 (77%), Gaps = 6/107 (6%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGSI DPGE+T+ +        SFDEFQRQTSLMTSCTLLWKELSDHFT LEQ+L++KSE
Sbjct  1    MGSIPDPGELTELTQ------PSFDEFQRQTSLMTSCTLLWKELSDHFTLLEQNLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALV  384
            ALK  ++TLD QT+ SLE L+ RE +I  S+ I + K +ES ++AL+
Sbjct  55   ALKQMIETLDNQTQASLESLKHREVTIEDSVKIAMGKAEESAKSALM  101



>ref|XP_006414627.1| hypothetical protein EUTSA_v10024868mg [Eutrema salsugineum]
 gb|ESQ56080.1| hypothetical protein EUTSA_v10024868mg [Eutrema salsugineum]
Length=539

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 84/117 (72%), Gaps = 8/117 (7%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS  DPGE+ +++        SFDEFQRQTSLMTSC LLWKELS+HFTSLEQ+LL+KSE
Sbjct  1    MGSPHDPGELIESAQ------PSFDEFQRQTSLMTSCNLLWKELSEHFTSLEQNLLKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGGS  408
            ALK  ++TLD QTK S+E+L  RE +I  S+ I   KV+E  RAAL  +E    GGS
Sbjct  55   ALKQMIETLDNQTKTSIELLNHREVTIDKSVEIAAGKVEERVRAALESLEKARDGGS  111



>gb|KFK43732.1| hypothetical protein AALP_AA1G165500 [Arabis alpina]
Length=531

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 93/135 (69%), Gaps = 6/135 (4%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            M S  DPGE+T+ +        S+DEFQ+QTSLMTSC+LLW+ELSDHF S+E++L++KSE
Sbjct  1    MESSLDPGELTELTQ------PSYDEFQKQTSLMTSCSLLWQELSDHFISMEKNLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            ALK  ++TLDTQT+ S+E+L++RE +I  S+ I   KV+E  RAAL     A   E  EV
Sbjct  55   ALKQMIETLDTQTQTSIELLKRREVTIDHSVEIAAAKVEERARAALESLEKARDDETGEV  114

Query  424  DNSAGLLLKLRSFCV  468
            D+   LL  L+  C+
Sbjct  115  DDGDELLNSLKLLCM  129



>gb|KJB28346.1| hypothetical protein B456_005G042900 [Gossypium raimondii]
Length=830

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 94/135 (70%), Gaps = 8/135 (6%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS+ +PGE+T+ +        SFDEFQ QTSLMT CTL+WKELSDH +SLE +L+R+SE
Sbjct  1    MGSVPNPGELTELTQ------PSFDEFQHQTSLMTGCTLMWKELSDHISSLEANLMRQSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            ALK K++ LD++TK SL+ L+KRE SI  S+ I + +V+  K+ AL    +   + + EV
Sbjct  55   ALKRKIEALDSETKTSLDSLKKRELSIDDSVKIAVNRVELLKKDALKTLND--DNPDGEV  112

Query  424  DNSAGLLLKLRSFCV  468
            DN  GLL  L+S C+
Sbjct  113  DNGDGLLQILKSTCL  127



>ref|NP_567447.1| FRIGIDA-like protein [Arabidopsis thaliana]
 sp|Q940H8.1|FRL4B_ARATH RecName: Full=FRIGIDA-like protein 4b [Arabidopsis thaliana]
 gb|AAK96809.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
 gb|AAM10105.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
 gb|AAM63474.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 gb|AEE83517.1| FRIGIDA-like protein [Arabidopsis thaliana]
Length=532

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 92/138 (67%), Gaps = 9/138 (7%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            M S  DPGE+ ++S        SF EFQ+Q SLMTSC LLWKELS+HFTS+EQ+L++KSE
Sbjct  1    MESSPDPGELIKSSQ------PSFFEFQKQASLMTSCNLLWKELSEHFTSMEQNLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNA---GGSEE  414
            AL+  ++TLD QT+ S+E+L+ RE +I  S+ I   KV+E  RAAL     A   G  + 
Sbjct  55   ALRQMIETLDNQTQSSIELLKHREVTIDHSVEIAEGKVEERVRAALDSLEKARDCGDEDT  114

Query  415  PEVDNSAGLLLKLRSFCV  468
             EVD+  GLL  L+S C+
Sbjct  115  GEVDDGDGLLSALKSLCL  132



>emb|CAB10269.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
 emb|CAB78532.1| hydroxyproline-rich glycoprotein homolog [Arabidopsis thaliana]
Length=507

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 92/138 (67%), Gaps = 9/138 (7%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            M S  DPGE+ ++S        SF EFQ+Q SLMTSC LLWKELS+HFTS+EQ+L++KSE
Sbjct  1    MESSPDPGELIKSSQ------PSFFEFQKQASLMTSCNLLWKELSEHFTSMEQNLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNA---GGSEE  414
            AL+  ++TLD QT+ S+E+L+ RE +I  S+ I   KV+E  RAAL     A   G  + 
Sbjct  55   ALRQMIETLDNQTQSSIELLKHREVTIDHSVEIAEGKVEERVRAALDSLEKARDCGDEDT  114

Query  415  PEVDNSAGLLLKLRSFCV  468
             EVD+  GLL  L+S C+
Sbjct  115  GEVDDGDGLLSALKSLCL  132



>emb|CDY34252.1| BnaA01g24690D [Brassica napus]
Length=522

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 6/106 (6%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS++DPGE+T+ +        SF+EFQ+QTSLMTSCTLLWKELSDHFT+LE++L++KSE
Sbjct  1    MGSVSDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWKELSDHFTTLEENLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL  381
            ALK  +  LD+QT+ SLE L++RE +I  S+ I   KV E  RAAL
Sbjct  55   ALKEMIGALDSQTQSSLESLKRREATIERSVEIVAGKVGERARAAL  100



>ref|XP_009108852.1| PREDICTED: FRIGIDA-like protein 4a [Brassica rapa]
Length=534

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 6/106 (6%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            MGS++DPGE+T+ +        SF+EFQ+QTSLMTSCTLLWKELSDHFT+LE++L++KSE
Sbjct  1    MGSVSDPGELTELAQ------PSFEEFQKQTSLMTSCTLLWKELSDHFTTLEENLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL  381
            ALK  +  LD+QT+ SLE L++RE +I  S+ I   KV E  RAAL
Sbjct  55   ALKEMIGALDSQTQSSLESLKRREATIERSVEIVAGKVGERARAAL  100



>ref|XP_006283490.1| hypothetical protein CARUB_v10004542mg [Capsella rubella]
 gb|EOA16388.1| hypothetical protein CARUB_v10004542mg [Capsella rubella]
Length=540

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 92/144 (64%), Gaps = 15/144 (10%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            M S  DPGE+ ++         SF EFQ+Q SLM+SC LLWKELS+HFTS+EQ L++KSE
Sbjct  1    MESSPDPGELVESPQ------PSFFEFQKQASLMSSCNLLWKELSEHFTSMEQSLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEF------GNAGG  405
            ALK  ++TLD QT+ S+E+L+ RE +I  S+ I   KVDE  RAAL         G+  G
Sbjct  55   ALKQMIETLDNQTQTSIELLKHREVTIDRSVEIAAGKVDERARAALESLEKARDGGSTAG  114

Query  406  SEEP---EVDNSAGLLLKLRSFCV  468
             E+    EVD+  GLL  L+S C+
Sbjct  115  DEDDGAGEVDDGDGLLSALKSLCL  138



>ref|XP_002868244.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44503.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=532

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 92/138 (67%), Gaps = 9/138 (7%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            M S  DPGE+ +++        SF EFQ+QTSLMTSC LLWKELS+HFTS+EQ+L++KSE
Sbjct  1    MESSPDPGELIESAQ------PSFVEFQKQTSLMTSCNLLWKELSEHFTSMEQNLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGSEEP--  417
            ALK  ++TLD QT+ S+E+L+ RE +I  S+ I   KV+E  RA L     A  ++E   
Sbjct  55   ALKQMIETLDNQTQNSIELLKHREVTIDHSVEIAAGKVEERARAVLDSLEKARAADEDDT  114

Query  418  -EVDNSAGLLLKLRSFCV  468
             EVD+  G+L  L+  C+
Sbjct  115  GEVDDGDGILSALKLLCL  132



>ref|XP_010440374.1| PREDICTED: FRIGIDA-like protein 4b [Camelina sativa]
Length=549

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 81/116 (70%), Gaps = 8/116 (7%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            M +  DPGE+ +++        SF EFQ+Q SLMTSC LLWKELS+HFTS+EQ L++KSE
Sbjct  1    MEASPDPGELVESAQ------PSFFEFQKQASLMTSCNLLWKELSEHFTSMEQSLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGG  405
            ALK  ++TLDTQT+ S+E+L+ RE +I  S+ I   KV+E  RAAL  +E    GG
Sbjct  55   ALKQMIETLDTQTQTSIELLKHREVTIDHSVEIAAGKVEERARAALESLEKARDGG  110



>gb|EPS62727.1| hypothetical protein M569_12062, partial [Genlisea aurea]
Length=454

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 86/112 (77%), Gaps = 6/112 (5%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            SF++FQRQTSLMTSCTLLWKELSDHF SLEQDL+RKS+ALK +LQ L+  T +SL+ L+ 
Sbjct  1    SFEDFQRQTSLMTSCTLLWKELSDHFYSLEQDLIRKSDALKVRLQDLNDHTSRSLKALDS  60

Query  310  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            RE+SI+ SIS  L+K++E+ + +L         E P+VD+S G+L+ L+ FC
Sbjct  61   RESSISRSISAALQKLEENAKMSL------DVCENPQVDDSEGVLMILKGFC  106



>ref|XP_010449973.1| PREDICTED: FRIGIDA-like protein 4b [Camelina sativa]
Length=544

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 8/125 (6%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            M S  DPGE+ +++        SF EFQ+Q SLMTSC LLWKELS+HFTS+EQ L++KSE
Sbjct  1    MESSPDPGELVESAQ------PSFFEFQKQASLMTSCNLLWKELSEHFTSMEQSLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGGSEEP  417
            ALK  ++TLD QT+ S+E+L+ RE +I  S+ I   KV+E  RAAL  +E    GG    
Sbjct  55   ALKQMIETLDNQTQTSIELLKHREVTIDHSVEIASGKVEERARAALESLEKARDGGDTAT  114

Query  418  EVDNS  432
              DN+
Sbjct  115  ANDNN  119



>ref|XP_010435051.1| PREDICTED: FRIGIDA-like protein 4b [Camelina sativa]
Length=548

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 8/116 (7%)
 Frame = +1

Query  64   MGSIADPGEVTQASappapppTSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSE  243
            M S  DPGE+ ++         SF EFQ+Q SLMTSC LLWKELS+HFTS+EQ L++KSE
Sbjct  1    MESSPDPGELVESDQ------PSFFEFQKQASLMTSCNLLWKELSEHFTSMEQSLMKKSE  54

Query  244  ALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAAL--VEFGNAGG  405
            ALK  ++TLD QT+ S+E+L+ RE +I  S+ I   KV+E  RAAL  +E    GG
Sbjct  55   ALKQMIETLDNQTQTSIELLKHREVTIDHSVEIAAGKVEERARAALESLEKARDGG  110



>ref|XP_010909467.1| PREDICTED: FRIGIDA-like protein 4a [Elaeis guineensis]
Length=534

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            SF+E +RQ  L+TSCTLLWKELSDHF+SLE+DL  KSE+L++K Q+LD  T++SL  L  
Sbjct  16   SFEELERQRELITSCTLLWKELSDHFSSLERDLQLKSESLRSKRQSLDLSTQRSLASLHH  75

Query  310  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            RE SI  ++ + L KV+E + AAL+   +       + +N   L  KLRSFC
Sbjct  76   RELSIDGAVDLALAKVNERRDAALLALSSPASPL--DSNNGNDLPGKLRSFC  125



