BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF022G09

Length=465
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006338842.1|  PREDICTED: CTD small phosphatase-like protei...    137   5e-36   Solanum tuberosum [potatoes]
ref|XP_004240939.1|  PREDICTED: CTD nuclear envelope phosphatase ...    130   2e-33   Solanum lycopersicum
ref|XP_009760937.1|  PREDICTED: nuclear envelope morphology prote...    125   1e-31   Nicotiana sylvestris
emb|CDP14017.1|  unnamed protein product                                124   6e-31   Coffea canephora [robusta coffee]
ref|XP_009760936.1|  PREDICTED: CTD nuclear envelope phosphatase ...    123   1e-30   Nicotiana sylvestris
ref|XP_009610469.1|  PREDICTED: nuclear envelope morphology prote...    121   3e-30   Nicotiana tomentosiformis
ref|XP_009610468.1|  PREDICTED: CTD nuclear envelope phosphatase ...    119   3e-29   Nicotiana tomentosiformis
ref|XP_011084905.1|  PREDICTED: LOW QUALITY PROTEIN: CTD nuclear ...    118   6e-29   
ref|XP_004239942.1|  PREDICTED: carboxy-terminal domain RNA polym...    114   2e-27   Solanum lycopersicum
gb|EYU20007.1|  hypothetical protein MIMGU_mgv1a010325mg                111   3e-26   Erythranthe guttata [common monkey flower]
ref|XP_002273682.1|  PREDICTED: carboxy-terminal domain RNA polym...    110   7e-26   Vitis vinifera
ref|XP_011076695.1|  PREDICTED: CTD small phosphatase-like protein      108   5e-25   Sesamum indicum [beniseed]
ref|XP_006355653.1|  PREDICTED: CTD small phosphatase-like protei...    103   2e-23   Solanum tuberosum [potatoes]
ref|XP_010264631.1|  PREDICTED: CTD nuclear envelope phosphatase ...  98.2    2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_008243657.1|  PREDICTED: carboxy-terminal domain RNA polym...  97.8    2e-21   Prunus mume [ume]
ref|XP_004302575.1|  PREDICTED: carboxy-terminal domain RNA polym...  96.7    5e-21   Fragaria vesca subsp. vesca
ref|XP_007205648.1|  hypothetical protein PRUPE_ppa009333mg           92.4    1e-19   Prunus persica
gb|EPS72976.1|  hypothetical protein M569_01780                       92.4    2e-19   Genlisea aurea
emb|CDP02804.1|  unnamed protein product                              87.4    4e-19   Coffea canephora [robusta coffee]
ref|XP_009377758.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.5    7e-19   Pyrus x bretschneideri [bai li]
ref|XP_008442416.1|  PREDICTED: CTD small phosphatase-like protein 2  89.7    2e-18   Cucumis melo [Oriental melon]
ref|XP_008370103.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.4    2e-18   
ref|XP_004137719.1|  PREDICTED: CTD small phosphatase-like protei...  89.0    3e-18   Cucumis sativus [cucumbers]
gb|KCW86105.1|  hypothetical protein EUGRSUZ_B02803                   88.2    3e-18   Eucalyptus grandis [rose gum]
ref|XP_008370102.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.0    3e-18   
ref|XP_006843565.1|  hypothetical protein AMTR_s00007p00087260        87.0    1e-17   
ref|XP_010044096.1|  PREDICTED: CTD small phosphatase-like protein    87.4    1e-17   Eucalyptus grandis [rose gum]
ref|XP_002265560.1|  PREDICTED: CTD small phosphatase-like protein    87.0    1e-17   Vitis vinifera
ref|XP_009346338.1|  PREDICTED: uncharacterized protein LOC103938066  85.9    2e-17   
ref|XP_009805067.1|  PREDICTED: CTD small phosphatase-like protei...  85.1    4e-17   Nicotiana sylvestris
ref|XP_009805066.1|  PREDICTED: CTD small phosphatase-like protei...  84.7    5e-17   Nicotiana sylvestris
ref|XP_010689631.1|  PREDICTED: CTD nuclear envelope phosphatase ...  81.3    2e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP44760.1|  hypothetical protein JCGZ_01260                       80.5    3e-15   Jatropha curcas
ref|XP_008351210.1|  PREDICTED: uncharacterized protein LOC103414622  77.8    8e-15   
ref|XP_009622999.1|  PREDICTED: CTD small phosphatase-like protein 2  78.6    1e-14   Nicotiana tomentosiformis
gb|KHG26951.1|  putative phosphatase PSR2                             78.6    1e-14   Gossypium arboreum [tree cotton]
ref|XP_009392189.1|  PREDICTED: CTD nuclear envelope phosphatase ...  78.2    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG26952.1|  ctdspl2                                               78.2    2e-14   Gossypium arboreum [tree cotton]
ref|NP_191155.1|  Haloacid dehalogenase-like hydrolase (HAD) supe...  76.6    6e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002309143.2|  hypothetical protein POPTR_0006s10170g           77.0    7e-14   Populus trichocarpa [western balsam poplar]
ref|XP_009416286.1|  PREDICTED: CTD nuclear envelope phosphatase ...  75.9    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002878054.1|  NLI interacting factor family protein            75.9    1e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_006403042.1|  hypothetical protein EUTSA_v10006119mg           74.7    4e-13   Eutrema salsugineum [saltwater cress]
gb|KJB78769.1|  hypothetical protein B456_013G018000                  73.9    5e-13   Gossypium raimondii
emb|CDX67629.1|  BnaA07g16690D                                        73.6    7e-13   
ref|XP_002312160.2|  NLI interacting factor family protein            73.6    7e-13   
emb|CAN74278.1|  hypothetical protein VITISV_004711                   74.7    8e-13   Vitis vinifera
ref|XP_011035940.1|  PREDICTED: CTD nuclear envelope phosphatase 1    72.4    2e-12   Populus euphratica
ref|XP_010922553.1|  PREDICTED: CTD small phosphatase-like protein 2  72.4    2e-12   Elaeis guineensis
ref|XP_006291562.1|  hypothetical protein CARUB_v10017717mg           72.4    2e-12   Capsella rubella
ref|XP_002315157.2|  NLI interacting factor family protein            71.6    3e-12   
ref|XP_011019110.1|  PREDICTED: carboxy-terminal domain RNA polym...  71.6    4e-12   Populus euphratica
ref|XP_007008963.1|  Haloacid dehalogenase-like hydrolase (HAD) s...  70.5    4e-12   
ref|XP_011019111.1|  PREDICTED: carboxy-terminal domain RNA polym...  71.6    5e-12   Populus euphratica
ref|XP_006378658.1|  hypothetical protein POPTR_0010s19580g           71.2    5e-12   Populus trichocarpa [western balsam poplar]
ref|XP_008805431.1|  PREDICTED: carboxy-terminal domain RNA polym...  71.2    6e-12   Phoenix dactylifera
ref|XP_008805436.1|  PREDICTED: carboxy-terminal domain RNA polym...  70.9    6e-12   Phoenix dactylifera
ref|XP_010504466.1|  PREDICTED: carboxy-terminal domain RNA polym...  70.9    7e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010516189.1|  PREDICTED: carboxy-terminal domain RNA polym...  70.9    7e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010535319.1|  PREDICTED: carboxy-terminal domain RNA polym...  70.9    8e-12   Tarenaya hassleriana [spider flower]
ref|XP_007008962.1|  Haloacid dehalogenase-like hydrolase (HAD) s...  70.1    2e-11   
ref|XP_010427400.1|  PREDICTED: carboxy-terminal domain RNA polym...  69.7    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009103976.1|  PREDICTED: CTD small phosphatase-like protein    69.7    2e-11   Brassica rapa
ref|XP_009344958.1|  PREDICTED: carboxy-terminal domain RNA polym...  69.3    3e-11   Pyrus x bretschneideri [bai li]
ref|XP_009116289.1|  PREDICTED: CTD small phosphatase-like protei...  68.6    4e-11   Brassica rapa
ref|XP_009116288.1|  PREDICTED: CTD small phosphatase-like protei...  68.6    5e-11   Brassica rapa
ref|XP_011046823.1|  PREDICTED: CTD nuclear envelope phosphatase ...  68.6    5e-11   Populus euphratica
gb|KFK34835.1|  hypothetical protein AALP_AA5G199300                  68.6    5e-11   Arabis alpina [alpine rockcress]
ref|XP_008374036.1|  PREDICTED: CTD small phosphatase-like protein    68.6    6e-11   Malus domestica [apple tree]
ref|XP_007218742.1|  hypothetical protein PRUPE_ppa009189mg           68.2    8e-11   Prunus persica
gb|KDO68955.1|  hypothetical protein CISIN_1g022258mg                 67.4    9e-11   Citrus sinensis [apfelsine]
ref|XP_008388217.1|  PREDICTED: uncharacterized protein LOC103450630  66.6    1e-10   
gb|KJB74329.1|  hypothetical protein B456_011G288400                  66.6    1e-10   Gossypium raimondii
emb|CDY27252.1|  BnaA09g35500D                                        67.0    1e-10   Brassica napus [oilseed rape]
ref|XP_009369172.1|  PREDICTED: probable C-terminal domain small ...  67.4    1e-10   Pyrus x bretschneideri [bai li]
gb|KDO68954.1|  hypothetical protein CISIN_1g022258mg                 66.6    2e-10   Citrus sinensis [apfelsine]
emb|CDX72186.1|  BnaC08g26880D                                        66.6    2e-10   
gb|KDO68952.1|  hypothetical protein CISIN_1g022258mg                 66.6    2e-10   Citrus sinensis [apfelsine]
ref|XP_006435743.1|  hypothetical protein CICLE_v10031856mg           67.0    3e-10   Citrus clementina [clementine]
ref|NP_001148462.1|  LOC100282077                                     66.2    4e-10   Zea mays [maize]
gb|KJB74328.1|  hypothetical protein B456_011G288400                  65.9    5e-10   Gossypium raimondii
gb|KJB74327.1|  hypothetical protein B456_011G288400                  65.9    5e-10   Gossypium raimondii
ref|XP_008793248.1|  PREDICTED: carboxy-terminal domain RNA polym...  65.5    6e-10   Phoenix dactylifera
ref|XP_008345306.1|  PREDICTED: probable C-terminal domain small ...  65.5    7e-10   Malus domestica [apple tree]
ref|XP_008463241.1|  PREDICTED: carboxy-terminal domain RNA polym...  65.1    8e-10   Cucumis melo [Oriental melon]
ref|XP_003616639.1|  CTD small phosphatase-like protein               65.1    8e-10   Medicago truncatula
emb|CDY46516.1|  BnaC06g15690D                                        64.3    2e-09   Brassica napus [oilseed rape]
ref|XP_010517421.1|  PREDICTED: CTD nuclear envelope phosphatase ...  63.5    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010920860.1|  PREDICTED: carboxy-terminal domain RNA polym...  63.5    3e-09   
ref|XP_004491033.1|  PREDICTED: CTD small phosphatase-like protei...  63.5    3e-09   Cicer arietinum [garbanzo]
ref|XP_004149232.1|  PREDICTED: CTD small phosphatase-like protei...  63.2    4e-09   Cucumis sativus [cucumbers]
ref|XP_010517419.1|  PREDICTED: CTD nuclear envelope phosphatase ...  63.2    5e-09   
ref|XP_010517420.1|  PREDICTED: CTD nuclear envelope phosphatase ...  63.2    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_003564541.1|  PREDICTED: CTD small phosphatase-like protein    63.2    5e-09   Brachypodium distachyon [annual false brome]
ref|XP_010517411.1|  PREDICTED: CTD nuclear envelope phosphatase ...  63.2    6e-09   
ref|XP_010505730.1|  PREDICTED: CTD small phosphatase-like protei...  62.8    6e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010505722.1|  PREDICTED: CTD small phosphatase-like protei...  63.2    6e-09   
ref|XP_010505729.1|  PREDICTED: CTD small phosphatase-like protei...  62.8    6e-09   
ref|XP_010517418.1|  PREDICTED: CTD nuclear envelope phosphatase ...  63.2    7e-09   
ref|XP_010505726.1|  PREDICTED: CTD small phosphatase-like protei...  62.8    8e-09   
ref|XP_006411263.1|  hypothetical protein EUTSA_v10016941mg           62.4    9e-09   Eutrema salsugineum [saltwater cress]
ref|XP_002533382.1|  conserved hypothetical protein                   61.6    1e-08   
gb|KDO56646.1|  hypothetical protein CISIN_1g020937mg                 60.8    1e-08   Citrus sinensis [apfelsine]
ref|XP_004970462.1|  PREDICTED: CTD small phosphatase-like protei...  62.0    1e-08   Setaria italica
ref|XP_009141872.1|  PREDICTED: carboxy-terminal domain RNA polym...  61.2    2e-08   Brassica rapa
ref|XP_008672265.1|  PREDICTED: uncharacterized protein LOC100216...  61.2    3e-08   Zea mays [maize]
ref|NP_001136647.1|  uncharacterized protein LOC100216776             60.8    4e-08   Zea mays [maize]
ref|XP_010508910.1|  PREDICTED: probable C-terminal domain small ...  60.5    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010534600.1|  PREDICTED: CTD small phosphatase-like protein    60.5    5e-08   Tarenaya hassleriana [spider flower]
gb|ACG32959.1|  CTD small phosphatase-like protein                    60.5    5e-08   Zea mays [maize]
emb|CDY07060.1|  BnaA04g22550D                                        60.1    5e-08   
ref|XP_002458718.1|  hypothetical protein SORBIDRAFT_03g038910        60.1    6e-08   Sorghum bicolor [broomcorn]
ref|XP_010508909.1|  PREDICTED: CTD small phosphatase-like protei...  60.5    7e-08   
emb|CDX93216.1|  BnaC04g46800D                                        59.7    7e-08   
gb|KDO56645.1|  hypothetical protein CISIN_1g020937mg                 59.7    8e-08   Citrus sinensis [apfelsine]
ref|XP_009406928.1|  PREDICTED: CTD nuclear envelope phosphatase ...  59.7    8e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001242244.1|  uncharacterized protein LOC100783451             58.9    2e-07   Glycine max [soybeans]
gb|KDP24445.1|  hypothetical protein JCGZ_25009                       58.9    2e-07   Jatropha curcas
gb|EEC71746.1|  hypothetical protein OsI_04315                        57.0    6e-07   Oryza sativa Indica Group [Indian rice]
ref|NP_001044710.1|  Os01g0833100                                     57.0    6e-07   
ref|XP_006294651.1|  hypothetical protein CARUB_v10023688mg           56.2    1e-06   
gb|EMT13698.1|  CTD small phosphatase-like protein 2                  56.2    1e-06   
emb|CDM84840.1|  unnamed protein product                              56.2    1e-06   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ91589.1|  predicted protein                                    55.8    2e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006294652.1|  hypothetical protein CARUB_v10023688mg           55.8    2e-06   
gb|KHN48568.1|  CTD small phosphatase-like protein 2                  55.5    2e-06   Glycine soja [wild soybean]
ref|XP_006429395.1|  hypothetical protein CICLE_v10012210mg           55.5    2e-06   Citrus clementina [clementine]
ref|XP_006481044.1|  PREDICTED: CTD small phosphatase-like protei...  55.5    3e-06   Citrus sinensis [apfelsine]
gb|KHN20843.1|  CTD small phosphatase-like protein 2                  55.5    3e-06   Glycine soja [wild soybean]
gb|KFK23193.1|  hypothetical protein AALP_AAs48948U000100             53.5    1e-05   Arabis alpina [alpine rockcress]
ref|XP_010101420.1|  CTD small phosphatase-like protein               52.8    2e-05   Morus notabilis
ref|XP_003545230.1|  PREDICTED: LOW QUALITY PROTEIN: carboxy-term...  53.1    2e-05   
ref|XP_011019112.1|  PREDICTED: CTD small phosphatase-like protei...  52.0    3e-05   Populus euphratica
ref|XP_010231274.1|  PREDICTED: uncharacterized protein LOC100829084  50.8    7e-05   Brachypodium distachyon [annual false brome]
ref|XP_006646453.1|  PREDICTED: CTD small phosphatase-like protei...  50.8    7e-05   
ref|XP_004307664.1|  PREDICTED: CTD nuclear envelope phosphatase ...  50.8    9e-05   Fragaria vesca subsp. vesca
ref|XP_010095242.1|  hypothetical protein L484_008252                 48.1    2e-04   
ref|XP_002893405.1|  predicted protein                                47.8    5e-04   
ref|XP_009385548.1|  PREDICTED: carboxy-terminal domain RNA polym...  48.5    6e-04   Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_006338842.1| PREDICTED: CTD small phosphatase-like protein 2-like [Solanum 
tuberosum]
Length=313

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            ELA+AA VYAP+TL  WR+LLNW   F+QIFVQ VRG+PS +QVLSYVG RNTSFLSS  
Sbjct  3    ELAQAADVYAPRTLPAWRSLLNWLLFFFQIFVQIVRGTPSLSQVLSYVGLRNTSFLSS-T  61

Query  246  PQFRPLPVVEL-EDNDDsppssalpslQIAAG-CPDEHHLPRltvvldldetlvCAYETS  419
            PQF+PLP+VEL E  +       + +LQIAAG  PD +   RLTVVLDLDETLVCAYETS
Sbjct  62   PQFKPLPIVELPESQEPPHQPLTVSTLQIAAGRVPDANGEQRLTVVLDLDETLVCAYETS  121

Query  420  TLPSIIHTQAIEAGL  464
            +LP+I+ TQA EAGL
Sbjct  122  SLPNIVRTQATEAGL  136



>ref|XP_004240939.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Solanum 
lycopersicum]
Length=306

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 101/133 (76%), Gaps = 6/133 (5%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            ELA+AA VYAP+TL  WR+LLNW   F+QIFVQ VRG+PS  Q+LSYVG RNTSFLSS  
Sbjct  3    ELAQAAGVYAPRTLPAWRSLLNWLLFFFQIFVQIVRGTPSLTQLLSYVGLRNTSFLSS-T  61

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
            P F+PLP+VEL ++        + +LQIAAG   E    RLTVVLDLDETLVCAYETS+L
Sbjct  62   PHFKPLPIVELPESHQ--TPLTVSTLQIAAGTNGEQ---RLTVVLDLDETLVCAYETSSL  116