>ref|XP_004139882.1| PREDICTED: uncharacterized protein LOC101210012 [Cucumis sativus]
Length=510

 Score =   104 bits (260),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 64/102 (63%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = +1

Query  163  MTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISI  342
            + +CTLLWKELSDHFT+LEQDLL+KSEAL+ K+QTLD QTK+SL+ LEKRE SI  S+ I
Sbjct  20   IIACTLLWKELSDHFTNLEQDLLKKSEALRHKIQTLDHQTKESLDELEKREVSIQGSVQI  79

Query  343  TLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCV  468
             L KV++S  AAL       G E  EVD+  GLLLKL+SFC+
Sbjct  80   ALGKVEKSMEAALKAL-EKDGDENGEVDDDDGLLLKLKSFCL  120



>ref|XP_010906476.1| PREDICTED: FRIGIDA-like protein 4a [Elaeis guineensis]
Length=541

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 77/115 (67%), Gaps = 7/115 (6%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            SFDE +RQ  L+TSCTLLWKELSDHF+S+E+DL   SE+L++K Q+LD  T++SL  L +
Sbjct  16   SFDELERQRELITSCTLLWKELSDHFSSVERDLQLWSESLRSKRQSLDLSTQRSLASLHR  75

Query  310  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNS---AGLLLKLRSFC  465
            RE SI +++ + L KV E + AAL+   +        VDN+     L  KLRSFC
Sbjct  76   RELSIDSAVDLALAKVGERRDAALLALSSPASP----VDNNNDTNDLPGKLRSFC  126



>ref|XP_008778905.1| PREDICTED: FRIGIDA-like protein 4a [Phoenix dactylifera]
Length=535

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 75/112 (67%), Gaps = 2/112 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            SF+E +RQ  L+TSCTLLWKELSDHF+SLE+DL  KSE+L++K Q+LD  T++SL  L  
Sbjct  16   SFEELERQRELITSCTLLWKELSDHFSSLERDLQLKSESLRSKRQSLDLSTQRSLASLHH  75

Query  310  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            RE SI  ++++ L KVDE + A L+           + +N   L  KLRSFC
Sbjct  76   RELSIDGAVALALAKVDERRDATLLALSFP--VSPLDSNNDHDLPGKLRSFC  125



>gb|AAL31182.1| AT4g14900/dl3490c [Arabidopsis thaliana]
Length=505

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 73/105 (70%), Gaps = 3/105 (3%)
 Frame = +1

Query  163  MTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISI  342
            MTSC LLWKELS+HFTS+EQ+L++KSEAL+  ++TLD QT+ S+E+L+ RE +I  S+ I
Sbjct  1    MTSCNLLWKELSEHFTSMEQNLMKKSEALRQMIETLDNQTQSSIELLKHREVTIDHSVEI  60

Query  343  TLKKVDESKRAALVEFGNA---GGSEEPEVDNSAGLLLKLRSFCV  468
               KV+E  RAAL     A   G  +  EVD+  GLL  L+S C+
Sbjct  61   AEGKVEERVRAALDSLEKARDCGDEDTGEVDDGDGLLSALKSLCL  105



>ref|XP_008796767.1| PREDICTED: FRIGIDA-like protein 4a [Phoenix dactylifera]
Length=538

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 76/115 (66%), Gaps = 7/115 (6%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            SF+E +RQ  L+TSCTLLWKELSDHF+S+E+DL  +SE+L++K Q+LD  T+ SL  L +
Sbjct  16   SFEELERQRELITSCTLLWKELSDHFSSMERDLQLRSESLRSKRQSLDLSTQSSLASLHR  75

Query  310  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNS---AGLLLKLRSFC  465
            RE SI  ++ + L KV+E   AAL+   +        VDN+     L  KLRSFC
Sbjct  76   RELSIDGAVDLALAKVEERCDAALLALSSPASP----VDNNNDTNDLPGKLRSFC  126



>ref|XP_009408489.1| PREDICTED: FRIGIDA-like protein 4a [Musa acuminata subsp. malaccensis]
Length=529

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 77/112 (69%), Gaps = 5/112 (4%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            SF E ++Q  L+T CTLLWKELSDHF++LE+ +  KSEAL++K ++LD  T+++L+ L +
Sbjct  17   SFAELEKQRELITCCTLLWKELSDHFSTLERGIEIKSEALRSKRESLDGSTRRTLDSLRR  76

Query  310  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            RE SI  ++ + L K+DE +R A V+   A  +E  E+D    L  KLRSFC
Sbjct  77   RELSIDGAVDLALAKLDE-RRTAAVQALAASSAEANELD----LAGKLRSFC  123



>ref|XP_009398870.1| PREDICTED: FRIGIDA-like protein 4b [Musa acuminata subsp. malaccensis]
Length=307

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            SF E ++Q  L+TSCTLLWKELSDHF+ L+Q L  KSEAL++K Q+LD  T  +L+ L +
Sbjct  17   SFAELEKQRELITSCTLLWKELSDHFSILQQGLEIKSEALRSKRQSLDASTGHALDSLRR  76

Query  310  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            RE SI +++ + + K+DE +RAA VE  +A  +   ++D    L  KLRS C
Sbjct  77   RELSIDSAVELAIAKLDE-RRAAAVEALSATAAGGDDLD----LAEKLRSLC  123



>ref|XP_010254145.1| PREDICTED: FRIGIDA-like protein 4a [Nelumbo nucifera]
Length=539

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 74/111 (67%), Gaps = 7/111 (6%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F+  + + +L+T+CT +WK+LS HF+SLE+ LL+KS+AL +K++ LD++TK++LE LE+R
Sbjct  25   FEALETRKTLLTNCTEIWKKLSSHFSSLEESLLQKSKALDSKIEALDSETKKTLEALEQR  84

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E SI    S  + +V E K AAL EF   G S       + GL   LRS+C
Sbjct  85   EKSIPERESAAIARVQEQKEAALAEFEKTGTS-------NLGLAEALRSYC  128



>ref|XP_009389010.1| PREDICTED: FRIGIDA-like protein 4a [Musa acuminata subsp. malaccensis]
Length=528

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            SF E ++Q  L+T CTLLWKELSDHF++LE+ L  KSEAL++K Q+LD  T+++L  L +
Sbjct  17   SFAELEKQRELITCCTLLWKELSDHFSTLERGLEIKSEALRSKRQSLDASTRRTLGSLRR  76

Query  310  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            RE SI A++ + L K+DE +R A V+   A  ++  E+    GL  KLRS C
Sbjct  77   RELSIDAAVDLALSKLDE-RRVAAVQALAAAAADGDEL----GLPEKLRSLC  123



>ref|XP_006826275.1| hypothetical protein AMTR_s00004p00045050 [Amborella trichopoda]
 gb|ERM93512.1| hypothetical protein AMTR_s00004p00045050 [Amborella trichopoda]
Length=513

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 72/118 (61%), Gaps = 9/118 (8%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F +  +Q +L+T+CTLLWK+LS HF+SLEQ L  KS+ L  K QTLD QT+++LE+LE+
Sbjct  9    AFQDLDKQRTLITNCTLLWKDLSHHFSSLEQHLQEKSQTLDTKSQTLDQQTQKTLEILEQ  68

Query  310  RETSIAASISITLKKVDESKRAALV------EFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            RE SI       + K+ + K AAL+      E GN   + +    N   +  KLR FC
Sbjct  69   REQSINYLEESAVTKLQQQKEAALLAAEKVAEEGNPNSNSD---SNDRAIESKLRGFC  123



>emb|CDY38318.1| BnaC05g30110D [Brassica napus]
Length=531

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  163  MTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISI  342
            MTSC+L+WK+L+DHFT+LEQ+L++KSEALK  ++TLD QT+ SLE L++RE +I  S+ I
Sbjct  1    MTSCSLMWKDLTDHFTTLEQNLMKKSEALKKMIETLDNQTQTSLESLKRREVTIDRSVEI  60

Query  343  TLKKVDESKRAAL  381
              +KV +  RAAL
Sbjct  61   VAEKVGKRVRAAL  73



>gb|KCW60755.1| hypothetical protein EUGRSUZ_H03480 [Eucalyptus grandis]
Length=477

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = +1

Query  229  LRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGS  408
            ++KSEALK KL+ LD QTK++L VL++RET+I  S+ I L+KV++SK AAL      GG 
Sbjct  1    MKKSEALKQKLRALDDQTKKTLTVLDERETTIDGSVEIVLEKVEKSKEAALGALERGGGR  60

Query  409  E-EP-----EVDNSAGLLLKLRSFCV  468
            + EP     EVD+  GLL+KLRSFC+
Sbjct  61   DVEPGSPGGEVDDGEGLLMKLRSFCL  86



>gb|KCW60756.1| hypothetical protein EUGRSUZ_H03480 [Eucalyptus grandis]
Length=511

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = +1

Query  229  LRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDESKRAALVEFGNAGGS  408
            ++KSEALK KL+ LD QTK++L VL++RET+I  S+ I L+KV++SK AAL      GG 
Sbjct  1    MKKSEALKQKLRALDDQTKKTLTVLDERETTIDGSVEIVLEKVEKSKEAALGALERGGGR  60

Query  409  E-EP-----EVDNSAGLLLKLRSFCV  468
            + EP     EVD+  GLL+KLRSFC+
Sbjct  61   DVEPGSPGGEVDDGEGLLMKLRSFCL  86



>ref|XP_008786398.1| PREDICTED: FRIGIDA-like protein 4a [Phoenix dactylifera]
Length=486

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 66/112 (59%), Gaps = 6/112 (5%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +FDE + Q +L+++CTL+WK LSDHF+SL Q L  +S+AL ++LQ L+ Q+KQ+LE L+ 
Sbjct  15   AFDELEAQKNLISNCTLIWKSLSDHFSSLRQTLADRSQALDSQLQALEAQSKQTLESLDL  74

Query  310  RETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            RE SI    S     + E K A L E       E P+      L   LR +C
Sbjct  75   REASIPDRESAATALIGERKDAVLSEI------ETPDAKPPDDLQGILRWYC  120



>ref|XP_006842236.1| hypothetical protein AMTR_s00078p00186900 [Amborella trichopoda]
 gb|ERN03911.1| hypothetical protein AMTR_s00078p00186900 [Amborella trichopoda]
Length=568

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 75/111 (68%), Gaps = 9/111 (8%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F+  + + +L+TSCT LW+++++HF+SLE+DL  KS+ L +KLQTL+T TK++L  L++R
Sbjct  16   FETLETEKNLLTSCTDLWRKVANHFSSLERDLNLKSQTLDSKLQTLETTTKETLGSLDRR  75

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E+SI A  S +L ++++ K AA  +F N    E PE         KLRSFC
Sbjct  76   ESSIPAIESASLDRIEKLKEAAFSDFANVNKGELPE---------KLRSFC  117



>ref|XP_002281155.2| PREDICTED: FRIGIDA-like protein 4a isoform X2 [Vitis vinifera]
Length=533

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 69/111 (62%), Gaps = 7/111 (6%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            FD  + Q +++++CT L+K LS+HF+SL+  L +KS +L +K Q L++ +K++LE L++R
Sbjct  12   FDSLEAQKTILSTCTQLYKTLSNHFSSLQHSLSQKSSSLDSKFQALESDSKKTLESLDQR  71

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E SI    S    +++E + AAL EF  A       V  +A L   L+S+C
Sbjct  72   ENSIPERESSAAARIEEQREAALSEFEKA-------VPENAELSECLKSYC  115



>ref|XP_010656337.1| PREDICTED: FRIGIDA-like protein 4a isoform X1 [Vitis vinifera]
Length=539

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 69/111 (62%), Gaps = 7/111 (6%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            FD  + Q +++++CT L+K LS+HF+SL+  L +KS +L +K Q L++ +K++LE L++R
Sbjct  12   FDSLEAQKTILSTCTQLYKTLSNHFSSLQHSLSQKSSSLDSKFQALESDSKKTLESLDQR  71

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E SI    S    +++E + AAL EF  A       V  +A L   L+S+C
Sbjct  72   ENSIPERESSAAARIEEQREAALSEFEKA-------VPENAELSECLKSYC  115



>emb|CAN61251.1| hypothetical protein VITISV_004639 [Vitis vinifera]
Length=630

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 69/111 (62%), Gaps = 7/111 (6%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            FD  + Q +++++CT L+K LS+HF+SL+  L +KS +L +K Q L++ +K++LE L++R
Sbjct  12   FDSLEAQKTILSTCTQLYKTLSNHFSSLQHSLSQKSSSLDSKFQALESDSKKTLESLDQR  71

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E SI    S    +++E + AAL EF       E  V  +A L   L+S+C
Sbjct  72   ENSIPERESSAAARIEEQREAALSEF-------EKAVPENAELSECLKSYC  115



>ref|XP_010915058.1| PREDICTED: FRIGIDA-like protein 4b isoform X2 [Elaeis guineensis]
Length=507

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 62/110 (56%), Gaps = 6/110 (5%)
 Frame = +1

Query  136  DEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE  315
            D  + Q +L+++CTLLWK LSDHF+SL Q L  +S+A+ +++Q LD  T+Q+LE L+ RE
Sbjct  16   DYLEAQKTLISNCTLLWKNLSDHFSSLRQTLADRSQAIDSQIQALDADTEQTLESLDLRE  75

Query  316  TSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
             SI    S     + E + A L E       E P+      L   LR +C
Sbjct  76   ASIPDRESTAAALIQERQDAVLAEI------EIPDAKPPDDLPGLLRWYC  119



>ref|XP_010915057.1| PREDICTED: FRIGIDA-like protein 4b isoform X1 [Elaeis guineensis]
Length=509

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 62/110 (56%), Gaps = 6/110 (5%)
 Frame = +1

Query  136  DEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE  315
            D  + Q +L+++CTLLWK LSDHF+SL Q L  +S+A+ +++Q LD  T+Q+LE L+ RE
Sbjct  16   DYLEAQKTLISNCTLLWKNLSDHFSSLRQTLADRSQAIDSQIQALDADTEQTLESLDLRE  75

Query  316  TSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
             SI    S     + E + A L E       E P+      L   LR +C
Sbjct  76   ASIPDRESTAAALIQERQDAVLAEI------EIPDAKPPDDLPGLLRWYC  119



>ref|XP_003532490.1| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=520

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            FDE + + +++  CT L+  LS HF+SL+  +  KS++L +KLQ+LD+ +K++LE L +R
Sbjct  9    FDELEAKKTILAKCTDLFTTLSTHFSSLQHSVAEKSQSLDSKLQSLDSLSKETLESLHRR  68

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEV  423
            ETSI    S    ++ E + AAL E   A    +P++
Sbjct  69   ETSIPERESSAAARIKEQREAALAELLRATPPPDPDL  105



>tpg|DAA59720.1| TPA: hypothetical protein ZEAMMB73_037297 [Zea mays]
Length=382

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 63/113 (56%), Gaps = 0/113 (0%)
 Frame = +1

Query  127  TSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLE  306
              F E +RQ  L+ +CT L+++LSDHF SLE+ L  +S+AL+ + +  D +T ++L+ L 
Sbjct  35   AGFAELERQQQLLATCTRLYQQLSDHFGSLERGLAARSDALRVRRRAFDARTHRALDSLH  94

Query  307  KRETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            +RE SI AS+S  L  +     +A      +  +      +S GL   LR+ C
Sbjct  95   RREASIDASVSRALDHLHSISASASAAAAASSKAPATSDSDSEGLAESLRALC  147



>ref|XP_004287092.1| PREDICTED: FRIGIDA-like protein 4a isoform X1 [Fragaria vesca 
subsp. vesca]
Length=570

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            FD+ + Q +++++ T L+  +SDHFT+L++ L  K ++L +K+++L+++++Q+LE L+ R
Sbjct  16   FDDLEAQKAILSTSTKLYATISDHFTALQKSLAEKFKSLDSKIESLESRSRQTLESLDVR  75

Query  313  ETSIAASISITLKKVDESKRAALVEFG  393
            ETS+A   +    +V E K AAL EFG
Sbjct  76   ETSLAEREASAAARVSEQKYAALAEFG  102



>ref|XP_008652075.1| PREDICTED: FRIGIDA-like protein 4a [Zea mays]
 tpg|DAA59721.1| TPA: hypothetical protein ZEAMMB73_037297 [Zea mays]
Length=607

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 63/111 (57%), Gaps = 0/111 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F E +RQ  L+ +CT L+++LSDHF SLE+ L  +S+AL+ + +  D +T ++L+ L +R
Sbjct  37   FAELERQQQLLATCTRLYQQLSDHFGSLERGLAARSDALRVRRRAFDARTHRALDSLHRR  96

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E SI AS+S  L  +     +A      +  +      +S GL   LR+ C
Sbjct  97   EASIDASVSRALDHLHSISASASAAAAASSKAPATSDSDSEGLAESLRALC  147



>ref|XP_011458926.1| PREDICTED: FRIGIDA-like protein 4a isoform X2 [Fragaria vesca 
subsp. vesca]
Length=547

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            FD+ + Q +++++ T L+  +SDHFT+L++ L  K ++L +K+++L+++++Q+LE L+ R
Sbjct  16   FDDLEAQKAILSTSTKLYATISDHFTALQKSLAEKFKSLDSKIESLESRSRQTLESLDVR  75

Query  313  ETSIAASISITLKKVDESKRAALVEFG  393
            ETS+A   +    +V E K AAL EFG
Sbjct  76   ETSLAEREASAAARVSEQKYAALAEFG  102



>ref|XP_010228309.1| PREDICTED: FRIGIDA-like protein 4a [Brachypodium distachyon]
Length=569

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 65/111 (59%), Gaps = 4/111 (4%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F E +RQ  L+ SCT L+++LSDHF SLE+ L  +S+A++ K + ++ +T ++L+ L +R
Sbjct  22   FAELERQQQLLASCTRLYQQLSDHFASLERGLAARSDAIRHKRRAVEARTGRALDSLRRR  81

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E SI  S+S  L+++D    A            E    ++AGL   LR+ C
Sbjct  82   ELSIDGSVSRALEQLDSLAAAGGSGGQEGSSVSE----DAAGLADGLRALC  128



>ref|XP_007204566.1| hypothetical protein PRUPE_ppa003799mg [Prunus persica]
 gb|EMJ05765.1| hypothetical protein PRUPE_ppa003799mg [Prunus persica]
Length=548

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            FD+ + Q +++++ T L+  LS HF SL+  L +KS++L++K+Q+L+++++++LE L+ R
Sbjct  16   FDDLEAQKAILSTSTKLFTTLSKHFNSLQDSLSQKSQSLESKIQSLESRSRETLESLDLR  75

Query  313  ETSIAASISITLKKVDESKRAALVEF  390
            ETSI    S  + +++E K AAL EF
Sbjct  76   ETSIPERESAAVARIEEQKAAALAEF  101



>gb|AFG65514.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65515.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65516.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65517.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65518.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65519.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65520.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65521.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65522.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65523.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65524.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65525.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
 gb|AFG65526.1| hypothetical protein UMN_3842_02, partial [Pinus taeda]
Length=118

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 57/88 (65%), Gaps = 2/88 (2%)
 Frame = +1

Query  151  QTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAA  330
            Q  ++  CTL WKEL+DH+ SLE+ L +K E L  K + L+ +TK++ E+L+KRE SI +
Sbjct  8    QRGVLEKCTLQWKELTDHYASLEESLQKKFEELAEKEKNLELKTKETEELLDKREQSIES  67

Query  331  SISITLKKVDESKRAAL--VEFGNAGGS  408
            +    L +++E K AAL  +E G +  S
Sbjct  68   NEETYLARLEEQKNAALAAIESGKSENS  95



>ref|XP_002514326.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48280.1| conserved hypothetical protein [Ricinus communis]
Length=547

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +1

Query  136  DEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE  315
            ++ + Q ++++SCT L+  L+ HFTSL+Q L  KS++L +K Q+L + + Q+LE L  RE
Sbjct  17   EDLEAQKTILSSCTQLFTTLTSHFTSLQQSLTVKSQSLDSKFQSLQSNSNQTLESLSHRE  76

Query  316  TSIAASISITLKKVDESKRAALVEF  390
            TSI    S    K++E K  AL EF
Sbjct  77   TSIPERESAAAAKIEEQKVKALAEF  101



>ref|XP_008242610.1| PREDICTED: FRIGIDA-like protein 4a [Prunus mume]
Length=551

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            FD+ + Q +++++ T L+  LS HF SL+  L +KS++L++K+Q+L+++++++LE L+ R
Sbjct  18   FDDLEAQKAILSTSTKLFTTLSKHFNSLQDSLSQKSQSLESKIQSLESRSRETLESLDLR  77

Query  313  ETSIAASISITLKKVDESKRAALVEF  390
            ETSI    S    +++E K AAL EF
Sbjct  78   ETSIPERESAAAARIEEQKAAALAEF  103



>ref|XP_003525267.2| PREDICTED: FRIGIDA-like protein 4a-like [Glycine max]
Length=520

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 63/103 (61%), Gaps = 3/103 (3%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            FDE + + +++  CT L+  LS HF+SL+  +  KS++L + LQ+LD+ +K++LE L +R
Sbjct  9    FDELEAKKTILAKCTDLFTTLSTHFSSLQHSISEKSQSLDSNLQSLDSLSKETLESLHRR  68

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGL  441
            ETSI    S    +++E + AAL +      +  P+ D SA L
Sbjct  69   ETSIPERESAAAARIEEQREAALADL---RATHPPDPDLSATL  108



>ref|XP_006650719.1| PREDICTED: FRIGIDA-like protein 4a-like, partial [Oryza brachyantha]
Length=536

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 45/111 (41%), Positives = 69/111 (62%), Gaps = 7/111 (6%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F E +RQ  L+ +CT L+++L++HF SLE+ L  +SE L+AK + LD +T + LE L +R
Sbjct  9    FAELERQQQLLATCTRLYQQLTEHFGSLERRLAARSETLRAKRRFLDVRTSRRLEALRRR  68

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E SI  S+S+ L ++D   ++A    G AG       D +AG+  +LRS C
Sbjct  69   EGSIDGSVSLALSQLDSLGKSAA---GTAGSGS----DAAAGIAEELRSLC  112



>ref|XP_004503419.1| PREDICTED: uncharacterized protein LOC101489761 [Cicer arietinum]
Length=537

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            FDE +   + +T CT L+  LS+HF+SL+  +  K + L +K Q+L++ +K++LE L  R
Sbjct  21   FDELENHKNTLTKCTHLFTSLSNHFSSLQDSISLKFQTLDSKFQSLESSSKETLESLNNR  80

Query  313  ETSIAASISITLKKVDESKRAALVEFGNA  399
            E SI    S    ++DE K AA+ E  N+
Sbjct  81   ENSIPERESSAAARIDEQKEAAIAELRNS  109



>ref|XP_004955594.1| PREDICTED: protein FRIGIDA-like [Setaria italica]
Length=570

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F E +RQ  L+ +CT L+++LSDHF SLE+ L  +S+AL+ + +  D +T ++L+ L +R
Sbjct  27   FAELERQQQLLATCTRLYQQLSDHFGSLERGLAARSDALRVRCRAFDARTHRALDALHRR  86

Query  313  ETSIAASISITL  348
            E SI  S+S  L
Sbjct  87   EASIDGSVSRAL  98