Query  426  PSIIHTQAIEAGL  464
            P+I+ TQA EAGL
Sbjct  117  PNIVRTQATEAGL  129



>ref|XP_009760937.1| PREDICTED: nuclear envelope morphology protein 1 isoform X2 [Nicotiana 
sylvestris]
Length=264

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 106/146 (73%), Gaps = 13/146 (9%)
 Frame = +3

Query  66   ELAKAA-KVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSP  242
            ELA+AA  VYAP++L  WR+LL+W A F QIFVQ VRG+PS +QVLSYVG RN+S   S 
Sbjct  3    ELAQAAADVYAPRSLPAWRSLLSWLAFFIQIFVQIVRGTPSLSQVLSYVGLRNSSSFLSS  62

Query  243  PPQFRPLPVVELEDND--------DsppssalpslQIAAG-CPD---EHHLPRltvvldl  386
             PQF+PLPVVEL D+            PS A+ +LQI AG  PD   + HL RLTVVLDL
Sbjct  63   TPQFKPLPVVELPDSQLPEEAPPPPQQPSVAVSTLQIDAGRVPDGNGDQHLRRLTVVLDL  122

Query  387  detlvCAYETSTLPSIIHTQAIEAGL  464
            DETLVCAYETS+LP+I+ TQA EAGL
Sbjct  123  DETLVCAYETSSLPNIVRTQAAEAGL  148



>emb|CDP14017.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            ELA++A VYAPKT+Q+WR LLNW A F+QIFVQ +RG+PS  QVLSYVG R++S LSS  
Sbjct  3    ELAQSADVYAPKTIQVWRALLNWLAFFFQIFVQIIRGTPSLTQVLSYVGLRHSSLLSSSS  62

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
            PQF+PLPVVEL++ +  PP  +      +    D   L +LTVVLDLDETLVCAYETS+L
Sbjct  63   PQFKPLPVVELQEPEHPPPPLSSAVQITSGATSDGGLLDKLTVVLDLDETLVCAYETSSL  122

Query  426  PSIIHTQAIEAGL  464
            PS+I +QA EAGL
Sbjct  123  PSMIRSQATEAGL  135



>ref|XP_009760936.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Nicotiana sylvestris]
Length=324

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 106/146 (73%), Gaps = 13/146 (9%)
 Frame = +3

Query  66   ELAKAA-KVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSP  242
            ELA+AA  VYAP++L  WR+LL+W A F QIFVQ VRG+PS +QVLSYVG RN+S   S 
Sbjct  3    ELAQAAADVYAPRSLPAWRSLLSWLAFFIQIFVQIVRGTPSLSQVLSYVGLRNSSSFLSS  62

Query  243  PPQFRPLPVVELEDND--------DsppssalpslQIAAG-CPD---EHHLPRltvvldl  386
             PQF+PLPVVEL D+            PS A+ +LQI AG  PD   + HL RLTVVLDL
Sbjct  63   TPQFKPLPVVELPDSQLPEEAPPPPQQPSVAVSTLQIDAGRVPDGNGDQHLRRLTVVLDL  122

Query  387  detlvCAYETSTLPSIIHTQAIEAGL  464
            DETLVCAYETS+LP+I+ TQA EAGL
Sbjct  123  DETLVCAYETSSLPNIVRTQAAEAGL  148



>ref|XP_009610469.1| PREDICTED: nuclear envelope morphology protein 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=264

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 104/146 (71%), Gaps = 13/146 (9%)
 Frame = +3

Query  66   ELAKAA-KVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSP  242
            ELA+AA  VYAP++L  WR+LL+W A F QIFVQ VRG+PS +QVLSYVG RN+S   S 
Sbjct  3    ELAQAAADVYAPRSLPAWRSLLSWLAFFIQIFVQIVRGTPSLSQVLSYVGLRNSSSFLSS  62

Query  243  PPQFRPLPVVELEDND--------DsppssalpslQIAAG----CPDEHHLPRltvvldl  386
             PQF+PLPVVEL ++            PS A+ +LQI AG       + HL RLTVVLDL
Sbjct  63   TPQFKPLPVVELPESQLPEEAPPPPQQPSVAVSTLQIDAGRVRDGNGDQHLRRLTVVLDL  122

Query  387  detlvCAYETSTLPSIIHTQAIEAGL  464
            DETLVCAYETS+LP+I+ TQA EAGL
Sbjct  123  DETLVCAYETSSLPNIVRTQATEAGL  148



>ref|XP_009610468.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Nicotiana tomentosiformis]
Length=325

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 104/146 (71%), Gaps = 13/146 (9%)
 Frame = +3

Query  66   ELAKAA-KVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSP  242
            ELA+AA  VYAP++L  WR+LL+W A F QIFVQ VRG+PS +QVLSYVG RN+S   S 
Sbjct  3    ELAQAAADVYAPRSLPAWRSLLSWLAFFIQIFVQIVRGTPSLSQVLSYVGLRNSSSFLSS  62

Query  243  PPQFRPLPVVELEDND--------DsppssalpslQIAAG----CPDEHHLPRltvvldl  386
             PQF+PLPVVEL ++            PS A+ +LQI AG       + HL RLTVVLDL
Sbjct  63   TPQFKPLPVVELPESQLPEEAPPPPQQPSVAVSTLQIDAGRVRDGNGDQHLRRLTVVLDL  122

Query  387  detlvCAYETSTLPSIIHTQAIEAGL  464
            DETLVCAYETS+LP+I+ TQA EAGL
Sbjct  123  DETLVCAYETSSLPNIVRTQATEAGL  148



>ref|XP_011084905.1| PREDICTED: LOW QUALITY PROTEIN: CTD nuclear envelope phosphatase 
1 homolog [Sesamum indicum]
Length=307

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 93/128 (73%), Gaps = 4/128 (3%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRP  260
            A+VYAP+T+Q+WRTLLNW A  +QIF Q +RG+PS  QVLSYVG R+ S LSS PPQF+ 
Sbjct  7    AQVYAPRTIQVWRTLLNWVAFVFQIFAQILRGTPSFTQVLSYVGLRHGSVLSSGPPQFKS  66

Query  261  LPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIH  440
            LPVVEL D   + P +      I    P    L +LTVVLDLDETLVCAYETS+LP+++ 
Sbjct  67   LPVVELHDXPAAAPVACGGGRVIGDSPP----LEKLTVVLDLDETLVCAYETSSLPALLR  122

Query  441  TQAIEAGL  464
            TQA EAGL
Sbjct  123  TQATEAGL  130



>ref|XP_004239942.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Solanum lycopersicum]
Length=318

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 103/140 (74%), Gaps = 8/140 (6%)
 Frame = +3

Query  66   ELAKAAKVYAP-KTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSP  242
            EL +AA+VYAP +TLQ+W++LLNW A F+QIFVQ ++G+P   QVLSY G RN+S LSS 
Sbjct  3    ELVQAAQVYAPTRTLQIWKSLLNWLAFFFQIFVQILKGTPCVTQVLSYFGVRNSSLLSS-  61

Query  243  PPQFRPLPVV--ELEDNDDsppssalpslQIAAG----CPDEHHLPRltvvldldetlvC  404
             PQF+PLP V    E+    P S AL +LQI  G      +E HL +LTVVLDLDETL+C
Sbjct  62   SPQFKPLPDVEPPEEEEAPPPSSVALSTLQITTGSVPISVEEEHLQKLTVVLDLDETLIC  121

Query  405  AYETSTLPSIIHTQAIEAGL  464
            AYETS+LP+II TQA EAGL
Sbjct  122  AYETSSLPTIICTQATEAGL  141



>gb|EYU20007.1| hypothetical protein MIMGU_mgv1a010325mg [Erythranthe guttata]
Length=316

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 102/140 (73%), Gaps = 8/140 (6%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            ELA AA++YAP+T+Q+WRTLLNW A F+QIF Q +RG+PS  Q+ SYVG  + S LSS P
Sbjct  3    ELA-AAEMYAPRTIQVWRTLLNWMAFFFQIFAQILRGTPSFGQIFSYVGLGHGSLLSSAP  61

Query  246  PQFRPLPVVEL----EDNDDsppssalpslQIAAGCPDEHHLP---RltvvldldetlvC  404
             QF+PL VVEL    E+++++P      S+ +A G     + P   +LTVVLDLDETLVC
Sbjct  62   TQFKPLAVVELSDFAEEHEEAPTGPNPASVPVAGGGERTINSPPFEKLTVVLDLDETLVC  121

Query  405  AYETSTLPSIIHTQAIEAGL  464
            AYETS+LP+++ +QA EAG+
Sbjct  122  AYETSSLPAMLRSQATEAGI  141



>ref|XP_002273682.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Vitis vinifera]
 emb|CBI25474.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   110 bits (275),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 93/131 (71%), Gaps = 5/131 (4%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRP  260
            A+VYAP++LQLWRTLLNW A F+QIF+Q +RG+PS  QVLSYVG R+ S L S  P F+P
Sbjct  15   AEVYAPRSLQLWRTLLNWLAFFFQIFLQILRGTPSVTQVLSYVGLRHHSLLPS-SPSFKP  73

Query  261  LPVVELEDND---DsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPS  431
            LPVVEL + +   DS   +A      AA   D     + TVVLDLDETLVCAYETS+LP+
Sbjct  74   LPVVELPELEPPPDSVQINATDGTDSAAAAVD-RPAEKFTVVLDLDETLVCAYETSSLPA  132

Query  432  IIHTQAIEAGL  464
             I  QAIE+GL
Sbjct  133  SIRNQAIESGL  143



>ref|XP_011076695.1| PREDICTED: CTD small phosphatase-like protein [Sesamum indicum]
Length=382

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 97/139 (70%), Gaps = 7/139 (5%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            ELA AA+VYAP+T+Q+WRTLLNW A F+QIF Q +RG+PS  QVLSYVG R  S LS+ P
Sbjct  71   ELA-AAEVYAPRTIQVWRTLLNWMAFFFQIFAQILRGTPSFNQVLSYVGIRPGSLLSTAP  129

Query  246  --PQFRPLPVVELEDNDDsppssalpslQI----AAGCPDEHHLPRltvvldldetlvCA  407
              PQF+PL VVEL +    P  +  P+            D   L +LTVVLDLDETLVCA
Sbjct  130  HAPQFKPLSVVELTEFSAEPEEAPPPAAVPVSVGGGKMVDSPPLEKLTVVLDLDETLVCA  189

Query  408  YETSTLPSIIHTQAIEAGL  464
            YETS+LP+++ TQA EAG+
Sbjct  190  YETSSLPAMLRTQATEAGI  208



>ref|XP_006355653.1| PREDICTED: CTD small phosphatase-like protein 2-like [Solanum 
tuberosum]
Length=317

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 95/138 (69%), Gaps = 5/138 (4%)
 Frame = +3

Query  66   ELAKAAKVYAP-KTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSP  242
            EL +AA+VYAP +TLQ+W++LLNW A F+QIFVQ ++G+P   QVLSY G RN+S LSS 
Sbjct  3    ELVQAAQVYAPTRTLQIWKSLLNWLAFFFQIFVQILKGTPCVTQVLSYFGVRNSSLLSSS  62

Query  243  PPQFRPLPVVELEDNDDsppssalpslQIAAG----CPDEHHLPRltvvldldetlvCAY  410
            P       V   E+      S AL +LQI  G      +E  L +LTVVLDLDETL+CAY
Sbjct  63   PQFKPLPDVEPPEEEAPPTSSVALSTLQITTGSVPISVEEERLQKLTVVLDLDETLICAY  122

Query  411  ETSTLPSIIHTQAIEAGL  464
            ETS+LP+II TQA EAGL
Sbjct  123  ETSSLPTIICTQATEAGL  140



>ref|XP_010264631.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Nelumbo 
nucifera]
Length=309

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 94/136 (69%), Gaps = 7/136 (5%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRN---TSFLS  236
            ELA+A  VYAP+ LQ+WRTLLNW A F+QIF+Q +RG+PS AQVLS++G R+    S  S
Sbjct  3    ELAQA-DVYAPRPLQVWRTLLNWLAFFFQIFLQILRGTPSMAQVLSFIGLRHPLLASSSS  61

Query  237  SPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
            S    F+PLPVVEL   D     S + S   +     +  + +LTVVLDLDETLVCAYET
Sbjct  62   SSSASFKPLPVVELPHQDLPSVPSHITSYDDSDL---DQRIEKLTVVLDLDETLVCAYET  118

Query  417  STLPSIIHTQAIEAGL  464
             +LP+I+  QAIEAGL
Sbjct  119  FSLPAIVRNQAIEAGL  134



>ref|XP_008243657.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Prunus mume]
Length=297

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 85/133 (64%), Gaps = 15/133 (11%)
 Frame = +3

Query  69   LAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPP  248
            + +AA+VY P+++QLWR  +NW   ++QI +Q +R +P   Q+LS++G           P
Sbjct  4    IGQAAEVYVPRSIQLWRAFINWMGFYFQILLQILRDTPCVPQLLSFIG--------PSSP  55

Query  249  QFRPLPVVELEDNDDsppssalpslQIAAGCPDEH-HLPRltvvldldetlvCAYETSTL  425
             FRPLPVVEL  ND           Q+  G  + H H+ +LTVVLDLDETLVCAYET TL
Sbjct  56   SFRPLPVVELPLND------LSSPAQVENGVINGHRHIEKLTVVLDLDETLVCAYETCTL  109

Query  426  PSIIHTQAIEAGL  464
            P+I+ TQA EAGL
Sbjct  110  PAIVRTQATEAGL  122



>ref|XP_004302575.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=295

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 87/129 (67%), Gaps = 13/129 (10%)
 Frame = +3

Query  78   AAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFR  257
            AA+VY PK +QLWR L+NW + F+QI    +RG+P  A +LSYV       L + PP FR
Sbjct  8    AAEVYEPKLIQLWRALVNWLSFFFQI----LRGAPCLAHLLSYVP------LLASPPSFR  57

Query  258  PLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSII  437
            PLPV E+  ND S  +       + +   D+H LP+LTVVLDLDETLVCAYETS++P+I+
Sbjct  58   PLPVAEIPLNDSSSSAHVNLENGVVS---DDHPLPKLTVVLDLDETLVCAYETSSVPAIV  114

Query  438  HTQAIEAGL  464
             TQA +AGL
Sbjct  115  RTQATDAGL  123



>ref|XP_007205648.1| hypothetical protein PRUPE_ppa009333mg [Prunus persica]
 gb|EMJ06847.1| hypothetical protein PRUPE_ppa009333mg [Prunus persica]
Length=297

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 83/133 (62%), Gaps = 15/133 (11%)
 Frame = +3

Query  69   LAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPP  248
            + +AA+VY P+++QLWR  +NW   ++QI +Q +R +P    +LS++G           P
Sbjct  4    IGQAAEVYVPRSIQLWRAFINWMGFYFQILLQILRDTPCVPHLLSFIG--------PSSP  55

Query  249  QFRPLPVVELEDNDDsppssalpslQIAAGCPDE-HHLPRltvvldldetlvCAYETSTL  425
             FRPLPVVEL  ND           Q+  G  +   H+ +LTVVLDLDETLVCAYET TL
Sbjct  56   SFRPLPVVELPLND------LSSPAQVENGVINGPRHIEKLTVVLDLDETLVCAYETCTL  109

Query  426  PSIIHTQAIEAGL  464
            P+I+ TQA EAGL
Sbjct  110  PAIVRTQATEAGL  122



>gb|EPS72976.1| hypothetical protein M569_01780, partial [Genlisea aurea]
Length=307

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 86/135 (64%), Gaps = 8/135 (6%)
 Frame = +3

Query  84   KVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFL--SSPPPQFR  257
            +V AP+T+QLW  +L+W    +QIF Q VR +PS  QVLSYVG R  SF+  S+P  QF+
Sbjct  1    EVDAPRTIQLWTMMLDWLGFLFQIFAQIVRSAPSIGQVLSYVGVRPVSFIPPSTPQVQFK  60

Query  258  PLPVVELEDNDDsp------pssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETS  419
            P+PVVE+E+  D          S++PS     G      L +L VVLDLDETLVCAYETS
Sbjct  61   PIPVVEIEEIGDLEPRSAPPRLSSVPSADQGKGGGVGAPLEKLMVVLDLDETLVCAYETS  120

Query  420  TLPSIIHTQAIEAGL  464
            +LP  +  QA EAG+
Sbjct  121  SLPDTLRNQATEAGI  135



>emb|CDP02804.1| unnamed protein product [Coffea canephora]
 emb|CDP01667.1| unnamed protein product [Coffea canephora]
Length=88

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            ELA++A VYAPKT+Q+WR LLNW A F+QIFVQ +RG+ S  QVLSYVG R++S LSS  
Sbjct  3    ELAQSADVYAPKTIQVWRALLNWLAFFFQIFVQIIRGTSSLTQVLSYVGLRHSSLLSSSS  62

Query  246  PQFRPL  263
            PQF+PL
Sbjct  63   PQFKPL  68



>ref|XP_009377758.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Pyrus x bretschneideri]
Length=297

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 81/131 (62%), Gaps = 13/131 (10%)
 Frame = +3

Query  72   AKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQ  251
            A AA+VY P TLQ+WR L+NW   F+QI +Q +RG+P    +LS +        SS PP 
Sbjct  8    AAAAEVYVPMTLQVWRGLVNWVGFFFQIILQILRGAPCLPHLLSCIS-------SSSPPA  60

Query  252  FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPS  431
            FRPLPV E+  ND         S  +  G  D   + +LTVVLDLDETLVCAYET ++P+
Sbjct  61   FRPLPVAEVPLND------LTSSAHVENGVVDGRPVEKLTVVLDLDETLVCAYETCSVPA  114

Query  432  IIHTQAIEAGL  464
            ++  QA EAGL
Sbjct  115  VVRAQATEAGL  125



>ref|XP_008442416.1| PREDICTED: CTD small phosphatase-like protein 2 [Cucumis melo]
 gb|ADN33794.1| hypothetical protein [Cucumis melo subsp. melo]
Length=301

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 81/127 (64%), Gaps = 2/127 (2%)
 Frame = +3

Query  84   KVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRPL  263
            +V AP++LQ+W+ L++W   F+ + VQ VRG+PS  Q+LSY+GFR    L S  P F+PL
Sbjct  8    EVCAPRSLQVWQALMDWLCFFFHVIVQIVRGAPSLPQILSYIGFR-FPLLPSSAPSFKPL  66