>gb|KDP33654.1| hypothetical protein JCGZ_07225 [Jatropha curcas]
Length=539

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 67/111 (60%), Gaps = 10/111 (9%)
 Frame = +1

Query  136  DEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE  315
            D+ + + +++TSCT L   L+ HFTSL+  L +KS++L +K Q+L++ ++ +LE L +RE
Sbjct  17   DDLEARKTVLTSCTQLLTTLTSHFTSLQDSLSQKSQSLDSKFQSLESNSQDTLESLSQRE  76

Query  316  TSIAASISITLKKVDESKRAALVEFGNAGGSEEP-EVDNSAGLLLKLRSFC  465
            TSI    S    K+ E K  AL +F      E+P + DN + L   L+S C
Sbjct  77   TSIPERESAAAAKIQEQKEKALADF------EKPSKFDNLSDL---LKSLC  118



>dbj|BAK00009.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F E +RQ  L+ SCT L+++L++HF SLE+ +  +S++L+A+ + ++ +  + L+ L +R
Sbjct  30   FAELERQQELLASCTRLYQQLTEHFGSLERGIKSRSDSLRARRRVVELRASRRLDALRRR  89

Query  313  ETSIAASISITLKKVD  360
            E SI AS+S+ L ++D
Sbjct  90   ERSIEASVSLALSRLD  105



>ref|XP_009336927.1| PREDICTED: FRIGIDA-like protein 4a [Pyrus x bretschneideri]
Length=554

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 68/111 (61%), Gaps = 7/111 (6%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F++ + Q +++++ T L+  LSDHF SL++ +  KS +L++K+Q+L+++++++L+ L+ R
Sbjct  24   FEDLEAQKAILSTSTKLFTTLSDHFDSLQKSISEKSHSLESKIQSLESRSRETLQSLDHR  83

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E SI    S T  +++E K AAL E        E  V     L   L+SFC
Sbjct  84   EASIPERESSTAARIEEQKAAALAEV-------EKNVFGDLDLAETLKSFC  127



>gb|ABK25209.1| unknown [Picea sitchensis]
 gb|ACN40848.1| unknown [Picea sitchensis]
Length=534

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F     Q +++  CTL WKEL+DH+ SLEQ L +K E L  K ++L+ +TK++ E+L+K
Sbjct  14   AFTVLDTQRAVLEKCTLQWKELTDHYASLEQSLQKKFEELAEKEKSLELKTKETEELLDK  73

Query  310  RETSIAASISITLKKVDESKRAALV  384
            RE SI ++    + +++E K +AL 
Sbjct  74   REQSIESNEETYIARLEEQKTSALA  98



>gb|ABR17868.1| unknown [Picea sitchensis]
Length=601

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F +       +T CT+ WKEL +HF SLE+ + ++ E L+AK +T + + +++ ++L+K
Sbjct  14   AFVDLDEHREALTKCTVQWKELEEHFVSLERSIQKRLEDLEAKERTFEAKMRETQDILDK  73

Query  310  RETSIAASISITLKKVDESKRAALV  384
            RE SIA+    +L +V E K AAL 
Sbjct  74   REVSIASKEQASLARVQEQKDAALA  98



>tpg|DAA42568.1| TPA: hypothetical protein ZEAMMB73_160821 [Zea mays]
Length=578

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F E +RQ  L+ +CT L++ LSDH  SLE+ L  +S+AL+ + +  D +T ++L+ L +R
Sbjct  32   FAELERQQRLLATCTRLYQHLSDHIGSLERGLAARSDALRVRRRAFDARTHRALDSLHRR  91

Query  313  ETSIAASISITL  348
            E SI AS+S  L
Sbjct  92   EASIDASVSRAL  103



>ref|XP_002461525.1| hypothetical protein SORBIDRAFT_02g004090 [Sorghum bicolor]
 gb|EER98046.1| hypothetical protein SORBIDRAFT_02g004090 [Sorghum bicolor]
Length=524

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 39/116 (34%), Positives = 64/116 (55%), Gaps = 11/116 (9%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F E +RQ  L+ +CT L+++L+DHF SLE+ L  +SE L+ + +  D +T ++L+ L +R
Sbjct  31   FAELERQQQLLATCTRLYQQLADHFGSLERGLAARSEQLRVRRRAFDARTHRALDSLHRR  90

Query  313  ETSIAASISITLKKV----DESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFCV  468
            E S+  S+S  L  +     E+  A      ++  SEE       GL   LR+ C+
Sbjct  91   EASVDTSVSRALDHLHSISKEAAAAPAPTPSDSAASEE-------GLAESLRALCL  139



>gb|EEC76321.1| hypothetical protein OsI_13877 [Oryza sativa Indica Group]
Length=550

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/111 (39%), Positives = 67/111 (60%), Gaps = 7/111 (6%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F E +RQ  L+ +CT L+++L++HF SLE+ L  +SE L+ K + LD +T + LE L +R
Sbjct  27   FAELERQQQLLATCTRLYQQLTEHFGSLERRLAARSETLRTKRRFLDVRTSRRLEALRRR  86

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E SI  S+S+ L ++D   +      G+AG +     D +AG+   LRS C
Sbjct  87   EASIDGSVSLALSRLDSLAK------GDAGTTGSASAD-AAGIAEGLRSLC  130



>ref|NP_001051543.1| Os03g0794900 [Oryza sativa Japonica Group]
 gb|AAT76425.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99329.1| hydroxyproline-rich glycoprotein family protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13457.1| Os03g0794900 [Oryza sativa Japonica Group]
 dbj|BAG95534.1| unnamed protein product [Oryza sativa Japonica Group]
Length=550

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/111 (39%), Positives = 67/111 (60%), Gaps = 7/111 (6%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F E +RQ  L+ +CT L+++L++HF SLE+ L  +SE L+ K + LD +T + LE L +R
Sbjct  27   FAELERQQQLLATCTRLYQQLTEHFGSLERRLAARSETLRTKRRFLDVRTSRRLEALRRR  86

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E SI  S+S+ L ++D   +      G+AG +     D +AG+   LRS C
Sbjct  87   EASIDGSVSLALSRLDSLAK------GDAGTTGSASAD-AAGIAEGLRSLC  130



>ref|XP_010088834.1| hypothetical protein L484_020817 [Morus notabilis]
 gb|EXB37031.1| hypothetical protein L484_020817 [Morus notabilis]
Length=541

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
             D+ + Q +++++CT L+K L+ HF+SL++ L  K ++L +K++ L++ ++++LE L++R
Sbjct  16   LDDLEAQKTILSTCTQLFKTLTSHFSSLQKSLSEKHQSLDSKIKALESHSRRTLESLDRR  75

Query  313  ETSIAASISITLKKVDESKRAALVEF  390
            E SI    S    ++ E K +AL EF
Sbjct  76   ECSIPDHESNAAARIAEQKDSALAEF  101



>ref|XP_008386583.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
 ref|XP_008386605.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=546

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F++ + Q +++++ T L+  LSDHF SL++ +   S +L++K+Q+L+++++++L+ L+ R
Sbjct  16   FEDLEAQRAILSTSTKLFTTLSDHFDSLQKSISENSHSLESKIQSLESRSRETLQSLDHR  75

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E SI    S    +++E K AAL E        E  V     L   L+SFC
Sbjct  76   EASIPERESSAAARIEEQKAAALAEV-------EKNVSGDLDLPETLKSFC  119



>ref|XP_011043451.1| PREDICTED: FRIGIDA-like protein 4a [Populus euphratica]
Length=561

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F++   + + ++SCT L+  L+ HF SL+  L +KS++L++K Q+L++ ++ +LE L  R
Sbjct  16   FNDLDARKTFLSSCTQLFTTLTTHFKSLQTSLSQKSQSLESKFQSLESNSQLTLESLSCR  75

Query  313  ETSIAASISITLKKVDESKRAALVEFGNA  399
            E SI    S    KV+E +  AL EF N+
Sbjct  76   EKSIPERESAAAAKVEEQRETALSEFRNS  104



>dbj|BAC83627.1| putative hydroxyproline-rich glycoprotein [Oryza sativa Japonica 
Group]
 dbj|BAG89444.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81597.1| hypothetical protein OsI_25073 [Oryza sativa Indica Group]
Length=534

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/84 (37%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F E +RQ  L+ SCT L+K+L +HF SLE+ L  +S++L+ K +  + +   +++ L +R
Sbjct  15   FAELERQQQLLASCTRLYKQLEEHFASLERGLAARSDSLRHKRRAAEARASAAMDSLRRR  74

Query  313  ETSIAASISITLKKVDESKRAALV  384
            E SI  S+S  L  +D+   A+ V
Sbjct  75   EASIDGSVSRALDHLDDLASASSV  98



>ref|XP_009347163.1| PREDICTED: FRIGIDA-like protein 4a [Pyrus x bretschneideri]
Length=539

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 63/111 (57%), Gaps = 7/111 (6%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F +   Q +++++ T L+  LSDHF SL++ +  KS +L++K+Q+L+++T+++   L+ R
Sbjct  16   FGDLDEQKAILSTSTKLFTTLSDHFDSLQKSISDKSHSLESKIQSLESRTRENSHSLDHR  75

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E SI    S    +++E K AAL E        E +      L   L+SFC
Sbjct  76   EASIPERGSSAAARIEEQKAAALAEV-------EKKASGELDLPETLKSFC  119



>ref|XP_006451127.1| hypothetical protein CICLE_v10007961mg [Citrus clementina]
 ref|XP_006475599.1| PREDICTED: FRIGIDA-like protein 4a-like [Citrus sinensis]
 gb|ESR64367.1| hypothetical protein CICLE_v10007961mg [Citrus clementina]
Length=536

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F++ + Q ++++SC  L+K L+ HFTSLE  L +K ++L +K  +LD+ + Q+L+ L  R
Sbjct  16   FEDLKAQKTILSSCMQLFKSLTSHFTSLEDSLSQKFKSLDSKFLSLDSTSAQTLDSLSHR  75

Query  313  ETSIAASISITLKKVDESKRAALVEF  390
            E SI    +   + + + + +AL +F
Sbjct  76   ENSIPDRHNAAFRLIHDHRDSALADF  101



>dbj|BAC83628.1| putative hydroxyproline-rich glycoprotein [Oryza sativa Japonica 
Group]
Length=419

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +1

Query  127  TSFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLE  306
              F E +RQ  L+ SCT L+K+L +HF SLE+ L  +S++L+ K +  + +   +++ L 
Sbjct  13   AGFAELERQQQLLASCTRLYKQLEEHFASLERGLAARSDSLRHKRRAAEARASAAMDSLR  72

Query  307  KRETSIAASISITLKKVDE  363
            +RE SI  S+S  L  +D+
Sbjct  73   RREASIDGSVSRALDHLDD  91



>ref|XP_006371900.1| hypothetical protein POPTR_0018s05910g [Populus trichocarpa]
 gb|ERP49697.1| hypothetical protein POPTR_0018s05910g [Populus trichocarpa]
Length=564

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F++   + ++++SCT L+  L+ HF SL+  L +KS +L++K Q+L++ ++ +LE L  R
Sbjct  16   FNDLDARKTILSSCTQLFTTLTTHFKSLQNSLSQKSLSLESKFQSLESNSQLTLESLSCR  75

Query  313  ETSIAASISITLKKVDESKRAALVEFGNA  399
            E SI    S    KV+E +  AL EF N+
Sbjct  76   EKSIPERESAAAAKVEEQRETALSEFRNS  104



>gb|KDO50860.1| hypothetical protein CISIN_1g009377mg [Citrus sinensis]
Length=536

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F++ + Q ++++SC  L+K L+ HFTSLE  L +K ++L +K  +LD+ + Q+L+ L  R
Sbjct  16   FEDLKAQKTILSSCMQLFKSLTSHFTSLEDSLSQKFKSLDSKFLSLDSTSAQTLDSLSHR  75

Query  313  ETSIAASISITLKKVDESKRAALVEF  390
            E SI    +   + + + + +AL +F
Sbjct  76   ENSIPDRHNAAFRLIHDHRDSALADF  101



>ref|NP_001059003.1| Os07g0173200 [Oryza sativa Japonica Group]
 dbj|BAF20917.1| Os07g0173200 [Oryza sativa Japonica Group]
Length=453

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F E +RQ  L+ SCT L+K+L +HF SLE+ L  +S++L+ K +  + +   +++ L +R
Sbjct  15   FAELERQQQLLASCTRLYKQLEEHFASLERGLAARSDSLRHKRRAAEARASAAMDSLRRR  74

Query  313  ETSIAASISITLKKVDE  363
            E SI  S+S  L  +D+
Sbjct  75   EASIDGSVSRALDHLDD  91



>ref|XP_007160344.1| hypothetical protein PHAVU_002G313900g [Phaseolus vulgaris]
 gb|ESW32338.1| hypothetical protein PHAVU_002G313900g [Phaseolus vulgaris]
Length=529

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 59/103 (57%), Gaps = 3/103 (3%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F+E + + S++  CT L+  LS HF+SL+  +  KS+ + +KLQ+L++ + ++L+ L  R
Sbjct  17   FEELEAKKSILAKCTNLFTTLSTHFSSLQHSVTDKSQFIDSKLQSLESLSSETLQSLHHR  76

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGL  441
            +TSI    S    ++ + K AAL E         P+ D SA L
Sbjct  77   QTSIPERESAAAARISDQKEAALAE---VRAPPLPDPDLSAAL  116



>gb|AAP31312.2| ABI3-interacting protein 2 [Callitropsis nootkatensis]
Length=672

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            SF+E      +M +CT+ WKEL +HF+ +++ L ++ E L  K +  + +T ++ +VLEK
Sbjct  46   SFEELDAHKGVMENCTIQWKELDEHFSYIDEALKKRFEELLEKEKQFEAKTSETWKVLEK  105

Query  310  RETSIAASISITLKKVDESKRAALV  384
             +  +AA    +L +V E K AA+ 
Sbjct  106  HDEVVAAKEQASLSRVQEEKDAAVA  130



>ref|XP_011010336.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
 ref|XP_011010338.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
 ref|XP_011010339.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
 ref|XP_011010340.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
Length=545

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  166  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  345
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEKRE ++ A   ++
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKQYETKTRRAREILEKREAAVVAKEQVS  93

Query  346  LKKVDESKRAALVEFGNA  399
            L+K+ E + AA+    NA
Sbjct  94   LEKLQEKRDAAIFSISNA  111



>ref|XP_008337438.1| PREDICTED: FRIGIDA-like protein 4a [Malus domestica]
Length=539

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 62/111 (56%), Gaps = 7/111 (6%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F +   Q +++++ T L+  LSDHF SL++ +  KS +L++K Q+L+++T+++   L+ R
Sbjct  16   FGDLDEQRAILSTSTKLFITLSDHFDSLQKSISEKSYSLESKTQSLESRTRENSHSLDHR  75

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E SI    S    +++E K AAL E        E +      L   L+SFC
Sbjct  76   EASIPERGSSAAARIEEQKAAALAEV-------EKKASGDLDLPETLKSFC  119



>gb|EEE60086.1| hypothetical protein OsJ_12936 [Oryza sativa Japonica Group]
Length=516

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F E +RQ  L+ +CT L+++L++HF SLE+ L  +SE L+ K + LD +T + LE L +R
Sbjct  27   FAELERQQQLLATCTRLYQQLTEHFGSLERRLAARSETLRTKRRFLDVRTSRRLEALRRR  86

Query  313  ETSIAASISITLKKVD  360
            E SI  S+S+ L ++D
Sbjct  87   EASIDGSVSLALSRLD  102



>gb|KHG13959.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=534

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = +1

Query  136  DEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE  315
            ++ + Q  +++ CT L+  L++HFTSL+  L +KS +L AK  +L ++  Q+LE L +RE
Sbjct  17   EDLEVQKKIVSKCTELFTTLTNHFTSLQNSLSQKSHSLDAKFLSLSSKFSQTLESLSQRE  76

Query  316  TSIAASISITLKKVDESKRAALVEFGNAGGSEE  414
             S+    S     ++  K AA  EF +  GS +
Sbjct  77   YSLPDRESAAAAHIETLKEAAFAEFKDPKGSAQ  109



>gb|KJB06948.1| hypothetical protein B456_001G004500 [Gossypium raimondii]
Length=534

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = +1

Query  136  DEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE  315
            ++ + Q  +++ CT L+  L++HFTSL+  L +KS++L AK  +L ++  QSL+ L +RE
Sbjct  17   EDLEAQKKIVSKCTELFTTLTNHFTSLQNSLSQKSQSLDAKFLSLSSKFSQSLDSLSQRE  76

Query  316  TSIAASISITLKKVDESKRAALVEFGNAGGSEE  414
            + +    S     ++  K AA  EF +  GS +
Sbjct  77   SCLPDRESAAAAHIETLKEAAFAEFKDPKGSAQ  109



>gb|AFK43654.1| unknown [Medicago truncatula]
Length=539

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F+E + Q + +  CT L+ +L++HF+ L+  + +K + L ++ Q+L+++ K++LE L  +
Sbjct  21   FNELESQKNTLIKCTDLFTKLNNHFSFLQDSISQKFQTLDSQFQSLESRHKETLESLANQ  80

Query  313  ETSIAASISITLKKVDESKRAALVEFGN  396
            E SI    S    ++DE K AAL    N
Sbjct  81   ENSIPERESSAAARIDEQKEAALAALRN  108



>ref|XP_003629646.1| Protein FRIGIDA [Medicago truncatula]
 ref|XP_003630808.1| Protein FRIGIDA [Medicago truncatula]
 gb|AET04122.1| frigida-LIKE protein [Medicago truncatula]
Length=539

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F+E + Q + +  CT L+ +L++HF+ L+  + +K + L ++ Q+L+++ K++LE L  +
Sbjct  21   FNELESQKNTLIKCTDLFTKLNNHFSFLQDSISQKFQTLDSQFQSLESRHKETLESLANQ  80

Query  313  ETSIAASISITLKKVDESKRAALVEFGN  396
            E SI    S    ++DE K AAL    N
Sbjct  81   ENSIPERESSAAARIDEQKEAALAALRN  108



>ref|XP_011024727.1| PREDICTED: FRIGIDA-like protein 3 [Populus euphratica]
Length=544

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  166  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  345
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEKRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKQYETKTRRAREILEKREAAVVAKEQAS  93

Query  346  LKKVDESKRAALVEFGNA  399
            L+K+ E + AA+    NA
Sbjct  94   LEKLQEKQDAAVFAIANA  111



>ref|XP_002320559.2| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
 ref|XP_006375598.1| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
 gb|EEE98874.2| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
 gb|ERP53395.1| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
Length=545

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  166  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  345
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEKRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKQYETKTRRAREILEKREAAVVAKEQDS  93

Query  346  LKKVDESKRAALVEFGNA  399
            L+K+ E + AA+    NA
Sbjct  94   LEKLQEKRDAAIFSISNA  111



>gb|ABK94872.1| unknown [Populus trichocarpa]
 gb|ABK95875.1| unknown [Populus trichocarpa]
Length=544

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  166  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  345
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEKRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKQYETKTRRAREILEKREAAVMAKEQAS  93

Query  346  LKKVDESKRAALVEFGNA  399
            L+K+ E + AA+    NA
Sbjct  94   LEKLQEKQDAAVFAIANA  111



>ref|XP_002303026.1| hypothetical protein POPTR_0002s24090g [Populus trichocarpa]
 gb|EEE82299.1| hypothetical protein POPTR_0002s24090g [Populus trichocarpa]
Length=544

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  166  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  345
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEKRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKQYETKTRRAREILEKREAAVMAKEQAS  93

Query  346  LKKVDESKRAALVEFGNA  399
            L+K+ E + AA+    NA
Sbjct  94   LEKLQEKQDAAVFAIANA  111



>ref|XP_006375597.1| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
 gb|ERP53394.1| hypothetical protein POPTR_0014s17360g [Populus trichocarpa]
Length=414

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  166  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  345
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEKRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKQYETKTRRAREILEKREAAVVAKEQDS  93

Query  346  LKKVDESKRAALVEFGNA  399
            L+K+ E + AA+    NA
Sbjct  94   LEKLQEKRDAAIFSISNA  111



>gb|KJB08745.1| hypothetical protein B456_001G101100 [Gossypium raimondii]
Length=531

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q +L  +  L WKEL +HF+ LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESQRAL--TLNLRWKELEEHFSGLEKSLKRRFHELEDQEKEFETKTRKAREMLQK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            RE ++ A    +L ++ E + AA+    NA
Sbjct  82   REAAVVAKEQSSLVRLQEKRDAAVFAITNA  111



>gb|KJB08746.1| hypothetical protein B456_001G101100 [Gossypium raimondii]
Length=527

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q +L  +  L WKEL +HF+ LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESQRAL--TLNLRWKELEEHFSGLEKSLKRRFHELEDQEKEFETKTRKAREMLQK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            RE ++ A    +L ++ E + AA+    NA
Sbjct  82   REAAVVAKEQSSLVRLQEKRDAAVFAITNA  111



>gb|KHG21752.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=531

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q +L  +  L WKEL +HF+ LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESQRAL--TLNLRWKELEEHFSGLEKSLKRRFHELEDQEKEFETKTRKAREMLQK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            RE ++ A    +L ++ E + AA+    NA
Sbjct  82   REAAVVAKEQSSLVRLQEKRDAAVFAITNA  111



>gb|KJB08748.1| hypothetical protein B456_001G101100 [Gossypium raimondii]
Length=401

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q +L  +  L WKEL +HF+ LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESQRAL--TLNLRWKELEEHFSGLEKSLKRRFHELEDQEKEFETKTRKAREMLQK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            RE ++ A    +L ++ E + AA+    NA
Sbjct  82   REAAVVAKEQSSLVRLQEKRDAAVFAITNA  111



>gb|KJB08747.1| hypothetical protein B456_001G101100 [Gossypium raimondii]
Length=339

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q +L  +  L WKEL +HF+ LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESQRAL--TLNLRWKELEEHFSGLEKSLKRRFHELEDQEKEFETKTRKAREMLQK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            RE ++ A    +L ++ E + AA+    NA
Sbjct  82   REAAVVAKEQSSLVRLQEKRDAAVFAITNA  111



>gb|KHN30845.1| Protein FRIGIDA [Glycine soja]
Length=544

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + +  + +T+++ E+LEKR+ ++ A    TL++
Sbjct  37   NLKWKELEEHFHGLEKSLKRRFHELEDQEKEFENKTRKAQEILEKRQAAVYAKEQATLQR  96

Query  355  VDESKRAALVEFGNA  399
            + E + AA+ +  NA
Sbjct  97   LQEKRDAAVFDIVNA  111



>ref|XP_003521013.1| PREDICTED: FRIGIDA-like protein 3-like [Glycine max]
Length=544

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + +  + +T+++ E+LEKR+ ++ A    TL++
Sbjct  37   NLKWKELEEHFHGLEKSLKRRFHELEDQEKEFENKTRKAQEILEKRQAAVYAKEQATLQR  96

Query  355  VDESKRAALVEFGNA  399
            + E + AA+ +  NA
Sbjct  97   LQEKRDAAVFDIVNA  111



>gb|KDP45205.1| hypothetical protein JCGZ_15070 [Jatropha curcas]
Length=538

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  166  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  345
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ EVLEKRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQEVLEKREAAVLAKEQAS  93

Query  346  LKKVDESKRAALVEFGNA  399
            L ++ E + AA+    NA
Sbjct  94   LGRLQEKRDAAVFAITNA  111



>gb|AFK33866.1| unknown [Lotus japonicus]
Length=212

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + +  +++T++S E+LEKRE ++ +   ++L++
Sbjct  37   NLKWKELEEHFHGLEKSLKRRFHELEDQEKEFESKTRKSRELLEKREAAVFSKEQVSLQR  96

Query  355  VDESKRAALVEFGNA  399
            + E + AA     NA
Sbjct  97   LQEKRDAAAFAVVNA  111



>ref|XP_002527289.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35133.1| conserved hypothetical protein [Ricinus communis]
Length=542

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 52/92 (57%), Gaps = 6/92 (7%)
 Frame = +1

Query  166  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  345
             +  L WKEL +HF  LE+ L R+   L+ + +   T+T+++ E+LEKRE ++ A    +
Sbjct  34   VTLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYATKTRRAQEMLEKREAAVLAKEHAS  93

Query  346  LKKVDESKRAALVEFGNA------GGSEEPEV  423
            L+++ E + AA+    +A      G S EP V
Sbjct  94   LERLQEKRDAAVFAIAHALQKNGQGSSAEPVV  125



>gb|KHN41627.1| hypothetical protein glysoja_036371 [Glycine soja]
Length=67

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            FDE + + +++  CT L+  LS HF+SL+  +  KS++L +KLQ+LD+ +K++LE L +
Sbjct  9    FDELEAKKTILAKCTDLFTTLSTHFSSLQHSISEKSQSLDSKLQSLDSLSKETLESLHR  67



>gb|KJB10825.1| hypothetical protein B456_001G227000 [Gossypium raimondii]
Length=551

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  166  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  345
             +  L WKEL +HF  LE+ L R+   L+ + +  +T+T++S E+L+KRE ++ A    +
Sbjct  43   VTLNLKWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKSREMLKKREAAVVAKEQAS  102

Query  346  LKKVDESKRAALVEFGNA  399
            L ++ E + AA+    NA
Sbjct  103  LVRLQEKRDAAVFAISNA  120



>gb|KJB10822.1| hypothetical protein B456_001G227000 [Gossypium raimondii]
 gb|KJB10823.1| hypothetical protein B456_001G227000 [Gossypium raimondii]
 gb|KJB10824.1| hypothetical protein B456_001G227000 [Gossypium raimondii]
Length=542

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + +  +T+T++S E+L+KRE ++ A    +L +
Sbjct  37   NLKWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKSREMLKKREAAVVAKEQASLVR  96

Query  355  VDESKRAALVEFGNA  399
            + E + AA+    NA
Sbjct  97   LQEKRDAAVFAISNA  111



>ref|XP_004956399.1| PREDICTED: protein FRIGIDA-like [Setaria italica]
Length=534

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E +RQ+++  S  L WK+L DHF  LEQ L +K + LK + +       +S ++LE+
Sbjct  24   AFAELERQSAV--SMNLKWKQLEDHFRGLEQSLKKKFDELKEQEKEFQETVAKSEQMLEQ  81

Query  310  RETSIAASISITLKKVDESKRAAL  381
            RE ++ A    +L+++ E + AAL
Sbjct  82   REAAVVAKELTSLERLQEKRDAAL  105



>gb|KHG07809.1| Protein FRIGIDA -like protein [Gossypium arboreum]
Length=543

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + +  +T+T++S E+L+KRE ++ A    +L +
Sbjct  37   NLKWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKSREMLKKREAAVVAKEQASLVR  96

Query  355  VDESKRAALVEFGNA  399
            + E + AA+    NA
Sbjct  97   LQEMRDAAVFAISNA  111



>ref|NP_001151902.1| ABI3-interacting protein 2 [Zea mays]
 gb|ACF85534.1| unknown [Zea mays]
 gb|ACG44869.1| ABI3-interacting protein 2 [Zea mays]
 gb|ACN29239.1| unknown [Zea mays]
 tpg|DAA39370.1| TPA: ABI3-interacting protein 2 isoform 1 [Zea mays]
 tpg|DAA39371.1| TPA: ABI3-interacting protein 2 isoform 2 [Zea mays]
 tpg|DAA39372.1| TPA: ABI3-interacting protein 2 isoform 3 [Zea mays]
Length=534

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q+++  S  L WK+L DHF  LEQ L +K + LK + +       +S ++LE+
Sbjct  24   AFAELESQSTV--SMNLKWKQLEDHFRGLEQSLKKKFDELKEQEKEFQETVAKSEQILEQ  81

Query  310  RETSIAASISITLKKVDESKRAAL  381
            RE ++ A    +L+K+ E + AAL
Sbjct  82   REAAVVAKELTSLEKLQEKREAAL  105



>ref|XP_007134303.1| hypothetical protein PHAVU_010G035900g [Phaseolus vulgaris]
 gb|ESW06297.1| hypothetical protein PHAVU_010G035900g [Phaseolus vulgaris]
Length=543

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WK+L +HF  LE+ L R+   L+ + +  + +T+++ E+LEKR+ ++ A    TL++
Sbjct  37   NLKWKDLEEHFHGLEKTLKRRFHELEDQEKEFENKTRKAREILEKRQAAVYAKEQDTLQR  96

Query  355  VDESKRAALVEFGNA  399
            + E + AA+ +  NA
Sbjct  97   LQEKRDAAVFDIMNA  111



>ref|XP_006447936.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 ref|XP_006447937.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 ref|XP_006469349.1| PREDICTED: FRIGIDA-like protein 3-like isoform X2 [Citrus sinensis]
 ref|XP_006469350.1| PREDICTED: FRIGIDA-like protein 3-like isoform X3 [Citrus sinensis]
 ref|XP_006469351.1| PREDICTED: FRIGIDA-like protein 3-like isoform X4 [Citrus sinensis]
 ref|XP_006469352.1| PREDICTED: FRIGIDA-like protein 3-like isoform X5 [Citrus sinensis]
 ref|XP_006469353.1| PREDICTED: FRIGIDA-like protein 3-like isoform X6 [Citrus sinensis]
 gb|ESR61176.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 gb|ESR61177.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
Length=549

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 53/90 (59%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E +   ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESHRAI--TLNLRWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREILQK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            RE ++ A    TL+K+ + + AA+     A
Sbjct  82   REAAVLAKEQTTLEKLQKKRDAAVFAISTA  111



>ref|XP_010037083.1| PREDICTED: FRIGIDA-like protein 3 [Eucalyptus grandis]
 ref|XP_010037084.1| PREDICTED: FRIGIDA-like protein 3 [Eucalyptus grandis]
 ref|XP_010037085.1| PREDICTED: FRIGIDA-like protein 3 [Eucalyptus grandis]
 ref|XP_010037086.1| PREDICTED: FRIGIDA-like protein 3 [Eucalyptus grandis]
 gb|KCW48707.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
 gb|KCW48708.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
 gb|KCW48709.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
Length=546

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 52/90 (58%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E +   ++  +  L WKEL +HF  LE+ L R+   L+ + + L+T+  ++ E+LEK
Sbjct  24   AFAELESHRAV--TLNLKWKELEEHFHGLERSLKRRFHELEGQEKELETKASKARELLEK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            RE  + A    +L+K+  ++ AA +   NA
Sbjct  82   READVLAKEQASLEKLQVNRDAAAIAISNA  111



>ref|XP_004510190.1| PREDICTED: protein FRIGIDA-like [Cicer arietinum]
Length=546

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + +  +++T+++ EVLEK+E ++ A    TL++
Sbjct  37   NLKWKELEEHFHGLEKSLKRRFHELEDQEKVFESKTRKAREVLEKQEAAVFAKEQATLQR  96

Query  355  VDESKRAALVEFGNA  399
            + E + A++    NA
Sbjct  97   LQEKRDASVFTIVNA  111



>ref|XP_006447935.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 ref|XP_006447938.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 ref|XP_006469348.1| PREDICTED: FRIGIDA-like protein 3-like isoform X1 [Citrus sinensis]
 gb|ESR61175.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
 gb|ESR61178.1| hypothetical protein CICLE_v10014710mg [Citrus clementina]
Length=586

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 53/90 (59%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E +   ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  61   AFAELESHRAI--TLNLRWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREILQK  118

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            RE ++ A    TL+K+ + + AA+     A
Sbjct  119  REAAVLAKEQTTLEKLQKKRDAAVFAISTA  148



>ref|XP_010277793.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Nelumbo nucifera]
Length=550

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 52/90 (58%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E +   ++  +  L WKEL +HF  LE+ L ++   L+ + +  +T+  ++ E+LEK
Sbjct  32   AFAELESHHAI--TLNLKWKELEEHFHGLERSLKQRFNELEDQEKKYETKVSEAREILEK  89

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            RE ++ A    +L+K+ E + AAL   G A
Sbjct  90   REAAVVAKEQASLEKLQEKRDAALSAIGIA  119



>ref|XP_010277794.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Nelumbo nucifera]
 ref|XP_010277795.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Nelumbo nucifera]
Length=542

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 52/90 (58%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E +   ++  +  L WKEL +HF  LE+ L ++   L+ + +  +T+  ++ E+LEK
Sbjct  24   AFAELESHHAI--TLNLKWKELEEHFHGLERSLKQRFNELEDQEKKYETKVSEAREILEK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            RE ++ A    +L+K+ E + AAL   G A
Sbjct  82   REAAVVAKEQASLEKLQEKRDAALSAIGIA  111



>ref|XP_010688181.1| PREDICTED: FRIGIDA-like protein 4a [Beta vulgaris subsp. vulgaris]
Length=566

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 62/111 (56%), Gaps = 7/111 (6%)
 Frame = +1

Query  133  FDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKR  312
            F+  + Q +L+  CT L+K L+ HF++L+Q +  K+  L +KL++LD+   +SL+ L +R
Sbjct  17   FNNLESQKNLLCKCTDLYKTLTSHFSTLQQSIDSKTLTLDSKLESLDSIHHKSLDELHER  76

Query  313  ETSIAASISITLKKVDESKRAALVEFGNAGGSEEPEVDNSAGLLLKLRSFC  465
            E S+   +     ++   + +A+ E       ++P ++ S  L   LRS C
Sbjct  77   EISLPHRLLSLSSEIKTKRESAIAEL------QKP-LNESLPLSEVLRSLC  120



>gb|KCW48710.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
 gb|KCW48711.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
 gb|KCW48712.1| hypothetical protein EUGRSUZ_K02358 [Eucalyptus grandis]
Length=402

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + + L+T+  ++ E+LEKRE  + A    +L+K
Sbjct  37   NLKWKELEEHFHGLERSLKRRFHELEGQEKELETKASKARELLEKREADVLAKEQASLEK  96

Query  355  VDESKRAALVEFGNA  399
            +  ++ AA +   NA
Sbjct  97   LQVNRDAAAIAISNA  111



>ref|XP_003521014.1| PREDICTED: FRIGIDA-like protein 3-like isoform X1 [Glycine max]
 ref|XP_006576663.1| PREDICTED: FRIGIDA-like protein 3-like isoform X2 [Glycine max]
 ref|XP_006576664.1| PREDICTED: FRIGIDA-like protein 3-like isoform X3 [Glycine max]
Length=546

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+ + L+ + +  + +T+++ E+LEKRE ++ A    +L++
Sbjct  37   NLKWKELEEHFHGLEKSLKRRFDELEDQEKEFENKTRKAREILEKREAAVFAKEQDSLQR  96

Query  355  VDESKRAALVEFGNA  399
            + E + AA     NA
Sbjct  97   LQEKRDAASFAIVNA  111



>ref|XP_004510189.1| PREDICTED: protein FRIGIDA-like [Cicer arietinum]
Length=541