Query  264  PVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIHT  443
            P  EL  +             +  G   +  L ++TVVLDLDETLVCAYETS+LP++  T
Sbjct  67   PAAELPLH-QFSTKKISSLNDLDDGGGQDRPLEKITVVLDLDETLVCAYETSSLPAVFRT  125

Query  444  QAIEAGL  464
            QA EAGL
Sbjct  126  QATEAGL  132



>ref|XP_008370103.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X2 [Malus domestica]
Length=275

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 80/131 (61%), Gaps = 13/131 (10%)
 Frame = +3

Query  72   AKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQ  251
            A AA+VY P TLQ+WR L+NW   F+QI +Q +RG+P    +LS +        SS PP 
Sbjct  8    AAAAEVYVPMTLQVWRGLVNWVGFFFQIILQILRGAPCLPHLLSCIS-------SSSPPA  60

Query  252  FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPS  431
            FRPLPV E+  ND         S  +     D   + +LTVVLDLDETLVCAYET ++P+
Sbjct  61   FRPLPVAEVPLND------LSSSAHVEXXVVDGRPVEKLTVVLDLDETLVCAYETCSVPA  114

Query  432  IIHTQAIEAGL  464
            I+  QA EAGL
Sbjct  115  IVRAQATEAGL  125



>ref|XP_004137719.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 ref|XP_004168574.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 gb|KGN58757.1| hypothetical protein Csa_3G731190 [Cucumis sativus]
Length=301

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 81/127 (64%), Gaps = 2/127 (2%)
 Frame = +3

Query  84   KVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRPL  263
            +V AP++LQ+W+  ++W + F+ + VQ VRG+PS  Q+LSY+GFR    L S  P F+PL
Sbjct  8    EVCAPRSLQVWQAFMDWLSFFFHVIVQIVRGAPSLPQILSYIGFR-FPLLPSSAPSFKPL  66

Query  264  PVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIHT  443
            P  EL  +             +  G   +  L ++TVVLDLDETLVCAYETS+LP++  T
Sbjct  67   PAAELPLH-QFSTKKISSLSDLDDGGGQDRPLEKVTVVLDLDETLVCAYETSSLPAVFRT  125

Query  444  QAIEAGL  464
            QA EAGL
Sbjct  126  QATEAGL  132



>gb|KCW86105.1| hypothetical protein EUGRSUZ_B02803 [Eucalyptus grandis]
Length=238

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 90/147 (61%), Gaps = 19/147 (13%)
 Frame = +3

Query  78   AAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFL--------  233
            ++++Y P+++Q+WR L+NW A F Q+F+Q +RG+PS AQ LSY+G R  SFL        
Sbjct  13   SSEMYVPRSMQVWRGLMNWLAFFLQVFLQILRGTPSLAQFLSYIGLRQ-SFLSSSSAAAA  71

Query  234  -----SSPPPQFRPLPVVELEDNDDsppssalpslQIA-----AGCPDEHHLPRltvvld  383
                  +    F+PLPVVE+   D  P   A     ++         D   + +LT+VLD
Sbjct  72   VAAPSPAAVAAFKPLPVVEIPLQDSCPTVHAGSDSDVSITAADDDDDDLLAVEKLTIVLD  131

Query  384  ldetlvCAYETSTLPSIIHTQAIEAGL  464
            LDETLVCAYETS+LP +I +QAIEAGL
Sbjct  132  LDETLVCAYETSSLPEVIRSQAIEAGL  158



>ref|XP_008370102.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X1 [Malus domestica]
Length=297

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 80/131 (61%), Gaps = 13/131 (10%)
 Frame = +3

Query  72   AKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQ  251
            A AA+VY P TLQ+WR L+NW   F+QI +Q +RG+P    +LS +        SS PP 
Sbjct  8    AAAAEVYVPMTLQVWRGLVNWVGFFFQIILQILRGAPCLPHLLSCIS-------SSSPPA  60

Query  252  FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPS  431
            FRPLPV E+  ND         S  +     D   + +LTVVLDLDETLVCAYET ++P+
Sbjct  61   FRPLPVAEVPLND------LSSSAHVEXXVVDGRPVEKLTVVLDLDETLVCAYETCSVPA  114

Query  432  IIHTQAIEAGL  464
            I+  QA EAGL
Sbjct  115  IVRAQATEAGL  125



>ref|XP_006843565.1| hypothetical protein AMTR_s00007p00087260 [Amborella trichopoda]
 gb|ERN05240.1| hypothetical protein AMTR_s00007p00087260 [Amborella trichopoda]
Length=254

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 79/132 (60%), Gaps = 13/132 (10%)
 Frame = +3

Query  69   LAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPP  248
            L    +V +P++LQ+WR  LNW A F+QI +Q ++G+P+ AQ+  + G R      SPPP
Sbjct  3    LVAQGEVVSPRSLQIWRGFLNWLAFFFQILLQLLQGTPTLAQIFGFFGLRPALLCDSPPP  62

Query  249  QFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLP  428
             F+PLPV      ++               C +E    +LTVVLDLDETLVCAYETS+LP
Sbjct  63   -FKPLPVEPTLPEEEF------------PACAEEETFDKLTVVLDLDETLVCAYETSSLP  109

Query  429  SIIHTQAIEAGL  464
             ++  QA +AGL
Sbjct  110  IVVRNQATQAGL  121



>ref|XP_010044096.1| PREDICTED: CTD small phosphatase-like protein [Eucalyptus grandis]
 gb|KCW86104.1| hypothetical protein EUGRSUZ_B02803 [Eucalyptus grandis]
Length=333

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 90/147 (61%), Gaps = 19/147 (13%)
 Frame = +3

Query  78   AAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFL--------  233
            ++++Y P+++Q+WR L+NW A F Q+F+Q +RG+PS AQ LSY+G R  SFL        
Sbjct  13   SSEMYVPRSMQVWRGLMNWLAFFLQVFLQILRGTPSLAQFLSYIGLRQ-SFLSSSSAAAA  71

Query  234  -----SSPPPQFRPLPVVELEDNDDsppssalpslQIA-----AGCPDEHHLPRltvvld  383
                  +    F+PLPVVE+   D  P   A     ++         D   + +LT+VLD
Sbjct  72   VAAPSPAAVAAFKPLPVVEIPLQDSCPTVHAGSDSDVSITAADDDDDDLLAVEKLTIVLD  131

Query  384  ldetlvCAYETSTLPSIIHTQAIEAGL  464
            LDETLVCAYETS+LP +I +QAIEAGL
Sbjct  132  LDETLVCAYETSSLPEVIRSQAIEAGL  158



>ref|XP_002265560.1| PREDICTED: CTD small phosphatase-like protein [Vitis vinifera]
 emb|CBI22795.3| unnamed protein product [Vitis vinifera]
Length=322

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 86/145 (59%), Gaps = 18/145 (12%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRP  260
             +VY P+ LQ+WR ++NW   F QIF+Q  RG+PS  Q+LSY+G R+   L S    FRP
Sbjct  4    TQVYVPRPLQVWRAVVNWLGFFLQIFLQIFRGTPSLPQLLSYIGLRH-PLLPSSASSFRP  62

Query  261  LPVVELEDNDDsppssalpslQIAAGCPDEHH-----------------LPRltvvldld  389
            LPVVEL  +D SP   + P          EH                  L +LTVVLDLD
Sbjct  63   LPVVELSLHDSSPEPPSAPLSSPLPVRVVEHSPFGGGVGGDDDGGDDRPLEKLTVVLDLD  122

Query  390  etlvCAYETSTLPSIIHTQAIEAGL  464
            ETLVCAYETS+LP+ + TQAIEAGL
Sbjct  123  ETLVCAYETSSLPAHLRTQAIEAGL  147



>ref|XP_009346338.1| PREDICTED: uncharacterized protein LOC103938066 [Pyrus x bretschneideri]
Length=191

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 13/131 (10%)
 Frame = +3

Query  72   AKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQ  251
            A AA+VY P TLQ+WR L+NW   FYQI +Q +RG+P    +LS +   ++       P 
Sbjct  7    AAAAEVYVPMTLQVWRGLVNWVGFFYQIILQILRGAPCLRHLLSCISSSSS-------PA  59

Query  252  FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPS  431
            FRPLPV E+  ND         S  +  G  D   + +LTVVLDLDETLVCAYET ++P+
Sbjct  60   FRPLPVAEVPLND------LSSSAHVENGVLDGRPVEKLTVVLDLDETLVCAYETCSVPA  113

Query  432  IIHTQAIEAGL  464
            I+  QA EAG+
Sbjct  114  IVRAQATEAGM  124



>ref|XP_009805067.1| PREDICTED: CTD small phosphatase-like protein 2 isoform X2 [Nicotiana 
sylvestris]
Length=212

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 93/141 (66%), Gaps = 23/141 (16%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +A +VY P+T+QLW++LLNW A F+QIF+Q ++G              N+S LSS P
Sbjct  3    ELFQATQVYTPRTIQLWKSLLNWLAFFFQIFLQILKG--------------NSSLLSS-P  47

Query  246  PQFRPLPVVELEDNDDsp----pssalpslQIAAG----CPDEHHLPRltvvldldetlv  401
            PQF+PLP VEL + ++       S AL +LQI  G      +E    RLTVVLDLD+TL+
Sbjct  48   PQFKPLPDVELLEEEEEAEAAPSSVALSTLQITTGNVPTSLEEERSQRLTVVLDLDDTLI  107

Query  402  CAYETSTLPSIIHTQAIEAGL  464
            CAYETS++P+++ TQA EAGL
Sbjct  108  CAYETSSMPTMMRTQATEAGL  128



>ref|XP_009805066.1| PREDICTED: CTD small phosphatase-like protein 2 isoform X1 [Nicotiana 
sylvestris]
Length=226

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 93/141 (66%), Gaps = 23/141 (16%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +A +VY P+T+QLW++LLNW A F+QIF+Q ++G              N+S LSS P
Sbjct  3    ELFQATQVYTPRTIQLWKSLLNWLAFFFQIFLQILKG--------------NSSLLSS-P  47

Query  246  PQFRPLPVVELEDNDDsp----pssalpslQIAAG----CPDEHHLPRltvvldldetlv  401
            PQF+PLP VEL + ++       S AL +LQI  G      +E    RLTVVLDLD+TL+
Sbjct  48   PQFKPLPDVELLEEEEEAEAAPSSVALSTLQITTGNVPTSLEEERSQRLTVVLDLDDTLI  107

Query  402  CAYETSTLPSIIHTQAIEAGL  464
            CAYETS++P+++ TQA EAGL
Sbjct  108  CAYETSSMPTMMRTQATEAGL  128



>ref|XP_010689631.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=312

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 89/141 (63%), Gaps = 20/141 (14%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRN---TSFLSSPPPQ  251
             +VYAPK+ QL +T+LNW A  +QIFVQ V+G+PS AQV + +GF +   TSFLS P   
Sbjct  4    TEVYAPKSGQLLKTVLNWLAFLFQIFVQIVKGTPSMAQVFNSMGFSHGGQTSFLSPPSSS  63

Query  252  --FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHL--------PRltvvldldetlv  401
              F+PLPVVE+       P  +  +  +  G  D+  +         +LTVVLDLDETLV
Sbjct  64   PGFKPLPVVEI-------PLHSSSATAVDIGVDDDAEVGDSVVSPSDKLTVVLDLDETLV  116

Query  402  CAYETSTLPSIIHTQAIEAGL  464
            CAYETS+LP  + TQA EAGL
Sbjct  117  CAYETSSLPPALCTQATEAGL  137



>gb|KDP44760.1| hypothetical protein JCGZ_01260 [Jatropha curcas]
Length=297

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 84/136 (62%), Gaps = 19/136 (14%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL ++  VY+P++LQLW TL NW A F+QIF+Q VR           +G       SS  
Sbjct  3    ELTQSEVVYSPRSLQLWSTLWNWLAFFFQIFLQIVRA----------LGHLPLLSSSSSS  52

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAG---CPDEHHLPRltvvldldetlvCAYET  416
              F+PLPVVEL + D         +L+I AG    P +  + +LTVVLDLDETLVCAYET
Sbjct  53   QSFKPLPVVELPETDS------PATLEITAGPESSPVDEPIKKLTVVLDLDETLVCAYET  106

Query  417  STLPSIIHTQAIEAGL  464
            S+LP+I+  QAIEAGL
Sbjct  107  SSLPAILRNQAIEAGL  122



>ref|XP_008351210.1| PREDICTED: uncharacterized protein LOC103414622 [Malus domestica]
Length=161

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 14/131 (11%)
 Frame = +3

Query  72   AKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQ  251
            A AA+VY P TLQ WR ++NW   FYQI +Q +RG+P    +LS +   ++       P 
Sbjct  7    AAAAEVYVPMTLQAWR-VVNWVGFFYQIILQILRGAPCLPHLLSCISSSSS-------PA  58

Query  252  FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPS  431
            FRPLPV E+  ND         S  +  G  D   + +LTVVLDLDETLVCAYET ++P+
Sbjct  59   FRPLPVAEVPLND------LSSSAHVENGVLDGRPVEKLTVVLDLDETLVCAYETCSVPA  112

Query  432  IIHTQAIEAGL  464
            I+  +A EAG+
Sbjct  113  IVRARATEAGM  123



>ref|XP_009622999.1| PREDICTED: CTD small phosphatase-like protein 2 [Nicotiana tomentosiformis]
Length=304

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 91/142 (64%), Gaps = 24/142 (17%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +A +VY P+T+QLW++LLNW A F+QIF+Q ++G              N+S LSS  
Sbjct  3    ELVQATQVYTPRTIQLWKSLLNWLAFFFQIFLQILKG--------------NSSLLSS-S  47

Query  246  PQFRPLPVVELEDNDDsp-----pssalpslQIAA-GCP---DEHHLPRltvvldldetl  398
            PQF+PLP VEL + ++        S AL +LQI     P    E    RLTVVLDLD+TL
Sbjct  48   PQFKPLPDVELLEEEEEEEALPPSSVALSTLQITTESVPISLQEERSQRLTVVLDLDDTL  107

Query  399  vCAYETSTLPSIIHTQAIEAGL  464
            VCAYETS++P+I+ TQA EAGL
Sbjct  108  VCAYETSSMPTIMRTQATEAGL  129



>gb|KHG26951.1| putative phosphatase PSR2 [Gossypium arboreum]
Length=307

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 86/130 (66%), Gaps = 11/130 (8%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRP  260
            A+VY+P++LQ+WR LLNW A FYQIF Q +R   +  Q        ++S  S+   +F+P
Sbjct  7    AEVYSPRSLQVWRALLNWLAFFYQIFAQIIR---AVGQYPLLSSSSSSSITSTSTHRFKP  63

Query  261  LPVVELEDNDDsppssalpslQIAA--GCPDEHHLPRltvvldldetlvCAYETSTLPSI  434
            LPVV      DS  + +  +++IAA    PDE  + +LTVVLDLDETLVCAYETS+LP  
Sbjct  64   LPVV------DSTRTESPATVEIAAVLDSPDEDRIEKLTVVLDLDETLVCAYETSSLPPS  117

Query  435  IHTQAIEAGL  464
            +H QA++AGL
Sbjct  118  LHNQAMDAGL  127



>ref|XP_009392189.1| PREDICTED: CTD nuclear envelope phosphatase 1-like [Musa acuminata 
subsp. malaccensis]
Length=308

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = +3

Query  72   AKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFL--SSPP  245
              AA     K++QLWRTL++W A  + + +Q  R +PS AQ++S+VG R       SS  
Sbjct  13   GSAATTKTTKSVQLWRTLVSWVAVLFHVLLQIPRRTPSWAQLVSFVGLRQNLLFSPSSAS  72

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
            P ++PL V    D        A P  Q A   P    L +LT+VLDLDETLVCAYETS+L
Sbjct  73   PDYKPLAVDPPTD--------APPPNQFAGPEP----LKKLTIVLDLDETLVCAYETSSL  120

Query  426  PSIIHTQAIEAGL  464
            PS +HTQAIEAGL
Sbjct  121  PSTVHTQAIEAGL  133



>gb|KHG26952.1| ctdspl2 [Gossypium arboreum]
Length=302

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 86/130 (66%), Gaps = 11/130 (8%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRP  260
            A+VY+P++LQ+WR LLNW A FYQIF Q +R   +  Q        ++S  S+   +F+P
Sbjct  7    AEVYSPRSLQVWRALLNWLAFFYQIFAQIIR---AVGQYPLLSSSSSSSITSTSTHRFKP  63

Query  261  LPVVELEDNDDsppssalpslQIAA--GCPDEHHLPRltvvldldetlvCAYETSTLPSI  434
            LPVV      DS  + +  +++IAA    PDE  + +LTVVLDLDETLVCAYETS+LP  
Sbjct  64   LPVV------DSTRTESPATVEIAAVLDSPDEDRIEKLTVVLDLDETLVCAYETSSLPPS  117

Query  435  IHTQAIEAGL  464
            +H QA++AGL
Sbjct  118  LHNQAMDAGL  127



>ref|NP_191155.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
[Arabidopsis thaliana]
 emb|CAB87850.1| putative protein [Arabidopsis thaliana]
 gb|AAM20657.1| putative protein [Arabidopsis thaliana]
 gb|AAM61626.1| unknown [Arabidopsis thaliana]
 gb|AAN15623.1| putative protein [Arabidopsis thaliana]
 gb|AEE79461.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
[Arabidopsis thaliana]
Length=305

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 83/138 (60%), Gaps = 15/138 (11%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRN--TSFLSS  239
            EL +A  VY+P++ Q+W+TL+NW A FYQIF+Q +R           VG+    +S   +
Sbjct  3    ELTQADVVYSPRSFQVWKTLVNWLAFFYQIFLQILRA----------VGYHPLLSSSAKA  52

Query  240  PPPQFRPLPVVELEDN-DDsppssalpslQIAAGCPD--EHHLPRltvvldldetlvCAY  410
                F+PLP +EL D   +SP +  + +   +  C D       RL VVLDLDETLVCAY
Sbjct  53   SADGFKPLPAIELLDRASESPTTVEIAATTTSDSCSDGARSRFQRLKVVLDLDETLVCAY  112

Query  411  ETSTLPSIIHTQAIEAGL  464
            ETS+LP+ +  QAIEAGL
Sbjct  113  ETSSLPAALRNQAIEAGL  130



>ref|XP_002309143.2| hypothetical protein POPTR_0006s10170g [Populus trichocarpa]
 gb|EEE92666.2| hypothetical protein POPTR_0006s10170g [Populus trichocarpa]
Length=325