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + +  + +T+++ E+L+K+E +I A    TL++
Sbjct  37   NLKWKELEEHFHGLEKSLKRRFHELEDQEKVFENKTRKAREMLKKQEAAIFAKEQATLQR  96

Query  355  VDESKRAALVEFGNA  399
            + E + AA+    NA
Sbjct  97   LQEKRDAAVFAIVNA  111



>ref|XP_007049532.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
 ref|XP_007049533.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
 gb|EOX93689.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
 gb|EOX93690.1| FRIGIDA-like protein isoform 1 [Theobroma cacao]
Length=546

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 53/90 (59%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E +   ++  +  + WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESHRAI--TLNMKWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREILQK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            RE ++ A    +L ++ E + AA+    N+
Sbjct  82   REAAVVAKEQASLLRLQEKRDAAVFAITNS  111



>ref|XP_007013214.1| FRIGIDA-like protein [Theobroma cacao]
 gb|EOY30833.1| FRIGIDA-like protein [Theobroma cacao]
Length=534

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = +1

Query  136  DEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRE  315
            D+ +   +++++CT L+  L+ HF+SL+  L +KS++L +K  +L + + Q+LE L  RE
Sbjct  17   DDLEAHKTILSTCTQLFTALTKHFSSLQDSLSQKSQSLDSKFLSLSSTSSQTLESLSLRE  76

Query  316  TSIAASISITLKKVDESKRAALVEFGN  396
            +SI    S    +++  K +AL EF N
Sbjct  77   SSIPDRESAVTARIETQKESALAEFQN  103



>ref|XP_003634846.1| PREDICTED: FRIGIDA-like protein 3 [Vitis vinifera]
 emb|CAN80762.1| hypothetical protein VITISV_014605 [Vitis vinifera]
Length=545

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 54/95 (57%), Gaps = 2/95 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E +   +L  +  L WK+L +HF  LE+ L R+   L+ + +  + +T ++ ++LEK
Sbjct  24   AFAELESHRAL--TLNLKWKQLEEHFHGLEKSLKRRFNELEDQEKEFEMKTMEAQQLLEK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNAGGSEE  414
            RE ++ A    +L+++ E + AA+    NA G  +
Sbjct  82   REAAVVAKEQDSLRRLQEKRDAAVFAIVNALGKHD  116



>ref|XP_009151640.1| PREDICTED: FRIGIDA-like protein 3 [Brassica rapa]
Length=545

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            ++ ++ A   ++L+++ + + AA+    +A
Sbjct  82   KKAAVEAKEKVSLERLQKKRDAAVFAINSA  111



>ref|XP_006599130.1| PREDICTED: FRIGIDA-like protein 3-like [Glycine max]
 gb|KHN16980.1| Protein FRIGIDA [Glycine soja]
Length=546

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+ + L+ + +  +++T+++ E+LEKRE ++ A    + ++
Sbjct  37   NLKWKELEEHFHGLEKSLKRRFDELEDQEKEFESKTRKAHEILEKREAAVFAKEQDSFQR  96

Query  355  VDESKRAALVEFGNA  399
            + E + AA     NA
Sbjct  97   LQEKRDAASFAIVNA  111



>gb|KHN30846.1| Protein FRIGIDA [Glycine soja]
Length=543

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+ + L+ + +  + +T+++ E+LEKRE ++ A    + ++
Sbjct  37   NLKWKELEEHFHGLEKSLKRRFDELEDQEKEFENKTRKAREILEKREAAVFAKEQDSFQR  96

Query  355  VDESKRAALVEFGNA  399
            + E + AA     NA
Sbjct  97   LQEKRDAASFAIVNA  111



>ref|XP_006858746.1| hypothetical protein AMTR_s00066p00134410 [Amborella trichopoda]
 gb|ERN20213.1| hypothetical protein AMTR_s00066p00134410 [Amborella trichopoda]
Length=544

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q ++  S  L WK L +HF  LE+ L ++ E L+ K +  + +  ++ E+LEK
Sbjct  24   AFAELEGQRAV--SLNLKWKALEEHFHDLERSLKKRFEELEEKEKAFEARASEAKEMLEK  81

Query  310  RETSIAASISITLKKVDESKRAAL  381
            RE ++ A    +L +V + + AAL
Sbjct  82   REAAVNAKEEASLDRVQDQRDAAL  105



>gb|AGV54168.1| protein FRIGIDA-like protein [Phaseolus vulgaris]
Length=548

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  166  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  345
             +  + WKEL +HF  LE+ L R+   L+ + +  + +T ++ E+LEKRE ++ A    +
Sbjct  36   VTLNMKWKELEEHFHGLEKSLKRRFHELEDQEKEFENKTMKARELLEKREAAVFAKEQDS  95

Query  346  LKKVDESKRAALVEFGNA  399
             +K+ E + AA+    NA
Sbjct  96   FQKIQEKRDAAVFAIVNA  113



>gb|KDO43511.1| hypothetical protein CISIN_1g008061mg [Citrus sinensis]
Length=442

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+ RE ++ A    TL+K
Sbjct  67   NLRWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREILQTREAAVLAKEQTTLEK  126

Query  355  VDESKRAALVEFGNA  399
            + + + AA+     A
Sbjct  127  LQKKRDAAVFAISTA  141



>gb|AIG88464.1| FRIGIDA-like protein, partial [Beta vulgaris subsp. vulgaris]
Length=333

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 58/107 (54%), Gaps = 8/107 (7%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E +   ++  S  L WKEL  HF  LE+ L R+   L+ + +  +++T ++ E++EK
Sbjct  3    AFAELESHRAV--SLNLKWKELEAHFHGLEKSLKRRFHELEDQEKEYESKTVEAQEMIEK  60

Query  310  RETSIAASISITLKKVDESKRAALVEFGNAG------GSEEPEVDNS  432
            R+T++ A    +L+K+ E + AA+     A         EE  VDNS
Sbjct  61   RKTAVVAKEQASLEKLQEKRDAAVFAIAIAREKHRRVSCEEYSVDNS  107



>ref|XP_006395188.1| hypothetical protein EUTSA_v10003930mg [Eutrema salsugineum]
 ref|XP_006395189.1| hypothetical protein EUTSA_v10003930mg [Eutrema salsugineum]
 gb|ESQ32474.1| hypothetical protein EUTSA_v10003930mg [Eutrema salsugineum]
 gb|ESQ32475.1| hypothetical protein EUTSA_v10003930mg [Eutrema salsugineum]
Length=559

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+TK++ E+LEK
Sbjct  25   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTKKAQELLEK  82

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            ++ ++ A    +L+++ + + AA+    +A
Sbjct  83   KKAAVEAKEKASLERLQKKRDAAMFAINSA  112



>gb|KDO43512.1| hypothetical protein CISIN_1g008061mg [Citrus sinensis]
Length=579

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+ RE ++ A    TL+K
Sbjct  67   NLRWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREILQTREAAVLAKEQTTLEK  126

Query  355  VDESKRAALVEFGNA  399
            + + + AA+     A
Sbjct  127  LQKKRDAAVFAISTA  141



>ref|XP_006426019.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
 ref|XP_006426020.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
 gb|ESR39259.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
 gb|ESR39260.1| hypothetical protein CICLE_v10025275mg [Citrus clementina]
Length=568

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  184  WKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKKVDE  363
            WKE+ +HF +LE  L RKSE L+A+ +  + +  ++  +L +RE ++AA     + +V E
Sbjct  40   WKEIEEHFYNLETTLKRKSEELEAREKEYEEKESKTHALLAEREAAVAAKEQDFIDRVQE  99

Query  364  SKRAALVEFGNAGGSEEP  417
             K AA+   G+A G+ +P
Sbjct  100  LKDAAVAAIGDARGNYQP  117



>ref|XP_010095585.1| hypothetical protein L484_007424 [Morus notabilis]
 gb|EXB61158.1| hypothetical protein L484_007424 [Morus notabilis]
Length=549

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 56/104 (54%), Gaps = 8/104 (8%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E +   ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T ++  +LEK
Sbjct  24   AFAELESHRAI--TLNLKWKELEEHFHGLEKSLKRRFHELEDQEKEFETRTTEAQRLLEK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNAG------GSEEPEV  423
            RE +I A    +L+++ + + AA+     A        SEEP V
Sbjct  82   REAAIVAKEQTSLERLQQKRDAAVFAITAAREKHRKVSSEEPAV  125



>ref|XP_006280261.1| hypothetical protein CARUB_v10026179mg [Capsella rubella]
 gb|EOA13159.1| hypothetical protein CARUB_v10026179mg [Capsella rubella]
Length=556

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            ++ ++ A    +L+++ + + AA+    +A
Sbjct  82   KKAAVEAKEKASLERLQKKRDAAMFAINSA  111



>gb|AIN75614.1| FRIGIDA3b-1 [Dimocarpus longan]
 gb|AIN75615.1| FRIGIDA3b-2 [Dimocarpus longan]
Length=550

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E +   ++  +  + WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+K
Sbjct  24   AFAELESHRAI--TLNMKWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREMLQK  81

Query  310  RETSIAASISITLKKVDESKRAAL  381
            RE ++ A    +L K+ + + AA+
Sbjct  82   REAAVVAKEQASLDKLQKKRDAAV  105



>gb|KDO43521.1| hypothetical protein CISIN_1g008061mg [Citrus sinensis]
Length=386

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+ RE ++ A    TL+K
Sbjct  67   NLRWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREILQTREAAVLAKEQTTLEK  126

Query  355  VDESKRAALVEFGNA  399
            + + + AA+     A
Sbjct  127  LQKKRDAAVFAISTA  141



>emb|CDX86307.1| BnaA06g30240D [Brassica napus]
Length=1493

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            ++ ++ A   ++L+++ + + AA+    +A
Sbjct  82   KKAAVEAKEKVSLERLQKKRDAAVFAINSA  111



>ref|XP_010493658.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Camelina sativa]
 ref|XP_010493659.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Camelina sativa]
Length=551

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            ++ ++ A    +L+++ + + AA+    +A
Sbjct  82   KKAAVEAKEKASLERLQKKRDAAMFTINSA  111



>gb|AGV54643.1| frigida protein [Phaseolus vulgaris]
Length=548

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  166  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  345
             +  + WKEL +HF  LE+ L R+   L+ + +  + +T ++ E+LEKRE ++ A    +
Sbjct  36   VTLNMKWKELEEHFHGLEKSLKRRFHELEDQEKEFENKTMKARELLEKREAAVFAKEQDS  95

Query  346  LKKVDESKRAALVEFGNA  399
             +++ E + AA+    NA
Sbjct  96   FQRIQEKRDAAVFAIVNA  113



>ref|XP_010442259.1| PREDICTED: FRIGIDA-like protein 3 [Camelina sativa]
 ref|XP_010442260.1| PREDICTED: FRIGIDA-like protein 3 [Camelina sativa]
 ref|XP_010442261.1| PREDICTED: FRIGIDA-like protein 3 [Camelina sativa]
Length=556

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            ++ ++ A    +L+++ + + AA+    +A
Sbjct  82   KKAAVEAKEKASLERLQKKRDAAMFTINSA  111



>ref|XP_010482089.1| PREDICTED: FRIGIDA-like protein 3 isoform X2 [Camelina sativa]
Length=554

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            ++ ++ A    +L+++ + + AA+    +A
Sbjct  82   KKAAVEAKEKASLERLQKKRDAAMFTINSA  111



>ref|XP_010482087.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Camelina sativa]
 ref|XP_010482088.1| PREDICTED: FRIGIDA-like protein 3 isoform X1 [Camelina sativa]
Length=555

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAV--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            ++ ++ A    +L+++ + + AA+    +A
Sbjct  82   KKAAVEAKEKASLERLQKKRDAAMFTINSA  111



>ref|XP_007134304.1| hypothetical protein PHAVU_010G036000g [Phaseolus vulgaris]
 ref|XP_007134305.1| hypothetical protein PHAVU_010G036000g [Phaseolus vulgaris]
 ref|XP_007134306.1| hypothetical protein PHAVU_010G036000g [Phaseolus vulgaris]
 gb|ESW06298.1| hypothetical protein PHAVU_010G036000g [Phaseolus vulgaris]
 gb|ESW06299.1| hypothetical protein PHAVU_010G036000g [Phaseolus vulgaris]
 gb|ESW06300.1| hypothetical protein PHAVU_010G036000g [Phaseolus vulgaris]
Length=548

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             + WKEL +HF  LE+ L R+   L+ + +  + +T ++ E+LEKRE ++ A    + ++
Sbjct  39   NMKWKELEEHFHGLEKSLKRRFHELEDQEKEFENKTMKARELLEKREAAVFAKEQDSFQR  98

Query  355  VDESKRAALVEFGNA  399
            + E + AA+    NA
Sbjct  99   IQEKRDAAVFAIVNA  113



>ref|XP_009385695.1| PREDICTED: FRIGIDA-like protein 3 [Musa acuminata subsp. malaccensis]
 ref|XP_009385705.1| PREDICTED: FRIGIDA-like protein 3 [Musa acuminata subsp. malaccensis]
Length=538

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 59/100 (59%), Gaps = 4/100 (4%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E +R +++  S  L WKEL +HF  LE+ L  + + L+ + +   T+  ++ ++LEK
Sbjct  24   AFAELERHSAI--SLNLKWKELEEHFHGLEKSLKTRFDELEDQEKEYVTEVTEAQQMLEK  81

Query  310  RETSIAASISITLKKVDESKRAAL-VEFGNAGGSE-EPEV  423
            +ET++ A    +L+++ E + AAL V F   G S  EP V
Sbjct  82   QETAVVAKELASLERLQEKRDAALSVLFDKHGTSSLEPVV  121



>ref|NP_001062667.1| Os09g0248200 [Oryza sativa Japonica Group]
 dbj|BAD19897.1| putative ABI3-interacting protein 2 [Oryza sativa Japonica Group]
 dbj|BAD26001.1| putative ABI3-interacting protein 2 [Oryza sativa Japonica Group]
 dbj|BAF24581.1| Os09g0248200 [Oryza sativa Japonica Group]
Length=540

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 53/89 (60%), Gaps = 3/89 (3%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q+++  S  L WK+L DHF  LEQ L +K + LK + +  +    +S ++LE+
Sbjct  24   AFAELESQSAV--SLNLKWKQLEDHFHGLEQSLKKKFDDLKRQEEEFEETVAKSEQMLEQ  81

Query  310  RETSIAASISITLKKVDESKRAAL-VEFG  393
            +E  + A    +L+K+ + + AAL V FG
Sbjct  82   QEAVVVAKELTSLEKLQQKRDAALAVIFG  110



>dbj|BAD19898.1| putative ABI3-interacting protein 2 [Oryza sativa Japonica Group]
 dbj|BAD26002.1| putative ABI3-interacting protein 2 [Oryza sativa Japonica Group]
 gb|ACJ54912.1| ABI3 interacting protein [Oryza sativa Japonica Group]
 dbj|BAG96275.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69256.1| hypothetical protein OsJ_28510 [Oryza sativa Japonica Group]
Length=545

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 53/89 (60%), Gaps = 3/89 (3%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q+++  S  L WK+L DHF  LEQ L +K + LK + +  +    +S ++LE+
Sbjct  24   AFAELESQSAV--SLNLKWKQLEDHFHGLEQSLKKKFDDLKRQEEEFEETVAKSEQMLEQ  81

Query  310  RETSIAASISITLKKVDESKRAAL-VEFG  393
            +E  + A    +L+K+ + + AAL V FG
Sbjct  82   QEAVVVAKELTSLEKLQQKRDAALAVIFG  110



>gb|EEC84154.1| hypothetical protein OsI_30525 [Oryza sativa Indica Group]
Length=540

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 53/89 (60%), Gaps = 3/89 (3%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q+++  S  L WK+L DHF  LEQ L +K + LK + +  +    +S ++LE+
Sbjct  24   AFAELESQSAV--SLNLKWKQLEDHFHGLEQSLKKKFDDLKRQEEEFEETVAKSEQMLEQ  81

Query  310  RETSIAASISITLKKVDESKRAAL-VEFG  393
            +E  + A    +L+K+ + + AAL V FG
Sbjct  82   QEAVVVAKELTSLEKLQQKRDAALAVIFG  110



>gb|KDO43513.1| hypothetical protein CISIN_1g008061mg [Citrus sinensis]
Length=427

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+ RE ++ A    TL+K
Sbjct  67   NLRWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREILQTREAAVLAKEQTTLEK  126

Query  355  VDESKRAALVEFGNA  399
            + + + AA+     A
Sbjct  127  LQKKRDAAVFAISTA  141



>gb|KDO43515.1| hypothetical protein CISIN_1g008061mg [Citrus sinensis]
 gb|KDO43516.1| hypothetical protein CISIN_1g008061mg [Citrus sinensis]
Length=457

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+ RE ++ A    TL+K
Sbjct  67   NLRWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREILQTREAAVLAKEQTTLEK  126

Query  355  VDESKRAALVEFGNA  399
            + + + AA+     A
Sbjct  127  LQKKRDAAVFAISTA  141



>gb|AGV54832.1| frigida-like protein [Phaseolus vulgaris]
Length=529

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  166  TSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISIT  345
             +  + WKEL +HF  LE+ L R+   L+ + +  + +T ++ E+LEKRE ++ A    +
Sbjct  36   VTLNMKWKELEEHFHGLEKSLKRRFHELEDQEKEFENKTMKARELLEKREAAVFAKEQDS  95

Query  346  LKKVDESKRAALVEFGNA  399
             +++ E + AA+    NA
Sbjct  96   FQRIQEKRDAAVFAIVNA  113



>gb|KDO43514.1| hypothetical protein CISIN_1g008061mg [Citrus sinensis]
Length=464

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+ RE ++ A    TL+K
Sbjct  74   NLRWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREILQTREAAVLAKEQTTLEK  133

Query  355  VDESKRAALVEFGNA  399
            + + + AA+     A
Sbjct  134  LQKKRDAAVFAISTA  148



>gb|KDO43517.1| hypothetical protein CISIN_1g008061mg [Citrus sinensis]
 gb|KDO43518.1| hypothetical protein CISIN_1g008061mg [Citrus sinensis]
 gb|KDO43519.1| hypothetical protein CISIN_1g008061mg [Citrus sinensis]
 gb|KDO43520.1| hypothetical protein CISIN_1g008061mg [Citrus sinensis]
Length=427

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+L+ RE ++ A    TL+K
Sbjct  37   NLRWKELEEHFHGLEKSLKRRFHELEDQEKEFETKTRKAREILQTREAAVLAKEQTTLEK  96

Query  355  VDESKRAALVEFGNA  399
            + + + AA+     A
Sbjct  97   LQKKRDAAVFAISTA  111



>ref|XP_010551997.1| PREDICTED: FRIGIDA-like protein 3 [Tarenaya hassleriana]
 ref|XP_010551998.1| PREDICTED: FRIGIDA-like protein 3 [Tarenaya hassleriana]
Length=559

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  24   AFAELESQRAI--TLNLKWKELEEHFHGLERSLKRRFHELEDQEREYETKTRKAQELLEK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            ++ ++ A    +L+++ + + AA++   +A
Sbjct  82   KKAAVEAKEKASLERLQKKRDAAVLAITSA  111



>ref|XP_010679002.1| PREDICTED: FRIGIDA-like protein 3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679003.1| PREDICTED: FRIGIDA-like protein 3 [Beta vulgaris subsp. vulgaris]
Length=563

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 57/107 (53%), Gaps = 8/107 (7%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E +   ++  S  L WKEL  HF  LE+ L R+   L+ + +  +++T ++ E++EK
Sbjct  24   AFAELESHRAV--SLNLKWKELEAHFHGLEKSLKRRFHELEDQEKEYESKTVEAQEMIEK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFGNAG------GSEEPEVDNS  432
            R+ ++ A    +L+K+ E + AA+     A         EE  VDNS
Sbjct  82   RKAAVVAKEQASLEKLQEKRDAAVFAIAIAREKHRRVSCEEYSVDNS  128



>ref|XP_006366815.1| PREDICTED: FRIGIDA-like protein 3-like isoform X1 [Solanum tuberosum]
 ref|XP_006366816.1| PREDICTED: FRIGIDA-like protein 3-like isoform X2 [Solanum tuberosum]
Length=545

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +1

Query  175  TLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEKRETSIAASISITLKK  354
             L WK+L +HF  L++ L R+   L+ + +  +T+  QS E+LEKR+ ++ A+   +L++
Sbjct  37   NLQWKQLEEHFNGLQKSLKRRFTELEDQEKEFETKIVQSTEILEKRQAAVIATEQASLQR  96

Query  355  VDESKRAAL  381
            + E + AA+
Sbjct  97   LQEKRDAAV  105



>ref|XP_010251408.1| PREDICTED: FRIGIDA-like protein 3 [Nelumbo nucifera]
 ref|XP_010251409.1| PREDICTED: FRIGIDA-like protein 3 [Nelumbo nucifera]
Length=545

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 51/88 (58%), Gaps = 2/88 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E +   ++  +  L WKEL +HF  LE+ L ++   L+ + +  +++  ++ E+LEK
Sbjct  24   AFAELESHRAI--TLNLKWKELEEHFHGLERSLKQRFNELEDQEKKYESKVSEAQEMLEK  81

Query  310  RETSIAASISITLKKVDESKRAALVEFG  393
            R+ ++ A    +L+K+ E + AAL   G
Sbjct  82   RKAAVVAKEQASLEKLQEKRDAALFAIG  109



>ref|XP_010547174.1| PREDICTED: FRIGIDA-like protein 3 [Tarenaya hassleriana]
Length=538

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q ++  +  L WKEL +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  25   AFAELESQRAI--TLNLKWKELEEHFHGLERSLKRRFHELEDQEKEYETRTRKAGELLEK  82

Query  310  RETSIAASISITLKKVDESKRAALV  384
            ++  + A    +L+++ + + AA++
Sbjct  83   KKADVDAKEKASLERLQKKRDAAML  107



>emb|CDX85335.1| BnaC07g26460D [Brassica napus]
Length=1617

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q ++  +  L WKE+ +HF  LE+ L R+   L+ + +  +T+T+++ E+LEK
Sbjct  148  AFAELESQRAV--TLNLKWKEIEEHFHGLERSLKRRFHELEDQEKEYETKTRKAQELLEK  205

Query  310  RETSIAASISITLKKVDESKRAALVEFGNA  399
            ++ ++ A   ++L+++ + + AA+    +A
Sbjct  206  KKAAVEAKEKVSLERLQKKRDAAVFAINSA  235



>ref|XP_002457174.1| hypothetical protein SORBIDRAFT_03g002730 [Sorghum bicolor]
 gb|EES02294.1| hypothetical protein SORBIDRAFT_03g002730 [Sorghum bicolor]
Length=536

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = +1

Query  130  SFDEFQRQTSLMTSCTLLWKELSDHFTSLEQDLLRKSEALKAKLQTLDTQTKQSLEVLEK  309
            +F E + Q+++  S  L WK+L DHF  LEQ L +K + LK + +       +S  +LE+
Sbjct  24   AFAELESQSAV--SMNLKWKQLEDHFRGLEQSLKKKFDELKEQEEEFQEIVAKSDLMLEQ  81

Query  310  RETSIAASISITLKKVDESKRAAL  381
            RE ++ A    +L+++ E + AAL
Sbjct  82   REAAVVAKELTSLERLQEKRDAAL  105



Lambda      K        H        a         alpha
   0.311    0.125    0.331    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556930065965