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 84/128 (66%), Gaps = 10/128 (8%)
 Frame = +3

Query  108  QLWRTLLNWAAAFYQIFVQNVRGSPSAAQ-VLSYVGFRNTSFLSSPPPQFRPLPVVEL--  278
            ++W+ ++N      ++F+Q +RG+PS AQ +LSY+GF     LSS PP F+PLPVVE+  
Sbjct  24   EVWKGMMNGLGFVMKLFLQILRGTPSMAQFLLSYIGF-TFPLLSSSPPSFKPLPVVEIPL  82

Query  279  ------EDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIH  440
                  +  D +  SS LP      G  D+  + +LTVVLDLDETL+CAYE S+LP+II 
Sbjct  83   QETTSNKITDKAHDSSCLPGYVCDFGASDDCLIEKLTVVLDLDETLICAYEASSLPAIIR  142

Query  441  TQAIEAGL  464
            TQA+EAG+
Sbjct  143  TQAVEAGV  150



>ref|XP_009416286.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Musa acuminata 
subsp. malaccensis]
Length=310

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 76/124 (61%), Gaps = 14/124 (11%)
 Frame = +3

Query  99   KTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFL--SSPPPQFRPLPVV  272
            K++Q WR L+NW A  +++ +Q  RG+PS AQ+LS+VG R+T     S+  P ++PL + 
Sbjct  24   KSVQAWRALVNWVAILFRLLLQIPRGTPSWAQILSFVGLRHTLLFSPSTASPAYKPLAID  83

Query  273  ELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIHTQAI  452
               D                   P    L +LTVVLDLDETLVCAYETS+LPS +H+QAI
Sbjct  84   PPIDG------------PTPDTAPAPEPLGKLTVVLDLDETLVCAYETSSLPSTVHSQAI  131

Query  453  EAGL  464
            EAG+
Sbjct  132  EAGV  135



>ref|XP_002878054.1| NLI interacting factor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54313.1| NLI interacting factor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 80/137 (58%), Gaps = 14/137 (10%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRN--TSFLSS  239
            EL +A  VY+P++ Q+W+TL+NW A FYQIF+Q +R           VG+    +S   +
Sbjct  3    ELTQADVVYSPRSFQVWKTLVNWLAFFYQIFLQILRA----------VGYHPLLSSSAKA  52

Query  240  PPPQFRPLPVVELEDNDDsppssalpslQIAAGCPD--EHHLPRltvvldldetlvCAYE  413
                F+PLP +EL D     P++   +    +   D       RL VVLDLDETLVCAYE
Sbjct  53   SADGFKPLPAIELLDRASESPTTVDIASTTTSDSSDCERSRFHRLKVVLDLDETLVCAYE  112

Query  414  TSTLPSIIHTQAIEAGL  464
            TS+LP+ +  QAIEAGL
Sbjct  113  TSSLPAALRNQAIEAGL  129



>ref|XP_006403042.1| hypothetical protein EUTSA_v10006119mg [Eutrema salsugineum]
 gb|ESQ44495.1| hypothetical protein EUTSA_v10006119mg [Eutrema salsugineum]
Length=305

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 83/140 (59%), Gaps = 19/140 (14%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRN--TSFLSS  239
            EL +A  VY+P++LQ+W+TL+NW A FYQIF+Q +R           VG+    +S   +
Sbjct  3    ELTQADVVYSPRSLQVWKTLVNWLAFFYQIFLQILRA----------VGYHPLLSSSAKA  52

Query  240  PPPQFRPLPVVELEDNDDsppssalpslQIAAGCP-----DEHHLPRltvvldldetlvC  404
                F+PLP +EL D   +  S     L+IA+        +     RL VVLDLDETLVC
Sbjct  53   SADGFKPLPAIELLDR--AVESPTTVELEIASSTTSCAQGERSRFQRLKVVLDLDETLVC  110

Query  405  AYETSTLPSIIHTQAIEAGL  464
            AYETS+LP+ +  QAI+AGL
Sbjct  111  AYETSSLPAALRNQAIDAGL  130



>gb|KJB78769.1| hypothetical protein B456_013G018000 [Gossypium raimondii]
Length=302

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 84/130 (65%), Gaps = 11/130 (8%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRP  260
            A+VY+P++LQ+WR LLNW A FYQIF Q +R   +  Q        ++S  S+   +F+P
Sbjct  7    AEVYSPRSLQVWRALLNWLAFFYQIFAQIIR---AVGQYPLLSSSSSSSITSTSTHRFKP  63

Query  261  LPVVELEDNDDsppssalpslQIAA--GCPDEHHLPRltvvldldetlvCAYETSTLPSI  434
            LPV       DS  + +  +++IAA    PDE  + +LTVVLDLDETLVCAYETS+LP  
Sbjct  64   LPVA------DSTRTESRATVEIAAVLDSPDEDRIEKLTVVLDLDETLVCAYETSSLPPS  117

Query  435  IHTQAIEAGL  464
            +  QA++AGL
Sbjct  118  LRNQAMDAGL  127



>emb|CDX67629.1| BnaA07g16690D [Brassica napus]
Length=296

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 84/136 (62%), Gaps = 20/136 (15%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +A  VY+ ++LQLW+TL+N  A FYQ+F+Q +R           VG+     LSS  
Sbjct  3    ELTQADVVYSRRSLQLWKTLVNCLAFFYQLFLQILRA----------VGYH--PLLSSSA  50

Query  246  PQFRPLPVVELEDN--DDsppssalpslQIAAGCPDEH-HLPRltvvldldetlvCAYET  416
              F+PLP +EL +   DD     +  S++I +    +H  L RL VVLDLDETLVCAYET
Sbjct  51   DGFKPLPNIELLETAADD-----SPASVEIESSIEVQHSRLQRLKVVLDLDETLVCAYET  105

Query  417  STLPSIIHTQAIEAGL  464
            S+LP+ +  QAIEAGL
Sbjct  106  SSLPAALRNQAIEAGL  121



>ref|XP_002312160.2| NLI interacting factor family protein [Populus trichocarpa]
 gb|EEE89527.2| NLI interacting factor family protein [Populus trichocarpa]
Length=307

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 84/133 (63%), Gaps = 14/133 (11%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL     VY+P+++QLWR L NW A F+QIF+Q +R           VG R+   LS+P 
Sbjct  3    ELTHPEVVYSPRSIQLWRALWNWLAFFFQIFLQILRA----------VGPRS---LSTPS  49

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
              F+PLP+ EL +  D PP++        A   +E  + +LTVVLDLDETLVCAYETS+L
Sbjct  50   HTFKPLPLGELPETTDPPPATVEIPAGTDAISANE-PIQKLTVVLDLDETLVCAYETSSL  108

Query  426  PSIIHTQAIEAGL  464
            P+++  QA+EAGL
Sbjct  109  PALLCNQAMEAGL  121



>emb|CAN74278.1| hypothetical protein VITISV_004711 [Vitis vinifera]
Length=388

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +3

Query  84   KVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRPL  263
            +VY P+ LQ+WR ++NW   F QIF+Q  RG+PS  Q+LSY+G R+   L S    FRPL
Sbjct  5    QVYVPRPLQVWRAVVNWLGFFLQIFLQIFRGTPSLPQLLSYIGLRH-PLLPSSASSFRPL  63

Query  264  PVVELEDND  290
            PVVEL  +D
Sbjct  64   PVVELPLHD  72



>ref|XP_011035940.1| PREDICTED: CTD nuclear envelope phosphatase 1 [Populus euphratica]
Length=294

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 82/133 (62%), Gaps = 15/133 (11%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +   VY+P+++QLWRTL +W A F+ I +Q +R      Q LS          SS P
Sbjct  3    ELTQPEVVYSPRSIQLWRTLWDWLAFFFHILLQILRA--VGPQTLS----------SSHP  50

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
              F+PLP+VEL D  D PP++   S   AA   DE  + +L VVLDLDETLVCAYETS+L
Sbjct  51   --FKPLPLVELPDTTDPPPATVEISAGTAAVSADE-PIQKLKVVLDLDETLVCAYETSSL  107

Query  426  PSIIHTQAIEAGL  464
            P+ +  QA EAGL
Sbjct  108  PAALRDQATEAGL  120



>ref|XP_010922553.1| PREDICTED: CTD small phosphatase-like protein 2 [Elaeis guineensis]
Length=302

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 76/125 (61%), Gaps = 18/125 (14%)
 Frame = +3

Query  99   KTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRN---TSFLSSPPPQFRPLPV  269
            KT Q WRT+L W    +QI +Q +RG+PS AQVLS+VG R+   +S  SS  P F+PLP 
Sbjct  18   KTGQAWRTVLGWLGFLFQILLQILRGTPSWAQVLSFVGLRHPLLSSSSSSSSPAFKPLP-  76

Query  270  VELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIHTQA  449
                            +       P    L +LT+VLDLDETLVCAYETS+LP+I+ +QA
Sbjct  77   --------------AEAPTDTPPPPPPEVLDKLTIVLDLDETLVCAYETSSLPAIVRSQA  122

Query  450  IEAGL  464
            IEAGL
Sbjct  123  IEAGL  127



>ref|XP_006291562.1| hypothetical protein CARUB_v10017717mg [Capsella rubella]
 gb|EOA24460.1| hypothetical protein CARUB_v10017717mg [Capsella rubella]
Length=303

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 82/136 (60%), Gaps = 13/136 (10%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRN--TSFLSS  239
            EL +A  VY+P++ Q+W+TL+NW A FYQIF+Q +R           VG+    +S   +
Sbjct  3    ELTQADVVYSPRSFQVWKTLVNWLAFFYQIFLQILRA----------VGYHPLLSSSAKA  52

Query  240  PPPQFRPLPVVELEDN-DDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
                F+PLP +EL D   DSP +  + S    +   D     RL VVLDLDETLVCAYET
Sbjct  53   NADGFKPLPAIELLDRAADSPTTVDIASSTSDSCDSDRSRFHRLKVVLDLDETLVCAYET  112

Query  417  STLPSIIHTQAIEAGL  464
            S+LP+ +  QAIEAGL
Sbjct  113  SSLPAALRNQAIEAGL  128



>ref|XP_002315157.2| NLI interacting factor family protein [Populus trichocarpa]
 gb|EEF01328.2| NLI interacting factor family protein [Populus trichocarpa]
Length=258

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 82/133 (62%), Gaps = 15/133 (11%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +   VY+P+++QLWRTL +W A F+ IF+Q +R      Q LS          SS P
Sbjct  3    ELTQPEVVYSPRSIQLWRTLWDWLAFFFHIFLQILRA--VGPQTLS----------SSHP  50

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
              F+PLP+VEL D  D PP++   S    A   +E  + +L VVLDLDETLVCAYETS+L
Sbjct  51   --FKPLPLVELPDTTDPPPATVEISAGTDAVSANE-PIQKLKVVLDLDETLVCAYETSSL  107

Query  426  PSIIHTQAIEAGL  464
            P+ +  QA EAGL
Sbjct  108  PAALRNQATEAGL  120



>ref|XP_011019110.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X1 [Populus euphratica]
Length=324

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 83/128 (65%), Gaps = 10/128 (8%)
 Frame = +3

Query  108  QLWRTLLNWAAAFYQIFVQNVRGSPSAAQ-VLSYVGFRNTSFLSSPPPQFRPLPVVEL--  278
            ++W+ ++NW     ++F+Q +RG+PS AQ +LSY+GF     LSS    F+PLPVVE+  
Sbjct  23   EVWKGMMNWLGFVMKLFLQILRGTPSMAQFLLSYIGF-TFPLLSSSSSSFKPLPVVEIPL  81

Query  279  ------EDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIH  440
                  +  D +  SS LP      G  D+  + +LTVVLDLDETL+CAYE S+LP+II 
Sbjct  82   QETTSNKITDTAHDSSCLPGYVCDLGASDDCLIEKLTVVLDLDETLICAYEASSLPAIIR  141

Query  441  TQAIEAGL  464
            TQA+EAG+
Sbjct  142  TQAVEAGV  149



>ref|XP_007008963.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
isoform 2, partial [Theobroma cacao]
 gb|EOY17773.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
isoform 2, partial [Theobroma cacao]
Length=213

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 83/135 (61%), Gaps = 13/135 (10%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVR--GSPSAAQVLSYVGFRNTSFLSSPPPQF  254
            A+VY+P+++Q+WR LLNW A F+QIF Q +R  G        S     ++S  SS P +F
Sbjct  7    AEVYSPRSMQVWRALLNWLAFFFQIFAQIIRAVGQYPLLSSSSSSSSSSSSTTSSSPHRF  66

Query  255  RPLPVVELEDNDDsppssalpslQIAAGCP-----DEHHLPRltvvldldetlvCAYETS  419
            +PLPV      DDS    +  +++IAA        DE  + +LTVVLDLDETLVCAYETS
Sbjct  67   KPLPV------DDSTEIESPATVEIAAVLDSSVLADEDSVEKLTVVLDLDETLVCAYETS  120

Query  420  TLPSIIHTQAIEAGL  464
            +LP  +  QA +AGL
Sbjct  121  SLPPALRNQATDAGL  135



>ref|XP_011019111.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X2 [Populus euphratica]
Length=323

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 83/128 (65%), Gaps = 10/128 (8%)
 Frame = +3

Query  108  QLWRTLLNWAAAFYQIFVQNVRGSPSAAQ-VLSYVGFRNTSFLSSPPPQFRPLPVVEL--  278
            ++W+ ++NW     ++F+Q +RG+PS AQ +LSY+GF     LSS    F+PLPVVE+  
Sbjct  23   EVWKGMMNWLGFVMKLFLQILRGTPSMAQFLLSYIGF-TFPLLSSSSSSFKPLPVVEIPL  81

Query  279  ------EDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIH  440
                  +  D +  SS LP      G  D+  + +LTVVLDLDETL+CAYE S+LP+II 
Sbjct  82   QETTSNKITDTAHDSSCLPGYVCDLGASDDCLIEKLTVVLDLDETLICAYEASSLPAIIR  141

Query  441  TQAIEAGL  464
            TQA+EAG+
Sbjct  142  TQAVEAGV  149



>ref|XP_006378658.1| hypothetical protein POPTR_0010s19580g [Populus trichocarpa]
 gb|ERP56455.1| hypothetical protein POPTR_0010s19580g [Populus trichocarpa]
Length=294

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 82/133 (62%), Gaps = 15/133 (11%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +   VY+P+++QLWRTL +W A F+ IF+Q +R      Q LS          SS P
Sbjct  3    ELTQPEVVYSPRSIQLWRTLWDWLAFFFHIFLQILRA--VGPQTLS----------SSHP  50

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
              F+PLP+VEL D  D PP++   S    A   +E  + +L VVLDLDETLVCAYETS+L
Sbjct  51   --FKPLPLVELPDTTDPPPATVEISAGTDAVSANE-PIQKLKVVLDLDETLVCAYETSSL  107

Query  426  PSIIHTQAIEAGL  464
            P+ +  QA EAGL
Sbjct  108  PAALRNQATEAGL  120



>ref|XP_008805431.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X1 [Phoenix dactylifera]
Length=301

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 75/123 (61%), Gaps = 17/123 (14%)
 Frame = +3

Query  102  TLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRN--TSFLSSPPPQFRPLPVVE  275
            T Q WRT+L W    +QI +Q +RG+PS AQVLS+VG R+   S  SS  P F+PLP   
Sbjct  19   TGQAWRTVLGWLGFLFQILLQILRGTPSWAQVLSFVGLRHPLLSSSSSSSPAFKPLPAEA  78

Query  276  LEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIHTQAIE  455
              D    PP                  L +LTVVLDLDETLVCAYETS+LP+++ +QA+E
Sbjct  79   PNDTPPPPPPEV---------------LDKLTVVLDLDETLVCAYETSSLPAVVRSQAVE  123

Query  456  AGL  464
            AGL
Sbjct  124  AGL  126



>ref|XP_008805436.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X2 [Phoenix dactylifera]
Length=291

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 75/123 (61%), Gaps = 17/123 (14%)
 Frame = +3

Query  102  TLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRN--TSFLSSPPPQFRPLPVVE  275
            T Q WRT+L W    +QI +Q +RG+PS AQVLS+VG R+   S  SS  P F+PLP   
Sbjct  19   TGQAWRTVLGWLGFLFQILLQILRGTPSWAQVLSFVGLRHPLLSSSSSSSPAFKPLPAEA  78

Query  276  LEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIHTQAIE  455
              D    PP                  L +LTVVLDLDETLVCAYETS+LP+++ +QA+E
Sbjct  79   PNDTPPPPPPEV---------------LDKLTVVLDLDETLVCAYETSSLPAVVRSQAVE  123

Query  456  AGL  464
            AGL
Sbjct  124  AGL  126



>ref|XP_010504466.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=300

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 84/134 (63%), Gaps = 12/134 (9%)
 Frame = +3

Query  66   ELAKAAKV-YAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSP  242
            EL +A+ V Y+P++ Q+W+TL++W A FYQIF+Q +R    A      +   ++S   + 
Sbjct  3    ELTQASDVVYSPRSFQVWKTLVDWLAFFYQIFLQILR----AVGYHPLLSSSSSSSAKAT  58

Query  243  PPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETST  422
               F+PLP +EL D  D     +  ++ IA+    +  L RL VVLDLDETLVCAYETS+
Sbjct  59   ADGFKPLPSIELLDRAD----ESPTTVDIASS---DGELQRLKVVLDLDETLVCAYETSS  111

Query  423  LPSIIHTQAIEAGL  464
            LP+ +  QAIEAGL
Sbjct  112  LPAALRNQAIEAGL  125



>ref|XP_010516189.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=300

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 84/134 (63%), Gaps = 12/134 (9%)
 Frame = +3

Query  66   ELAKAAKV-YAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSP  242
            EL +A+ V Y+P++ Q+W+TL++W A FYQIF+Q +R    A      +   ++S   + 
Sbjct  3    ELTQASDVVYSPRSFQVWKTLVDWLAFFYQIFLQILR----AVGYHPLLSSSSSSSAKAT  58

Query  243  PPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETST  422
               F+PLP +EL D  D     +  ++ IA+    +  L RL VVLDLDETLVCAYETS+
Sbjct  59   ADGFKPLPSIELLDRAD----ESPTTVDIASS---DGELQRLKVVLDLDETLVCAYETSS  111

Query  423  LPSIIHTQAIEAGL  464
            LP+ +  QAIEAGL
Sbjct  112  LPAALRNQAIEAGL  125



>ref|XP_010535319.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Tarenaya hassleriana]
 ref|XP_010535391.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Tarenaya hassleriana]
Length=307

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 80/137 (58%), Gaps = 8/137 (6%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +A  VY+P++LQ+W+ L+NW A FYQIF+Q +R       + S     + +  +   
Sbjct  3    ELTQAEVVYSPRSLQVWKALVNWLAFFYQIFLQILRAVGYHHLLSSSSSSSDKAVANG--  60

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEH----HLPRltvvldldetlvCAYE  413
              F+PLPVVEL +     P++   +     G  D H       +LTVVLDLDETL+CAYE
Sbjct  61   --FKPLPVVELPELASESPATVEIASGRTYGERDGHGYGGRFAKLTVVLDLDETLICAYE  118

Query  414  TSTLPSIIHTQAIEAGL  464
            TS+LP  +  QAIE GL
Sbjct  119  TSSLPVSLRNQAIEGGL  135



>ref|XP_007008962.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY17772.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
isoform 1 [Theobroma cacao]
Length=310

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 83/135 (61%), Gaps = 13/135 (10%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVR--GSPSAAQVLSYVGFRNTSFLSSPPPQF  254
            A+VY+P+++Q+WR LLNW A F+QIF Q +R  G        S     ++S  SS P +F
Sbjct  7    AEVYSPRSMQVWRALLNWLAFFFQIFAQIIRAVGQYPLLSSSSSSSSSSSSTTSSSPHRF  66

Query  255  RPLPVVELEDNDDsppssalpslQIAAGCP-----DEHHLPRltvvldldetlvCAYETS  419
            +PLPV      DDS    +  +++IAA        DE  + +LTVVLDLDETLVCAYETS
Sbjct  67   KPLPV------DDSTEIESPATVEIAAVLDSSVLADEDSVEKLTVVLDLDETLVCAYETS  120

Query  420  TLPSIIHTQAIEAGL  464
            +LP  +  QA +AGL
Sbjct  121  SLPPALRNQATDAGL  135



>ref|XP_010427400.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=301

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 79/134 (59%), Gaps = 11/134 (8%)
 Frame = +3

Query  66   ELAKAAKV-YAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSP  242
            EL +A+ V Y+P++ Q+W+TL++W A FYQIF+Q +R    A      +   ++S   + 
Sbjct  3    ELTQASDVVYSPRSFQVWKTLVDWLAFFYQIFLQILR----AVGYHPLLSSSSSSSAKAT  58

Query  243  PPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETST  422
               F+PLP +EL D        A     +     D   L RL VVLDLDETLVCAYETS+
Sbjct  59   ADGFKPLPSIELLDR------PAESPTTVDIASSDGGELQRLKVVLDLDETLVCAYETSS  112

Query  423  LPSIIHTQAIEAGL  464
            LP+ +  QAIEAGL
Sbjct  113  LPAALRNQAIEAGL  126



>ref|XP_009103976.1| PREDICTED: CTD small phosphatase-like protein [Brassica rapa]
Length=296

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 79/134 (59%), Gaps = 16/134 (12%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +A  VY+ ++LQLW+TL+N  A FYQ+F+Q +R           VG+     LSS  
Sbjct  3    ELTQADVVYSRRSLQLWKTLVNCLAFFYQLFLQILRA----------VGYH--PLLSSSA  50

Query  246  PQFRPLPVVE-LEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETST  422
              F+PLP +E LE   D  P+S      I     +     RL VVLDLDETLVCAYETS+
Sbjct  51   DGFKPLPNIELLETAADDSPASVEIESSIEV---ERSRFQRLKVVLDLDETLVCAYETSS  107

Query  423  LPSIIHTQAIEAGL  464
            LP+ +  QAI+AGL
Sbjct  108  LPAALRNQAIDAGL  121



>ref|XP_009344958.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Pyrus x bretschneideri]
Length=301

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 83/137 (61%), Gaps = 16/137 (12%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR----NTSFL  233
            EL +   VY+PKTLQ+WR LLNW   F+QIF++ +R           +G R    ++S  
Sbjct  3    ELTQGEVVYSPKTLQVWRALLNWFGFFFQIFLRILRA----------LGHRPLLSSSSSS  52

Query  234  SSPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYE  413
            S+    F+ LPV+EL +ND    S+ + +    +    +    +LTVVLDLDETLVCAYE
Sbjct  53   SASSAAFKSLPVIELPENDSPAASAVVIADTPDSDS--DDPFEKLTVVLDLDETLVCAYE  110

Query  414  TSTLPSIIHTQAIEAGL  464
            TS+LP+++ TQA E G+
Sbjct  111  TSSLPAVVRTQATEGGM  127



>ref|XP_009116289.1| PREDICTED: CTD small phosphatase-like protein isoform X2 [Brassica 
rapa]
Length=291

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 80/133 (60%), Gaps = 19/133 (14%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL ++  VY+P++LQ+W+T +N  A FYQIF+Q +R        + Y    ++S   +  
Sbjct  3    ELTQSDVVYSPRSLQVWKTFMNCLAFFYQIFLQILRA-------VGYHPLLSSSSSKAAA  55

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
              F+PLP +EL ++          +++IA G        RL VVLDLDETLVCAYETS+L
Sbjct  56   DGFKPLPSIELPES--------PTTVEIATG----DRFQRLKVVLDLDETLVCAYETSSL  103

Query  426  PSIIHTQAIEAGL  464
            P+ +  QAIEAGL
Sbjct  104  PAALRNQAIEAGL  116



>ref|XP_009116288.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Brassica 
rapa]
Length=292

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 80/133 (60%), Gaps = 19/133 (14%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL ++  VY+P++LQ+W+T +N  A FYQIF+Q +R        + Y    ++S   +  
Sbjct  3    ELTQSDVVYSPRSLQVWKTFMNCLAFFYQIFLQILRA-------VGYHPLLSSSSSKAAA  55

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
              F+PLP +EL ++          +++IA G        RL VVLDLDETLVCAYETS+L
Sbjct  56   DGFKPLPSIELPES--------PTTVEIATG----DRFQRLKVVLDLDETLVCAYETSSL  103

Query  426  PSIIHTQAIEAGL  464
            P+ +  QAIEAGL
Sbjct  104  PAALRNQAIEAGL  116



>ref|XP_011046823.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Populus 
euphratica]
Length=295

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 81/134 (60%), Gaps = 16/134 (12%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRG-SPSAAQVLSYVGFRNTSFLSSP  242
            EL     VY+P+++QLWR L N  A F++IF+Q +R   P +              LSSP
Sbjct  3    ELTHPEVVYSPRSIQLWRALWNCLAFFFRIFLQILRALGPQS--------------LSSP  48

Query  243  PPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETST  422
               F+PLP+VEL +  D P ++        A   +E  + +LTVVLDLDETLVCAYETS+
Sbjct  49   SHTFKPLPLVELPETTDPPLATVEIPAGTDAISANE-PIQKLTVVLDLDETLVCAYETSS  107

Query  423  LPSIIHTQAIEAGL  464
            LP+++  QAIEAGL
Sbjct  108  LPALLCNQAIEAGL  121



>gb|KFK34835.1| hypothetical protein AALP_AA5G199300 [Arabis alpina]
Length=301

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 84/138 (61%), Gaps = 19/138 (14%)
 Frame = +3

Query  66   ELAKAAKVYAP-KTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRN--TSFLS  236
            EL +A  VY+P ++ Q+W+TL+NW A FYQIF+Q +R           VG+    +S   
Sbjct  3    ELTQADVVYSPPRSFQVWKTLVNWLAFFYQIFLQILRA----------VGYHPLLSSSAK  52

Query  237  SPPPQFRPLPVVELEDNDDsppssalpslQIAA--GCPDEHHLPRltvvldldetlvCAY  410
            +    F+PLP +EL D      + +  +++IA+     ++    RL VVLDLDETLVCAY
Sbjct  53   ATADGFKPLPAIELLDT----AAESPATVEIASSKNSCEQGRSQRLKVVLDLDETLVCAY  108

Query  411  ETSTLPSIIHTQAIEAGL  464
            ETS+LP+ +  QAIEAGL
Sbjct  109  ETSSLPASLRNQAIEAGL  126



>ref|XP_008374036.1| PREDICTED: CTD small phosphatase-like protein [Malus domestica]
Length=301

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 82/133 (62%), Gaps = 8/133 (6%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +   VY+PKTLQ+WR LLNW   F+QIF++ +R       +  +    ++S  S+  
Sbjct  3    ELTQGEVVYSPKTLQVWRALLNWLGFFFQIFLRILRA------LGHHPLLSSSSSSSASS  56

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
              F+ LPV+EL +ND    S+ + +    +    +    +LTVVLDLDETLVCAYETS+L
Sbjct  57   AAFKSLPVIELPENDSPAASAVVIADTPDSDS--DDPFEKLTVVLDLDETLVCAYETSSL  114

Query  426  PSIIHTQAIEAGL  464
            P+++ TQA E G+
Sbjct  115  PAVVRTQATEGGM  127



>ref|XP_007218742.1| hypothetical protein PRUPE_ppa009189mg [Prunus persica]
 gb|EMJ19941.1| hypothetical protein PRUPE_ppa009189mg [Prunus persica]
Length=303

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 82/133 (62%), Gaps = 6/133 (5%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +   VY+PKTLQ+WR L+NW   F+QIF+Q +R       +  +    ++S  SS  
Sbjct  3    ELTQGEVVYSPKTLQVWRALVNWFGFFFQIFLQILRA------LGHHPLLSSSSSASSSS  56

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
              F+ LPVVEL++ +   P+++   +        +  + +LTVVLDLDETLVCAYE+S+L
Sbjct  57   ASFKSLPVVELQELEHDSPAASAVEIADTPDADSDDRIHKLTVVLDLDETLVCAYESSSL  116

Query  426  PSIIHTQAIEAGL  464
            P+++  QA E GL
Sbjct  117  PAVVRDQATEGGL  129



>gb|KDO68955.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
Length=276

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 75/135 (56%), Gaps = 12/135 (9%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR--NTSFLSS  239
            EL +A   Y+ +++Q+WRTLLNW A F+QIF          A++L  +G     +S  S+
Sbjct  3    ELTQAEVAYSHRSIQVWRTLLNWLAFFFQIF----------AKILRALGHHPLLSSSASA  52

Query  240  PPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETS  419
                F+PL VVEL + D S                 E  L +LTVVLDLDETLVCAYETS
Sbjct  53   STHAFKPLQVVELPETDSSATVDIGAVRDSGDDVVSEERLQKLTVVLDLDETLVCAYETS  112

Query  420  TLPSIIHTQAIEAGL  464
            +LP  +  QA  AGL
Sbjct  113  SLPVTLRNQATGAGL  127



>ref|XP_008388217.1| PREDICTED: uncharacterized protein LOC103450630 [Malus domestica]
Length=216

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 68/131 (52%), Gaps = 33/131 (25%)
 Frame = +3

Query  72   AKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQ  251
            A AA+VY P TLQ WR ++NW   FYQI +Q +RG+P    +LS +        SS  P 
Sbjct  7    AAAAEVYVPMTLQAWR-VVNWVGFFYQIILQILRGAPCLPHLLSCI-------SSSSSPA  58

Query  252  FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPS  431
            FRPLPV EL D            +++     DE              TLVCAYET ++P+
Sbjct  59   FRPLPVAELMD----------FVMEVVLDL-DE--------------TLVCAYETCSVPA  93

Query  432  IIHTQAIEAGL  464
            I+  +A EAG+
Sbjct  94   IVRARATEAGM  104



>gb|KJB74329.1| hypothetical protein B456_011G288400 [Gossypium raimondii]
Length=243

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 78/133 (59%), Gaps = 11/133 (8%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRP  260
            A+VY P+++Q+WR LLNW A F+QIF Q +R       + S       +  SS   +F+P
Sbjct  7    AEVYTPRSMQVWRALLNWLAFFFQIFAQIIRAVGQYPLLSSSSTTETKTTTSSSTHRFKP  66

Query  261  LPVVELEDNDDsppssalpslQIAAGCP-----DEHHLPRltvvldldetlvCAYETSTL  425
            LPVV      DS       +++IAA        D+    +LTVVLDLDETLVCAYETS+L
Sbjct  67   LPVV------DSVEIECPSTVEIAAVLDSPAPVDDDRTEKLTVVLDLDETLVCAYETSSL  120

Query  426  PSIIHTQAIEAGL  464
            P  + +QA +AGL
Sbjct  121  PLALRSQATDAGL  133



>emb|CDY27252.1| BnaA09g35500D [Brassica napus]
Length=295

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 81/133 (61%), Gaps = 16/133 (12%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL ++  VY+P++LQ+W+T +N  A FYQIF+Q +R        + Y    ++S   +  
Sbjct  3    ELTQSDVVYSPRSLQVWKTFMNCLAFFYQIFLQILRA-------VGYHPLLSSSSSKAAA  55

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
              F+PLP +EL ++          +++IA+    +    RL VVLDLDETLVCAYETS+L
Sbjct  56   DGFKPLPSIELPES--------PTTVEIASSATGD-RFQRLKVVLDLDETLVCAYETSSL  106

Query  426  PSIIHTQAIEAGL  464
            P+ +  QAIEAGL
Sbjct  107  PAALRNQAIEAGL  119



>ref|XP_009369172.1| PREDICTED: probable C-terminal domain small phosphatase [Pyrus 
x bretschneideri]
 ref|XP_009369173.1| PREDICTED: probable C-terminal domain small phosphatase [Pyrus 
x bretschneideri]
Length=300

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 82/133 (62%), Gaps = 9/133 (7%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +   VY+PKTLQ+WR LLNW A F QIF+Q +R    A      +   ++S  S+  
Sbjct  3    ELTQGEVVYSPKTLQVWRALLNWLAFFSQIFLQILR----ALGHHPLLSSSSSSSSSASS  58

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
              F+ LPV  LE++     S A  +++IA     +    +LTVVLDLDETLVCAYETS+L
Sbjct  59   AAFKSLPVEPLEND-----SPASSAVEIADTPDSDGPFEKLTVVLDLDETLVCAYETSSL  113

Query  426  PSIIHTQAIEAGL  464
            P+++ TQA E GL
Sbjct  114  PAVVRTQATEGGL  126



>gb|KDO68954.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
Length=285

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 75/135 (56%), Gaps = 12/135 (9%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR--NTSFLSS  239
            EL +A   Y+ +++Q+WRTLLNW A F+QIF          A++L  +G     +S  S+
Sbjct  3    ELTQAEVAYSHRSIQVWRTLLNWLAFFFQIF----------AKILRALGHHPLLSSSASA  52

Query  240  PPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETS  419
                F+PL VVEL + D S                 E  L +LTVVLDLDETLVCAYETS
Sbjct  53   STHAFKPLQVVELPETDSSATVDIGAVRDSGDDVVSEERLQKLTVVLDLDETLVCAYETS  112

Query  420  TLPSIIHTQAIEAGL  464
            +LP  +  QA  AGL
Sbjct  113  SLPVTLRNQATGAGL  127



>emb|CDX72186.1| BnaC08g26880D [Brassica napus]
Length=295

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 81/133 (61%), Gaps = 16/133 (12%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL ++  VY+P++LQ+W+T +N  A FYQIF+Q +R        + Y    ++S   +  
Sbjct  3    ELTQSDVVYSPRSLQVWKTFMNCLAFFYQIFLQILRA-------VGYHPLLSSSSSKAAS  55

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
              F+PLP +EL ++          +++IA+    +    RL VVLDLDETLVCAYETS+L
Sbjct  56   DGFKPLPSIELPES--------PTTVEIASSTTGD-RFQRLKVVLDLDETLVCAYETSSL  106

Query  426  PSIIHTQAIEAGL  464
            P+ +  QAIEAGL
Sbjct  107  PAALRNQAIEAGL  119



>gb|KDO68952.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
 gb|KDO68953.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
Length=300

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 75/135 (56%), Gaps = 12/135 (9%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR--NTSFLSS  239
            EL +A   Y+ +++Q+WRTLLNW A F+QIF          A++L  +G     +S  S+
Sbjct  3    ELTQAEVAYSHRSIQVWRTLLNWLAFFFQIF----------AKILRALGHHPLLSSSASA  52

Query  240  PPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETS  419
                F+PL VVEL + D S                 E  L +LTVVLDLDETLVCAYETS
Sbjct  53   STHAFKPLQVVELPETDSSATVDIGAVRDSGDDVVSEERLQKLTVVLDLDETLVCAYETS  112

Query  420  TLPSIIHTQAIEAGL  464
            +LP  +  QA  AGL
Sbjct  113  SLPVTLRNQATGAGL  127



>ref|XP_006435743.1| hypothetical protein CICLE_v10031856mg [Citrus clementina]
 ref|XP_006486313.1| PREDICTED: CTD small phosphatase-like protein-like [Citrus sinensis]
 gb|ESR48983.1| hypothetical protein CICLE_v10031856mg [Citrus clementina]
Length=375

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 75/135 (56%), Gaps = 12/135 (9%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR--NTSFLSS  239
            EL +A   Y+ +++Q+WRTLLNW A F+QIF          A++L  +G     +S  S+
Sbjct  78   ELTQAEVAYSHRSIQVWRTLLNWLAFFFQIF----------AKILRALGHHPLLSSSASA  127

Query  240  PPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETS  419
                F+PL VVEL + D S                 E  L +LTVVLDLDETLVCAYETS
Sbjct  128  STHAFKPLQVVELPETDSSATVDIGAVRDSGDDVVSEERLQKLTVVLDLDETLVCAYETS  187

Query  420  TLPSIIHTQAIEAGL  464
            +LP  +  QA  AGL
Sbjct  188  SLPVTLRNQATGAGL  202



>ref|NP_001148462.1| LOC100282077 [Zea mays]
 gb|ACG31578.1| CTD small phosphatase-like protein [Zea mays]
 gb|AFW84679.1| CTD small phosphatase-like protein isoform 1 [Zea mays]
 gb|AFW84680.1| CTD small phosphatase-like protein isoform 2 [Zea mays]
Length=311

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 81/141 (57%), Gaps = 19/141 (13%)
 Frame = +3

Query  78   AAKVYAPKTL------------QLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRN  221
            A +VY+P T             Q WR ++ W   F Q+ +Q +RG+PS AQ+LS+VGFR 
Sbjct  3    ATEVYSPTTAAAAQQQRGKAASQAWRAVVGWIGFFLQVLLQILRGTPSCAQLLSFVGFRY  62

Query  222  TSFLSSPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlv  401
               L S P    PLP V        P  S +P+    A  P    L RLTVVLDLDETLV
Sbjct  63   P--LLSGPAASEPLPEVAF-----MPLHSEIPADAAPAPKPASEPLGRLTVVLDLDETLV  115

Query  402  CAYETSTLPSIIHTQAIEAGL  464
             AYE+S+LP+I+ TQA+EAGL
Sbjct  116  SAYESSSLPAIVRTQAVEAGL  136



>gb|KJB74328.1| hypothetical protein B456_011G288400 [Gossypium raimondii]
Length=294

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 78/133 (59%), Gaps = 11/133 (8%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRP  260
            A+VY P+++Q+WR LLNW A F+QIF Q +R       + S       +  SS   +F+P
Sbjct  7    AEVYTPRSMQVWRALLNWLAFFFQIFAQIIRAVGQYPLLSSSSTTETKTTTSSSTHRFKP  66

Query  261  LPVVELEDNDDsppssalpslQIAAGCP-----DEHHLPRltvvldldetlvCAYETSTL  425
            LPVV      DS       +++IAA        D+    +LTVVLDLDETLVCAYETS+L
Sbjct  67   LPVV------DSVEIECPSTVEIAAVLDSPAPVDDDRTEKLTVVLDLDETLVCAYETSSL  120

Query  426  PSIIHTQAIEAGL  464
            P  + +QA +AGL
Sbjct  121  PLALRSQATDAGL  133



>gb|KJB74327.1| hypothetical protein B456_011G288400 [Gossypium raimondii]
Length=308

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 78/133 (59%), Gaps = 11/133 (8%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRP  260
            A+VY P+++Q+WR LLNW A F+QIF Q +R       + S       +  SS   +F+P
Sbjct  7    AEVYTPRSMQVWRALLNWLAFFFQIFAQIIRAVGQYPLLSSSSTTETKTTTSSSTHRFKP  66

Query  261  LPVVELEDNDDsppssalpslQIAAGCP-----DEHHLPRltvvldldetlvCAYETSTL  425
            LPVV      DS       +++IAA        D+    +LTVVLDLDETLVCAYETS+L
Sbjct  67   LPVV------DSVEIECPSTVEIAAVLDSPAPVDDDRTEKLTVVLDLDETLVCAYETSSL  120

Query  426  PSIIHTQAIEAGL  464
            P  + +QA +AGL
Sbjct  121  PLALRSQATDAGL  133



>ref|XP_008793248.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Phoenix dactylifera]
Length=303

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 84/140 (60%), Gaps = 21/140 (15%)
 Frame = +3

Query  66   ELAKAA--KVYAP-----KTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNT  224
            ELA++A   +Y+P      +L +WRT+++WA     I +Q +RG+PS AQ LS+V F ++
Sbjct  3    ELARSAPAAMYSPGGGAASSLPVWRTVVSWAGFLLHILLQILRGTPSWAQFLSFVPFLSS  62

Query  225  SFLSSPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvC  404
            S  SS  P FRPLPV    D                +  P +    +LTVVLDLDETLVC
Sbjct  63   SSSSS--PAFRPLPVEAPADT--------PLPPPTVSDIPSD----KLTVVLDLDETLVC  108

Query  405  AYETSTLPSIIHTQAIEAGL  464
            AYE+S LPS++  QAIEAGL
Sbjct  109  AYESSCLPSLVRDQAIEAGL  128



>ref|XP_008345306.1| PREDICTED: probable C-terminal domain small phosphatase [Malus 
domestica]
Length=298

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 81/133 (61%), Gaps = 11/133 (8%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +   VY+PKTLQ+WR LLNW A F QIF+Q +R       +  +    ++S  S+  
Sbjct  3    ELTQGEVVYSPKTLQVWRALLNWLAFFSQIFLQILRA------LGHHSLLSSSSSSSASS  56

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
              F+ LP VE  +ND    S A  +++IA     +    +LTVVLDLDETLVCAYETS L
Sbjct  57   AAFKSLP-VEPPEND----SPAASAVEIADTPDSDDPFEKLTVVLDLDETLVCAYETSGL  111

Query  426  PSIIHTQAIEAGL  464
            P+++ TQA E GL
Sbjct  112  PTVVRTQATEGGL  124



>ref|XP_008463241.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Cucumis melo]
Length=297

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 83/128 (65%), Gaps = 12/128 (9%)
 Frame = +3

Query  84   KVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVG-FRNTSFLSSPPPQFRP  260
            +VY+P TLQ+W+TLLNW A F+QIFV           +L+  G  R  S  SS  P F+P
Sbjct  8    EVYSPGTLQVWKTLLNWLAFFFQIFVS----------ILTAFGHLRLLSSHSSSSPSFKP  57

Query  261  LPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIH  440
            LPVVEL D++    S+   +     G  D   + +LT+VLDLDETL+CAYETSTLP+II 
Sbjct  58   LPVVELPDHELLAASAVDIASVEDEGESD-GLMEKLTIVLDLDETLICAYETSTLPAIIR  116

Query  441  TQAIEAGL  464
            +QAIEAGL
Sbjct  117  SQAIEAGL  124



>ref|XP_003616639.1| CTD small phosphatase-like protein [Medicago truncatula]
 gb|AES99597.1| NLI interacting factor-like phosphatase [Medicago truncatula]
Length=305

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 83/135 (61%), Gaps = 9/135 (7%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +      P+T Q+W++LL+W A F+QIF Q +R        L      ++S  SS  
Sbjct  3    ELTQTEVYSPPRTQQVWKSLLSWFAFFFQIFSQIIRT--LGHYPLLSSSSSSSSSSSSTS  60

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCP--DEHHLPRltvvldldetlvCAYETS  419
              F+PLP VEL+D D     S+  +L+I A  P  D+    +LTVVLDLDETLVCAYETS
Sbjct  61   SSFKPLPSVELQDFD-----SSSSALEITADYPAADQRPFQKLTVVLDLDETLVCAYETS  115

Query  420  TLPSIIHTQAIEAGL  464
            +LP+ + +QAIEAGL
Sbjct  116  SLPAALRSQAIEAGL  130



>emb|CDY46516.1| BnaC06g15690D [Brassica napus]
Length=303

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 76/138 (55%), Gaps = 17/138 (12%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +A  VY+ ++LQLW+TL+N  A FYQIF+Q +R           VG+     LSS  
Sbjct  3    ELTQADVVYSRRSLQLWKTLVNCLAFFYQIFLQILRA----------VGYH--PLLSSSA  50

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRl-----tvvldldetlvCAY  410
              F+PLP +EL +     P+S      I         L         VVLDLDETLVCAY
Sbjct  51   DGFKPLPNIELLETAADSPASVEIESSIEVERSRFERLKARFQFFFFVVLDLDETLVCAY  110

Query  411  ETSTLPSIIHTQAIEAGL  464
            ETS+LP+ +  QAI+AGL
Sbjct  111  ETSSLPAALRNQAIDAGL  128



>ref|XP_010517421.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X5 [Camelina sativa]
Length=273

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 81/136 (60%), Gaps = 14/136 (10%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL++A  VY+P+++QLW  L+NW   FY+ F++ +R           V   + S LS+ P
Sbjct  3    ELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKILR-----------VDAHHHSLLSTSP  51

Query  246  PQ---FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
                 F+PL V++L  ++   P S   + +  +       + +LTVVLDLDETLV AYET
Sbjct  52   STKDGFKPLSVLDLPKSETESPVSIEIASERTSTDGQVSTIQKLTVVLDLDETLVSAYET  111

Query  417  STLPSIIHTQAIEAGL  464
            S++P+ + TQAIEAGL
Sbjct  112  SSIPTALRTQAIEAGL  127



>ref|XP_010920860.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Elaeis guineensis]
Length=303

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 89/140 (64%), Gaps = 21/140 (15%)
 Frame = +3

Query  66   ELAKAAK--VYAP-----KTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNT  224
            ELA++A   +Y P       L +WRT+++WA   ++I +Q +RG+PS AQ+LS+V F ++
Sbjct  3    ELARSAASAMYTPGGGAANRLHVWRTVVSWAGFLFRILLQILRGTPSWAQLLSFVPFLSS  62

Query  225  SFLSSPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvC  404
            S   S  P FRPLPV       ++P  +  P   ++    D     +LTVVLDLDETLVC
Sbjct  63   S--PSSSPAFRPLPV-------EAPADTPPPPPTVSDSPSD-----KLTVVLDLDETLVC  108

Query  405  AYETSTLPSIIHTQAIEAGL  464
            AYE+S+LPS++  QAIEAGL
Sbjct  109  AYESSSLPSLVRDQAIEAGL  128



>ref|XP_004491033.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cicer arietinum]
Length=311

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 81/136 (60%), Gaps = 7/136 (5%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +    Y+P+T Q+W++ L+W A F+QIF Q +R        L      ++S  SS  
Sbjct  5    ELTQTEVAYSPRTQQVWKSFLSWLAFFFQIFSQIIRT--LGHYRLLSSSSSSSSSSSSTS  62

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAG---CPDEHHLPRltvvldldetlvCAYET  416
              F+PLP VEL++ D     S   +L+I A      D     +LTVVLDLDETLVCAYET
Sbjct  63   SSFKPLPSVELQEYD--LSLSPPSALEITADYSPAVDHRSFQKLTVVLDLDETLVCAYET  120

Query  417  STLPSIIHTQAIEAGL  464
            S+LP+ + +QAIEAGL
Sbjct  121  SSLPAALRSQAIEAGL  136



>ref|XP_004149232.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 ref|XP_004172125.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 gb|KGN50658.1| hypothetical protein Csa_5G203410 [Cucumis sativus]
Length=297

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 18/131 (14%)
 Frame = +3

Query  84   KVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVG-FRNTSFLSSPPPQFRP  260
            +VY+P TL +W+TLLNW A F+QIFV           +L+  G  R  S  SS  P F+P
Sbjct  8    EVYSPGTLHVWKTLLNWLAFFFQIFV----------SILTAFGHLRLLSSHSSSSPSFKP  57

Query  261  LPVVELEDNDDsppssalpslQIAAGCPDEHH---LPRltvvldldetlvCAYETSTLPS  431
            LPVVEL D++      A  ++ IA+   +E     + +LT+VLDLDETL+CAYETSTLP+
Sbjct  58   LPVVELPDHE----LLAASAVDIASVEDEEESDGLMEKLTIVLDLDETLICAYETSTLPA  113

Query  432  IIHTQAIEAGL  464
            II +QAIEAGL
Sbjct  114  IIRSQAIEAGL  124



>ref|XP_010517419.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X3 [Camelina sativa]
Length=325

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 81/136 (60%), Gaps = 14/136 (10%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL++A  VY+P+++QLW  L+NW   FY+ F++ +R           V   + S LS+ P
Sbjct  3    ELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKILR-----------VDAHHHSLLSTSP  51

Query  246  PQ---FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
                 F+PL V++L  ++   P S   + +  +       + +LTVVLDLDETLV AYET
Sbjct  52   STKDGFKPLSVLDLPKSETESPVSIEIASERTSTDGQVSTIQKLTVVLDLDETLVSAYET  111

Query  417  STLPSIIHTQAIEAGL  464
            S++P+ + TQAIEAGL
Sbjct  112  SSIPTALRTQAIEAGL  127



>ref|XP_010517420.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X4 [Camelina sativa]
Length=311

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 81/136 (60%), Gaps = 14/136 (10%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL++A  VY+P+++QLW  L+NW   FY+ F++ +R           V   + S LS+ P
Sbjct  3    ELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKILR-----------VDAHHHSLLSTSP  51

Query  246  PQ---FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
                 F+PL V++L  ++   P S   + +  +       + +LTVVLDLDETLV AYET
Sbjct  52   STKDGFKPLSVLDLPKSETESPVSIEIASERTSTDGQVSTIQKLTVVLDLDETLVSAYET  111

Query  417  STLPSIIHTQAIEAGL  464
            S++P+ + TQAIEAGL
Sbjct  112  SSIPTALRTQAIEAGL  127



>ref|XP_003564541.1| PREDICTED: CTD small phosphatase-like protein [Brachypodium distachyon]
Length=312

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 80/146 (55%), Gaps = 28/146 (19%)
 Frame = +3

Query  78   AAKVYAPKTL-------------QLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR  218
            AA+VY+P                Q+WRT++ W     Q+ +Q +RG+PS AQ+LS+VGFR
Sbjct  3    AAEVYSPTAAAAAQQQQRGKAATQVWRTVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  219  ----NTSFLSSPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldl  386
                + +  S P P+   +P+            S +P+       P    L RLTVVLDL
Sbjct  63   YPLLSATAASDPSPEVAFMPL-----------HSEIPADAAPVPAPPPAPLERLTVVLDL  111

Query  387  detlvCAYETSTLPSIIHTQAIEAGL  464
            DETLV AYE+S LP I+ TQA+EAGL
Sbjct  112  DETLVSAYESSGLPPIVRTQAVEAGL  137



>ref|XP_010517411.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517412.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517413.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517414.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517415.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517417.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
Length=341

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 81/136 (60%), Gaps = 14/136 (10%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL++A  VY+P+++QLW  L+NW   FY+ F++ +R           V   + S LS+ P
Sbjct  3    ELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKILR-----------VDAHHHSLLSTSP  51

Query  246  PQ---FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
                 F+PL V++L  ++   P S   + +  +       + +LTVVLDLDETLV AYET
Sbjct  52   STKDGFKPLSVLDLPKSETESPVSIEIASERTSTDGQVSTIQKLTVVLDLDETLVSAYET  111

Query  417  STLPSIIHTQAIEAGL  464
            S++P+ + TQAIEAGL
Sbjct  112  SSIPTALRTQAIEAGL  127



>ref|XP_010505730.1| PREDICTED: CTD small phosphatase-like protein isoform X4 [Camelina 
sativa]
Length=309

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 80/136 (59%), Gaps = 15/136 (11%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL++A  VY+P+++QLW  L+NW   FY+ F++ +R               + S LS+ P
Sbjct  3    ELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKFLRVDA------------HHSLLSTSP  50

Query  246  PQ---FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
                 F+PL V++L +     P S   + +  +       + +LTVVLDLD+TLVCAYET
Sbjct  51   STKDGFKPLSVIDLPEIATESPVSIQIASEKTSTEGQVSTIQKLTVVLDLDDTLVCAYET  110

Query  417  STLPSIIHTQAIEAGL  464
            S++P+ + TQAIEAGL
Sbjct  111  SSVPAALRTQAIEAGL  126



>ref|XP_010505722.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010505723.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010505724.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010505725.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
Length=325

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 80/136 (59%), Gaps = 15/136 (11%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL++A  VY+P+++QLW  L+NW   FY+ F++ +R               + S LS+ P
Sbjct  3    ELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKFLRVDA------------HHSLLSTSP  50

Query  246  PQ---FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
                 F+PL V++L +     P S   + +  +       + +LTVVLDLD+TLVCAYET
Sbjct  51   STKDGFKPLSVIDLPEIATESPVSIQIASEKTSTEGQVSTIQKLTVVLDLDDTLVCAYET  110

Query  417  STLPSIIHTQAIEAGL  464
            S++P+ + TQAIEAGL
Sbjct  111  SSVPAALRTQAIEAGL  126



>ref|XP_010505729.1| PREDICTED: CTD small phosphatase-like protein isoform X3 [Camelina 
sativa]
Length=319

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 80/136 (59%), Gaps = 15/136 (11%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL++A  VY+P+++QLW  L+NW   FY+ F++ +R               + S LS+ P
Sbjct  3    ELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKFLRVDA------------HHSLLSTSP  50

Query  246  PQ---FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
                 F+PL V++L +     P S   + +  +       + +LTVVLDLD+TLVCAYET
Sbjct  51   STKDGFKPLSVIDLPEIATESPVSIQIASEKTSTEGQVSTIQKLTVVLDLDDTLVCAYET  110

Query  417  STLPSIIHTQAIEAGL  464
            S++P+ + TQAIEAGL
Sbjct  111  SSVPAALRTQAIEAGL  126



>ref|XP_010517418.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X2 [Camelina sativa]
Length=333

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 81/136 (60%), Gaps = 14/136 (10%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL++A  VY+P+++QLW  L+NW   FY+ F++ +R           V   + S LS+ P
Sbjct  3    ELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKILR-----------VDAHHHSLLSTSP  51

Query  246  PQ---FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
                 F+PL V++L  ++   P S   + +  +       + +LTVVLDLDETLV AYET
Sbjct  52   STKDGFKPLSVLDLPKSETESPVSIEIASERTSTDGQVSTIQKLTVVLDLDETLVSAYET  111

Query  417  STLPSIIHTQAIEAGL  464
            S++P+ + TQAIEAGL
Sbjct  112  SSIPTALRTQAIEAGL  127



>ref|XP_010505726.1| PREDICTED: CTD small phosphatase-like protein isoform X2 [Camelina 
sativa]
 ref|XP_010505728.1| PREDICTED: CTD small phosphatase-like protein isoform X2 [Camelina 
sativa]
Length=324

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 80/136 (59%), Gaps = 15/136 (11%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL++A  VY+P+++QLW  L+NW   FY+ F++ +R               + S LS+ P
Sbjct  3    ELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKFLRVDA------------HHSLLSTSP  50

Query  246  PQ---FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
                 F+PL V++L +     P S   + +  +       + +LTVVLDLD+TLVCAYET
Sbjct  51   STKDGFKPLSVIDLPEIATESPVSIQIASEKTSTEGQVSTIQKLTVVLDLDDTLVCAYET  110

Query  417  STLPSIIHTQAIEAGL  464
            S++P+ + TQAIEAGL
Sbjct  111  SSVPAALRTQAIEAGL  126



>ref|XP_006411263.1| hypothetical protein EUTSA_v10016941mg [Eutrema salsugineum]
 gb|ESQ52716.1| hypothetical protein EUTSA_v10016941mg [Eutrema salsugineum]
Length=320

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 79/133 (59%), Gaps = 4/133 (3%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +A  VY+P++LQLW  L+NW   FYQ F++ +R   S   +LS     +   ++   
Sbjct  3    ELTQADLVYSPRSLQLWTVLVNWLDFFYQSFLKILRAI-SRHPLLSTSSSSSAKSIAD--  59

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
              F+PLPV+EL +     P +   +    +       + RLTVVLDLDETLV AYETS+L
Sbjct  60   -GFKPLPVIELPEVAPESPVTVGIASTRTSSEVKFGSIQRLTVVLDLDETLVSAYETSSL  118

Query  426  PSIIHTQAIEAGL  464
            P+ + TQAIEAGL
Sbjct  119  PATLRTQAIEAGL  131



>ref|XP_002533382.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29000.1| conserved hypothetical protein [Ricinus communis]
Length=267

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 83/141 (59%), Gaps = 17/141 (12%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +   VY+P+++Q+WRTL NW A F+QIF+Q +R       + S     NT       
Sbjct  3    ELTQQEIVYSPRSIQVWRTLWNWLAFFFQIFLQILRALGHLPLLSSSSSSSNT-------  55

Query  246  PQFRPLPVVELEDNDDspps-----salpslQIAAG---CPDEHHLPRltvvldldetlv  401
              F+PLPV+EL + +    +      +  +L+IA+G    P +    +LTVVLDLDETLV
Sbjct  56   --FKPLPVIELTETETETGTETETDLSAATLEIASGPVSSPVDQPFRKLTVVLDLDETLV  113

Query  402  CAYETSTLPSIIHTQAIEAGL  464
            CAYETS+LP+ +  QA  AG+
Sbjct  114  CAYETSSLPAALRNQATGAGV  134



>gb|KDO56646.1| hypothetical protein CISIN_1g020937mg [Citrus sinensis]
Length=224

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 80/137 (58%), Gaps = 12/137 (9%)
 Frame = +3

Query  84   KVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVG-----FRNTSFLSSPPP  248
            +V  P+++Q+WR  ++W    +Q+F+Q +RG+PS    L  VG     + +    SS  P
Sbjct  10   EVCEPRSVQVWRGFVSWVGFIFQVFIQILRGTPSFFSYL--VGLSSSSYSSLLASSSASP  67

Query  249  QFRPLPVVELEDNDDsp-----pssalpslQIAAGCPDEHHLPRltvvldldetlvCAYE  413
             F+PLPVVEL   + S       S          G  D   + +LTVVLDLDETLVCAYE
Sbjct  68   SFKPLPVVELPLQESSAAAAAHVSFDGGLSDDCGGGGDGQEIEKLTVVLDLDETLVCAYE  127

Query  414  TSTLPSIIHTQAIEAGL  464
            TS+LP+II TQA EAGL
Sbjct  128  TSSLPAIIRTQAAEAGL  144



>ref|XP_004970462.1| PREDICTED: CTD small phosphatase-like protein 2-like [Setaria 
italica]
Length=312

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 78/142 (55%), Gaps = 20/142 (14%)
 Frame = +3

Query  78   AAKVYAPKTL-------------QLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR  218
            AA+VY+P                Q WRT++ W     Q+ +Q +RG+PS AQ+LS+VGFR
Sbjct  3    AAEVYSPTAAAAAQQQQRGKVASQAWRTVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  219  NTSFLSSPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetl  398
                L S P    P P V        P  S +P+    A       L RLTVVLDLDETL
Sbjct  63   YP--LLSGPAASEPSPEVAF-----MPLRSEIPADVAPAPAAPPEPLGRLTVVLDLDETL  115

Query  399  vCAYETSTLPSIIHTQAIEAGL  464
            V AYE+S+LP I+ TQA+EAGL
Sbjct  116  VSAYESSSLPVIVRTQAVEAGL  137



>ref|XP_009141872.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Brassica rapa]
Length=304

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 82/138 (59%), Gaps = 18/138 (13%)
 Frame = +3

Query  66   ELAKAAKVYAPKT-LQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSP  242
            EL +A  VY+P++ LQLW   +NW   FYQ F++ +R        L++  F ++  +S  
Sbjct  3    ELNQADLVYSPRSSLQLWNVFVNWLDFFYQFFLKILRP-------LAHHPFLSSKAISD-  54

Query  243  PPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEH----HLPRltvvldldetlvCAY  410
               F+PLPV+EL +         + ++QIA+G          + RLTVVLDLDETLV AY
Sbjct  55   --GFKPLPVIELPE---MAAEPPVTTIQIASGRTSSEGEVGSIQRLTVVLDLDETLVSAY  109

Query  411  ETSTLPSIIHTQAIEAGL  464
            ETS+LP  + TQAIEAGL
Sbjct  110  ETSSLPHNLRTQAIEAGL  127



>ref|XP_008672265.1| PREDICTED: uncharacterized protein LOC100216776 isoform X1 [Zea 
mays]
Length=360

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 80/145 (55%), Gaps = 27/145 (19%)
 Frame = +3

Query  78   AAKVYAPKTL------------QLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR-  218
            AA+VY+P               Q WRT++ W     Q+ +Q +RG+PS AQ+LS+VG R 
Sbjct  3    AAEVYSPTAAAAAQQQREKAASQAWRTVVGWIGFLVQVLLQILRGTPSCAQLLSFVGVRY  62

Query  219  ---NTSFLSSPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldld  389
               +    S+P P+   +P+            S +P+    A  P    L RL VVLDLD
Sbjct  63   PLLSGPTASNPSPEVAFMPL-----------RSEIPADAAPAPTPAPEPLGRLKVVLDLD  111

Query  390  etlvCAYETSTLPSIIHTQAIEAGL  464
            ETLV AYE+S+LP+I+ TQA+EAGL
Sbjct  112  ETLVSAYESSSLPTIVRTQAVEAGL  136



>ref|NP_001136647.1| uncharacterized protein LOC100216776 [Zea mays]
 gb|ACF82332.1| unknown [Zea mays]
 tpg|DAA56987.1| TPA: CTD small phosphatase-like protein [Zea mays]
Length=364

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 80/145 (55%), Gaps = 27/145 (19%)
 Frame = +3

Query  78   AAKVYAPKTL------------QLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR-  218
            AA+VY+P               Q WRT++ W     Q+ +Q +RG+PS AQ+LS+VG R 
Sbjct  3    AAEVYSPTAAAAAQQQREKAASQAWRTVVGWIGFLVQVLLQILRGTPSCAQLLSFVGVRY  62

Query  219  ---NTSFLSSPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldld  389
               +    S+P P+   +P+            S +P+    A  P    L RL VVLDLD
Sbjct  63   PLLSGPTASNPSPEVAFMPL-----------RSEIPADAAPAPTPAPEPLGRLKVVLDLD  111

Query  390  etlvCAYETSTLPSIIHTQAIEAGL  464
            ETLV AYE+S+LP+I+ TQA+EAGL
Sbjct  112  ETLVSAYESSSLPTIVRTQAVEAGL  136



>ref|XP_010508910.1| PREDICTED: probable C-terminal domain small phosphatase isoform 
X2 [Camelina sativa]
Length=310

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 79/136 (58%), Gaps = 15/136 (11%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL++A  VY+P+++QLW  L+NW   FY+ F++ +R               + S LS+ P
Sbjct  3    ELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKILRFDA------------HHSLLSTSP  50

Query  246  PQ---FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
                 F+PL V++L +     P S   + +  +       + +LTVVLDLDETLV AYET
Sbjct  51   STKDGFKPLSVIDLPEIATESPVSIQIASEKTSTEGQVSTIQKLTVVLDLDETLVSAYET  110

Query  417  STLPSIIHTQAIEAGL  464
            S+LP+ + TQAIEAGL
Sbjct  111  SSLPAALRTQAIEAGL  126



>ref|XP_010534600.1| PREDICTED: CTD small phosphatase-like protein [Tarenaya hassleriana]
Length=311

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 77/151 (51%), Gaps = 35/151 (23%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +A  VY+P++L++W+ L+NW A FYQIF+Q +R   +   +       ++    +  
Sbjct  3    ELTQAEVVYSPRSLEVWKALVNWLAFFYQIFLQFLR---AVGHLPLLSSSSSSPSGKAAA  59

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLP------------------Rlt  371
              F  LPVVE+ D               AA  P    +P                  +LT
Sbjct  60   DGFELLPVVEVPDK--------------AAESPASVEIPSRRTCGDRDGHGDGGRFAKLT  105

Query  372  vvldldetlvCAYETSTLPSIIHTQAIEAGL  464
            VVLDLDETLVCAYETS+LP  +  QAIEAGL
Sbjct  106  VVLDLDETLVCAYETSSLPVSLRNQAIEAGL  136



>gb|ACG32959.1| CTD small phosphatase-like protein [Zea mays]
 tpg|DAA56988.1| TPA: CTD small phosphatase-like protein [Zea mays]
Length=311

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 78/141 (55%), Gaps = 19/141 (13%)
 Frame = +3

Query  78   AAKVYAPKTL------------QLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRN  221
            AA+VY+P               Q WRT++ W     Q+ +Q +RG+PS AQ+LS+VG R 
Sbjct  3    AAEVYSPTAAAAAQQQREKAASQAWRTVVGWIGFLVQVLLQILRGTPSCAQLLSFVGVRY  62

Query  222  TSFLSSPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlv  401
               L S P    P P V        P  S +P+    A  P    L RL VVLDLDETLV
Sbjct  63   P--LLSGPTASNPSPEVAF-----MPLRSEIPADAAPAPTPAPEPLGRLKVVLDLDETLV  115

Query  402  CAYETSTLPSIIHTQAIEAGL  464
             AYE+S+LP+I+ TQA+EAGL
Sbjct  116  SAYESSSLPTIVRTQAVEAGL  136



>emb|CDY07060.1| BnaA04g22550D [Brassica napus]
Length=304

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 81/138 (59%), Gaps = 18/138 (13%)
 Frame = +3

Query  66   ELAKAAKVYAPKT-LQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSP  242
            EL +A  VY+P++ LQLW   +NW   FYQ F++ +R        L++  F ++  +S  
Sbjct  3    ELNQADVVYSPRSSLQLWNVFVNWLDFFYQFFLKILRP-------LAHHPFLSSKAISD-  54

Query  243  PPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEH----HLPRltvvldldetlvCAY  410
               F+PLPV+EL +         + ++QI +G          + RLTVVLDLDETLV AY
Sbjct  55   --GFKPLPVIELPE---MAAEPPVTTIQITSGRTSSEGEVGSIQRLTVVLDLDETLVSAY  109

Query  411  ETSTLPSIIHTQAIEAGL  464
            ETS+LP  + TQAIEAGL
Sbjct  110  ETSSLPDNLRTQAIEAGL  127



>ref|XP_002458718.1| hypothetical protein SORBIDRAFT_03g038910 [Sorghum bicolor]
 gb|EES03838.1| hypothetical protein SORBIDRAFT_03g038910 [Sorghum bicolor]
Length=314

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 75/142 (53%), Gaps = 18/142 (13%)
 Frame = +3

Query  78   AAKVYAPKTL-------------QLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR  218
            AA+VY+P                Q WR ++ W     Q+ +Q +RG+PS AQ+LS+VGFR
Sbjct  3    AAEVYSPTAAAAAQQQQRGKAASQAWRAVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  219  NTSFLSSPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetl  398
                L S P    P P V               +    A  P    L RLTVVLDLDETL
Sbjct  63   YP--LLSGPAASEPSPEVAFM---PLHSEIPADADAAPAPIPAPEPLGRLTVVLDLDETL  117

Query  399  vCAYETSTLPSIIHTQAIEAGL  464
            V AYE+S+LP+I+ TQA+EAGL
Sbjct  118  VSAYESSSLPAIVRTQAVEAGL  139



>ref|XP_010508909.1| PREDICTED: CTD small phosphatase-like protein 2-B isoform X1 
[Camelina sativa]
Length=385

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 79/136 (58%), Gaps = 15/136 (11%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL++A  VY+P+++QLW  L+NW   FY+ F++ +R               + S LS+ P
Sbjct  3    ELSQADLVYSPRSVQLWNVLVNWLDFFYRFFLKILRFDA------------HHSLLSTSP  50

Query  246  PQ---FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
                 F+PL V++L +     P S   + +  +       + +LTVVLDLDETLV AYET
Sbjct  51   STKDGFKPLSVIDLPEIATESPVSIQIASEKTSTEGQVSTIQKLTVVLDLDETLVSAYET  110

Query  417  STLPSIIHTQAIEAGL  464
            S+LP+ + TQAIEAGL
Sbjct  111  SSLPAALRTQAIEAGL  126



>emb|CDX93216.1| BnaC04g46800D [Brassica napus]
Length=304

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 81/138 (59%), Gaps = 18/138 (13%)
 Frame = +3

Query  66   ELAKAAKVYAPKT-LQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSP  242
            EL++   VY+P++ LQLW   +NW   FYQ F++ +R        L++  F ++  +S  
Sbjct  3    ELSQTDVVYSPRSSLQLWNVFVNWLDFFYQFFLKILRP-------LAHHPFLSSKAISD-  54

Query  243  PPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEH----HLPRltvvldldetlvCAY  410
               F+PLPV+EL +         + +++IA+G          + RL VVLDLDETLV AY
Sbjct  55   --GFKPLPVIELPE---MAAEPPVTTIEIASGRTSSEGEVGSIQRLMVVLDLDETLVSAY  109

Query  411  ETSTLPSIIHTQAIEAGL  464
            ETS+LP  + TQAIEAGL
Sbjct  110  ETSSLPDNLRTQAIEAGL  127



>gb|KDO56645.1| hypothetical protein CISIN_1g020937mg [Citrus sinensis]
Length=319

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +3

Query  84   KVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVL---SYVGFRNTSFLSSPPPQF  254
            +V  P+++Q+WR  ++W    +Q+F+Q +RG+PS    L   S   + +    SS  P F
Sbjct  10   EVCEPRSVQVWRGFVSWVGFIFQVFIQILRGTPSFFSYLVGLSSSSYSSLLASSSASPSF  69

Query  255  RPLPVVELEDNDDsp-----pssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETS  419
            +PLPVVEL   + S       S          G  D   + +LTVVLDLDETLVCAYETS
Sbjct  70   KPLPVVELPLQESSAAAAAHVSFDGGLSDDCGGGGDGQEIEKLTVVLDLDETLVCAYETS  129

Query  420  TLPSIIHTQAIEAGL  464
            +LP+II TQA EAGL
Sbjct  130  SLPAIIRTQAAEAGL  144



>ref|XP_009406928.1| PREDICTED: CTD nuclear envelope phosphatase 1-like [Musa acuminata 
subsp. malaccensis]
Length=322

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 72/122 (59%), Gaps = 13/122 (11%)
 Frame = +3

Query  99   KTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRPLPVVEL  278
            K++Q WR L+   A  +++ +Q +RG+PS AQ+LS VG R+  F SSP   ++ L V   
Sbjct  24   KSVQAWRALVCRVAILFRLLLQILRGTPSWAQLLSSVGLRH-PFFSSPSAGYKLLSVAPP  82

Query  279  EDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIHTQAIEA  458
             D   +  +            P    L +LTVVLDLDETL+CAYETS+L S +  QA+EA
Sbjct  83   ADALPNHTA------------PASEPLGKLTVVLDLDETLICAYETSSLSSTVRAQAVEA  130

Query  459  GL  464
            GL
Sbjct  131  GL  132



>ref|NP_001242244.1| uncharacterized protein LOC100783451 [Glycine max]
 gb|ACU20842.1| unknown [Glycine max]
Length=304

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 9/130 (7%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRP  260
            A+VY+P+T Q+WR LL+W A F+QIF Q +R       +         S  ++    F+P
Sbjct  7    AEVYSPRTQQVWRALLSWLAFFFQIFFQIIRALGHYPLLSFSSSSDAASSSNA---SFKP  63

Query  261  LPVVELEDNDDsppssalpslQIAA--GCPDEHHLPRltvvldldetlvCAYETSTLPSI  434
            LP VEL ++D         +LQI+     P +H +P+LTVVLDLDETLVCAYETS+LP+ 
Sbjct  64   LPSVELSEHDS----PPSSALQISPLHCSPKDHPIPKLTVVLDLDETLVCAYETSSLPAA  119

Query  435  IHTQAIEAGL  464
            + TQAIE GL
Sbjct  120  LRTQAIEGGL  129



>gb|KDP24445.1| hypothetical protein JCGZ_25009 [Jatropha curcas]
Length=316

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 86/138 (62%), Gaps = 6/138 (4%)
 Frame = +3

Query  69   LAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQV-LSYVGFRN---TSFLS  236
            + +  +V+  +++Q+WR ++NW     Q+F+Q +R +PS AQ+ LSYVGF     +S   
Sbjct  4    IEQQGEVHMTRSVQIWRGIVNWLGFLLQLFLQILRITPSMAQMALSYVGFTYPLLSSSCC  63

Query  237  SPPPQFRPLPVVE--LEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAY  410
            S    F+ LPVVE  L+++  + P+       ++ G    H + +LTVVLDLDETLVCAY
Sbjct  64   SSSSSFKSLPVVEIPLQESSLTLPAQISVPADVSEGDACNHRMEKLTVVLDLDETLVCAY  123

Query  411  ETSTLPSIIHTQAIEAGL  464
            ETS+LPS I   AI AGL
Sbjct  124  ETSSLPSSICALAIGAGL  141



>gb|EEC71746.1| hypothetical protein OsI_04315 [Oryza sativa Indica Group]
Length=312

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 79/149 (53%), Gaps = 34/149 (23%)
 Frame = +3

Query  78   AAKVYAPKTL-------------QLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR  218
            AA+VY+P                Q W+ ++ W     Q+ +Q +RG+PS AQ+LS+VGFR
Sbjct  3    AAEVYSPTAAAAAQQQQRGKVAAQAWQAVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  219  NTSFLS-------SPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvv  377
                LS       SP   F PL              S +P+    A  P    L RLTVV
Sbjct  63   -YPLLSGPADSEQSPSVAFMPL-------------RSEIPADTAPAPTPPPESLQRLTVV  108

Query  378  ldldetlvCAYETSTLPSIIHTQAIEAGL  464
            LDLDETLV AYE+S+LP+I+ TQA+EAGL
Sbjct  109  LDLDETLVSAYESSSLPAIVRTQAVEAGL  137



>ref|NP_001044710.1| Os01g0833100 [Oryza sativa Japonica Group]
 dbj|BAD73773.1| NLI interacting factor (NIF) family protein-like [Oryza sativa 
Japonica Group]
 dbj|BAF06624.1| Os01g0833100 [Oryza sativa Japonica Group]
 dbj|BAG91176.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55630.1| hypothetical protein OsJ_03971 [Oryza sativa Japonica Group]
Length=312

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 79/149 (53%), Gaps = 34/149 (23%)
 Frame = +3

Query  78   AAKVYAPKTL-------------QLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR  218
            AA+VY+P                Q W+ ++ W     Q+ +Q +RG+PS AQ+LS+VGFR
Sbjct  3    AAEVYSPTAAAAAQQQQRGKVAAQAWQAVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  219  NTSFLS-------SPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvv  377
                LS       SP   F PL              S +P+    A  P    L RLTVV
Sbjct  63   -YPLLSGPADSEQSPSVAFMPL-------------RSEIPADTAPAPTPPPESLQRLTVV  108

Query  378  ldldetlvCAYETSTLPSIIHTQAIEAGL  464
            LDLDETLV AYE+S+LP+I+ TQA+EAGL
Sbjct  109  LDLDETLVSAYESSSLPAIVRTQAVEAGL  137



>ref|XP_006294651.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
 gb|EOA27549.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
Length=272

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 78/136 (57%), Gaps = 15/136 (11%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL++   VY+P+++QLW   +NW   FY+ F+          ++L  VG  + S LS+ P
Sbjct  3    ELSQTDLVYSPRSIQLWNVFVNWLDYFYEFFL----------KILGAVG--HHSLLSTSP  50

Query  246  PQ---FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
                 F+PL V++L +    PP S   +    +       + +LTVVLDLDETLV AYET
Sbjct  51   SNKDGFKPLSVIDLPEITAEPPLSVEIASARTSTERQVSTIQKLTVVLDLDETLVSAYET  110

Query  417  STLPSIIHTQAIEAGL  464
            S+LP+ +  QAIEAGL
Sbjct  111  SSLPAALRKQAIEAGL  126



>gb|EMT13698.1| CTD small phosphatase-like protein 2 [Aegilops tauschii]
Length=314

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 76/142 (54%), Gaps = 18/142 (13%)
 Frame = +3

Query  78   AAKVYAPKTL-------------QLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR  218
            AA+VY+P                Q W+ ++ W     Q+ +Q +RG+PS AQ+LS+VGFR
Sbjct  3    AAEVYSPTAAAAAQHQQRGKAATQAWQAVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  219  NTSFLSSPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetl  398
                 S+     +P P V        P  S +P+       P    L RLTVVLDLDETL
Sbjct  63   YPLLSSASAAPDQPSPEVAF-----MPLRSEIPAAAAPVPAPPPEPLQRLTVVLDLDETL  117

Query  399  vCAYETSTLPSIIHTQAIEAGL  464
            V AYE+S LP I+ TQA+EAGL
Sbjct  118  VSAYESSGLPPIVRTQAVEAGL  139



>emb|CDM84840.1| unnamed protein product [Triticum aestivum]
Length=313

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 77/142 (54%), Gaps = 19/142 (13%)
 Frame = +3

Query  78   AAKVYAPKTL-------------QLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR  218
            AA+VY+P                Q W+ ++ W     Q+ +Q +RG+PS AQ+LS+VGFR
Sbjct  3    AAEVYSPTAAAAAQHQQRGKAATQAWQAVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  219  NTSFLSSPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetl  398
                 ++  P  +P P V        P  S +P+       P    L RLTVVLDLDETL
Sbjct  63   YPLLSATAAPD-QPSPEVAF-----MPLRSEIPADAAPVPAPPPEPLERLTVVLDLDETL  116

Query  399  vCAYETSTLPSIIHTQAIEAGL  464
            V AYE+S LP I+ TQA+EAGL
Sbjct  117  VSAYESSGLPPIVRTQAVEAGL  138



>dbj|BAJ91589.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 77/142 (54%), Gaps = 19/142 (13%)
 Frame = +3

Query  78   AAKVYAPKTL-------------QLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR  218
            AA+VY+P                Q W+ ++ W     Q+ +Q +RG+PS AQ+LS+VGFR
Sbjct  3    AAEVYSPTAAAAAQHQQRGKAATQAWQAVVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR  62

Query  219  NTSFLSSPPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetl  398
                 ++  P  +P P V        P  S +P+       P    L RLTVVLDLDETL
Sbjct  63   YPLLSATAGPD-QPSPEVAF-----MPLRSEIPADAAPVPAPPPEPLERLTVVLDLDETL  116

Query  399  vCAYETSTLPSIIHTQAIEAGL  464
            V AYE+S LP I+ TQA+EAGL
Sbjct  117  VSAYESSGLPPIVRTQAVEAGL  138



>ref|XP_006294652.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
 gb|EOA27550.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
Length=309

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 78/136 (57%), Gaps = 15/136 (11%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL++   VY+P+++QLW   +NW   FY+ F+          ++L  VG  + S LS+ P
Sbjct  3    ELSQTDLVYSPRSIQLWNVFVNWLDYFYEFFL----------KILGAVG--HHSLLSTSP  50

Query  246  PQ---FRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYET  416
                 F+PL V++L +    PP S   +    +       + +LTVVLDLDETLV AYET
Sbjct  51   SNKDGFKPLSVIDLPEITAEPPLSVEIASARTSTERQVSTIQKLTVVLDLDETLVSAYET  110

Query  417  STLPSIIHTQAIEAGL  464
            S+LP+ +  QAIEAGL
Sbjct  111  SSLPAALRKQAIEAGL  126



>gb|KHN48568.1| CTD small phosphatase-like protein 2 [Glycine soja]
Length=304

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 9/130 (7%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRP  260
            A+VY+P+T Q+WR LL+W A F+QIF Q +R       +         S  ++    F+P
Sbjct  7    AEVYSPRTQQVWRALLSWLAFFFQIFFQIIRALGHYPLLSFSSSSNAASSSNA---SFKP  63

Query  261  LPVVELEDNDDsppssalpslQIAA--GCPDEHHLPRltvvldldetlvCAYETSTLPSI  434
            LP VEL ++D         +LQI+     P +H +P+LTVVLDLDETLVCAYETS+LP+ 
Sbjct  64   LPSVELSEHDS----PPSSALQISPLHCSPKDHPIPKLTVVLDLDETLVCAYETSSLPAA  119

Query  435  IHTQAIEAGL  464
            + TQAIE GL
Sbjct  120  LRTQAIEGGL  129



>ref|XP_006429395.1| hypothetical protein CICLE_v10012210mg [Citrus clementina]
 gb|ESR42635.1| hypothetical protein CICLE_v10012210mg [Citrus clementina]
Length=321

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 76/137 (55%), Gaps = 10/137 (7%)
 Frame = +3

Query  84   KVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVL-----SYVGFRNTSFLSSPPP  248
            +V  P+++Q+WR  ++W     Q+F+Q +RG+PS    L     S       S  SS  P
Sbjct  10   EVCEPRSVQVWRGFVSWVGFILQVFIQILRGTPSFFSYLVGLSSSSYSSLLASSSSSASP  69

Query  249  QFRPLPVVELEDNDDsp-----pssalpslQIAAGCPDEHHLPRltvvldldetlvCAYE  413
             F+PLPVVEL   + S       S          G  D   + +LTVVLDLDETLVCAYE
Sbjct  70   SFKPLPVVELPLQESSAAAAAHVSFDGGLSDDCGGGGDGQEMEKLTVVLDLDETLVCAYE  129

Query  414  TSTLPSIIHTQAIEAGL  464
            TS+LP+II  QA EAGL
Sbjct  130  TSSLPAIIRAQAAEAGL  146



>ref|XP_006481044.1| PREDICTED: CTD small phosphatase-like protein-like [Citrus sinensis]
Length=321

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 76/137 (55%), Gaps = 10/137 (7%)
 Frame = +3

Query  84   KVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVL-----SYVGFRNTSFLSSPPP  248
            +V  P+++Q+WR  ++W     Q+F+Q +RG+PS    L     S       S  SS  P
Sbjct  10   EVCEPRSVQVWRGFVSWVGFILQVFIQILRGTPSFFSYLVGLSSSSYSSLLASSSSSASP  69

Query  249  QFRPLPVVELEDNDDsp-----pssalpslQIAAGCPDEHHLPRltvvldldetlvCAYE  413
             F+PLPVVEL   + S       S          G  D   + +LTVVLDLDETLVCAYE
Sbjct  70   SFKPLPVVELPLQESSAAAAAHVSFDGGLSDDCGGGGDGQEIEKLTVVLDLDETLVCAYE  129

Query  414  TSTLPSIIHTQAIEAGL  464
            TS+LP+II  QA EAGL
Sbjct  130  TSSLPAIIRAQAAEAGL  146



>gb|KHN20843.1| CTD small phosphatase-like protein 2 [Glycine soja]
Length=306

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 83/128 (65%), Gaps = 2/128 (2%)
 Frame = +3

Query  81   AKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRP  260
            A+VY+P+T Q+WR LL+W A F+QIF Q +R       +       ++S  SS    F+P
Sbjct  7    AEVYSPRTQQVWRALLSWLAFFFQIFFQIIRALGHYPLLSFSSNSSSSSNASSSSSSFKP  66

Query  261  LPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIH  440
            LP VE+ ++D  PPS+   S       P +H +P+LTVVLDLDETLVCAYETS+LP+ + 
Sbjct  67   LPSVEIAEHDSPPPSALEISP--LDYSPADHPVPKLTVVLDLDETLVCAYETSSLPAALR  124

Query  441  TQAIEAGL  464
            TQAIE GL
Sbjct  125  TQAIEGGL  132



>gb|KFK23193.1| hypothetical protein AALP_AAs48948U000100 [Arabis alpina]
Length=303

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 75/133 (56%), Gaps = 14/133 (11%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPP  245
            EL +   VY+P+    W  L+NW   FYQ F++ +R    A   L Y  +   +      
Sbjct  3    ELTQTDLVYSPR----WNVLVNWLDFFYQFFLKILRAF--AHNPLLYASYSTKAIADG--  54

Query  246  PQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTL  425
              F+PL V+EL +      + +  +++IA+   +   + RLTVVLDLDETLV AYETS+L
Sbjct  55   --FKPLSVIELPE----ITAESPIAVEIASEVGEVSSIQRLTVVLDLDETLVSAYETSSL  108

Query  426  PSIIHTQAIEAGL  464
             + + TQAIEAGL
Sbjct  109  SAALRTQAIEAGL  121



>ref|XP_010101420.1| CTD small phosphatase-like protein [Morus notabilis]
 gb|EXB88392.1| CTD small phosphatase-like protein [Morus notabilis]
Length=307

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 73/134 (54%), Gaps = 9/134 (7%)
 Frame = +3

Query  66   ELAKAAKV-YAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSP  242
            EL +   V Y+P+TLQ+WR LLNW   F+QIF+Q +R       + S     + SF   P
Sbjct  4    ELTQGGDVVYSPRTLQVWRALLNWLGFFFQIFLQILRALGHLPLLSSSSSSSSPSFKPLP  63

Query  243  PPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETST  422
                     +EL ++D    S+   +    +   D     +LTVVLDLDETLVCAYETS+
Sbjct  64   N--------IELPEHDLPADSAVHIAALHDSDSDDVSEEKKLTVVLDLDETLVCAYETSS  115

Query  423  LPSIIHTQAIEAGL  464
            LP  +  QA EAGL
Sbjct  116  LPPGVRNQATEAGL  129



>ref|XP_003545230.1| PREDICTED: LOW QUALITY PROTEIN: carboxy-terminal domain RNA polymerase 
II polypeptide A small phosphatase 2-like [Glycine 
max]
Length=393

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 81/126 (64%), Gaps = 2/126 (2%)
 Frame = +3

Query  87   VYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSSPPPQFRPLP  266
            VY+P+T Q+WR LL+W A F+QIF Q +R       +       ++S  SS    F+PLP
Sbjct  96   VYSPRTQQVWRALLSWLAFFFQIFFQIIRALGHYPLLSFSSNSSSSSNASSSSSSFKPLP  155

Query  267  VVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIHTQ  446
             VE+ ++D  PPS+   S       P +H +P+LTVVLDLDETLVCAYETS+LP+ + TQ
Sbjct  156  SVEIAEHDSPPPSALEISP--LDYSPADHPVPKLTVVLDLDETLVCAYETSSLPAALRTQ  213

Query  447  AIEAGL  464
            AIE GL
Sbjct  214  AIEGGL  219



>ref|XP_011019112.1| PREDICTED: CTD small phosphatase-like protein isoform X3 [Populus 
euphratica]
Length=281

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = +3

Query  108  QLWRTLLNWAAAFYQIFVQNVRGSPSAAQ-VLSYVGFRNTSFLSSPPPQFRPLPVVEL  278
            ++W+ ++NW     ++F+Q +RG+PS AQ +LSY+GF     LSS    F+PLPVVE+
Sbjct  23   EVWKGMMNWLGFVMKLFLQILRGTPSMAQFLLSYIGF-TFPLLSSSSSSFKPLPVVEI  79



>ref|XP_010231274.1| PREDICTED: uncharacterized protein LOC100829084 [Brachypodium 
distachyon]
Length=268

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 63/118 (53%), Gaps = 14/118 (12%)
 Frame = +3

Query  114  WRTLLNWAAAFYQIFVQNVR-GSPSAAQVLSYVGFRNTSFLSSPPPQFRPLPVVELEDND  290
            W+ +  W     QI +Q  R  S S A++LS++G R     ++P   F  LP     D  
Sbjct  13   WQVMAVWLGFLLQILLQAFRRSSSSVARLLSFLGLRRPLLSAAPAVTFVQLPSEAPAD--  70

Query  291  DsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIHTQAIEAGL  464
                       ++    P    L RLTVVLDLDETLVCAYE+S+LP+ +H QAIEAGL
Sbjct  71   -----------ELPPPPPPYPPLGRLTVVLDLDETLVCAYESSSLPATVHAQAIEAGL  117



>ref|XP_006646453.1| PREDICTED: CTD small phosphatase-like protein 2-like, partial 
[Oryza brachyantha]
Length=282

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 67/121 (55%), Gaps = 21/121 (17%)
 Frame = +3

Query  123  LLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLS-------SPPPQFRPLPVVELE  281
            ++ W     Q+ +Q +RG+PS AQ+LS+VGFR    LS       SP   F PL      
Sbjct  1    VVGWIGFLLQVLLQILRGTPSCAQLLSFVGFR-YPLLSGPADSEQSPSVAFMPL------  53

Query  282  DNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIHTQAIEAG  461
                    S +P     A  P    L RL VVLDLDETLV AYE+S+LP+I+ TQA+EAG
Sbjct  54   -------RSEIPVDAAPAPTPPPESLQRLMVVLDLDETLVSAYESSSLPAIVRTQAVEAG  106

Query  462  L  464
            L
Sbjct  107  L  107



>ref|XP_004307664.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Fragaria 
vesca subsp. vesca]
Length=297

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 71/135 (53%), Gaps = 16/135 (12%)
 Frame = +3

Query  66   ELAKAAKVYA--PKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFRNTSFLSS  239
            EL ++   Y   PKT+QLW+ LLNW    +QIFVQ VR       + S      +     
Sbjct  3    ELTQSEVAYNSPPKTMQLWKALLNWLGFLFQIFVQVVRALGHHPLLSSSSSSEVSF----  58

Query  240  PPPQFRPLPVVELEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETS  419
                 + LP VEL ++D S           +   P      +LTVVLDLDETLVCAYE++
Sbjct  59   -----KSLPAVELPEHDSSAAVEIDAPDSDSDDPPQ-----KLTVVLDLDETLVCAYESA  108

Query  420  TLPSIIHTQAIEAGL  464
            +LP+++ TQA E G+
Sbjct  109  SLPAMVRTQATEGGM  123



>ref|XP_010095242.1| hypothetical protein L484_008252 [Morus notabilis]
 gb|EXB59010.1| hypothetical protein L484_008252 [Morus notabilis]
Length=127

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 8/79 (10%)
 Frame = +3

Query  78   AAKVYAPKT--LQLWRTLLNWAAAFYQIFVQNVRGSPSAA-QVLSYVGF-----RNTSFL  233
            A+ VYAP++   QLWR + NW   F++I +Q +RG+PS    +LS++G      R  S  
Sbjct  6    ASDVYAPRSSVQQLWRAVANWFGFFFEILLQILRGTPSCLPHLLSFLGLTHQNHRLLSSS  65

Query  234  SSPPPQFRPLPVVELEDND  290
            SS    F+P+   EL  ND
Sbjct  66   SSSSCSFKPVSASELSLND  84



>ref|XP_002893405.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69664.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=183

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 38/76 (50%), Gaps = 16/76 (21%)
 Frame = +3

Query  66   ELAKAAKVYAPKTLQLWRTLLNWAAAFYQIFVQNVRGSPSAAQVLSYVGFR--NTSFLSS  239
            EL  A  VY+P+  Q+W+TL+NW A FYQI              L  VG+    +S   +
Sbjct  3    ELTHADVVYSPRWFQVWKTLVNWLAFFYQI--------------LCAVGYHPLLSSSAKA  48

Query  240  PPPQFRPLPVVELEDN  287
                F+PLP +EL D 
Sbjct  49   SADGFKPLPAIELLDR  64



>ref|XP_009385548.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Musa acuminata subsp. malaccensis]
Length=313

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 15/123 (12%)
 Frame = +3

Query  99   KTLQLWRTLLNWAAAFYQIFVQNVR-GSPSAAQVLSYVGFRNTSFLSSPPPQFRPLPVVE  275
            +T Q WRT+L W    +++ +Q ++ G+PS AQ+LS+VG R+           R LP   
Sbjct  19   RTAQAWRTVLGWLGFLFRVLLQILQSGTPSWAQLLSFVGVRH-----------RLLPA--  65

Query  276  LEDNDDsppssalpslQIAAGCPDEHHLPRltvvldldetlvCAYETSTLPSIIHTQAIE  455
               +D +       +         +  L +LTVVLDLDETLV AYE S++P ++ +QAIE
Sbjct  66   -SSSDPAFHPLPTDAPPPPPPQLRQDPLDKLTVVLDLDETLVSAYEASSVPIVVRSQAIE  124

Query  456  AGL  464
            AG+
Sbjct  125  AGV  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559272306750