BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF022F11

Length=512
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|Q9LEB4.1|RBP45_NICPL  RecName: Full=Polyadenylate-binding prot...    116   1e-27   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009795696.1|  PREDICTED: polyadenylate-binding protein RBP45     116   1e-27   Nicotiana sylvestris
ref|XP_009600135.1|  PREDICTED: polyadenylate-binding protein RBP45     116   1e-27   Nicotiana tomentosiformis
gb|EYU33637.1|  hypothetical protein MIMGU_mgv1a007175mg                114   6e-27   Erythranthe guttata [common monkey flower]
ref|XP_006346222.1|  PREDICTED: polyadenylate-binding protein RBP...    113   2e-26   Solanum tuberosum [potatoes]
ref|XP_011097972.1|  PREDICTED: polyadenylate-binding protein RBP...    112   3e-26   
ref|XP_004244127.1|  PREDICTED: polyadenylate-binding protein RBP45     112   3e-26   Solanum lycopersicum
ref|XP_008345010.1|  PREDICTED: polyadenylate-binding protein RBP...    112   4e-26   Malus domestica [apple tree]
ref|XP_009375056.1|  PREDICTED: polyadenylate-binding protein RBP...    112   4e-26   Pyrus x bretschneideri [bai li]
ref|XP_009376881.1|  PREDICTED: polyadenylate-binding protein RBP...    112   4e-26   Pyrus x bretschneideri [bai li]
ref|XP_008377253.1|  PREDICTED: polyadenylate-binding protein RBP...    112   6e-26   Malus domestica [apple tree]
ref|XP_007209154.1|  hypothetical protein PRUPE_ppa005940mg             110   3e-25   Prunus persica
ref|XP_007015035.1|  RNA-binding family protein isoform 3               109   3e-25   
ref|XP_002518499.1|  nuclear acid binding protein, putative             109   3e-25   Ricinus communis
ref|XP_007015034.1|  RNA-binding family protein isoform 2               109   4e-25   
ref|XP_008238181.1|  PREDICTED: polyadenylate-binding protein RBP...    109   6e-25   
ref|XP_002285479.1|  PREDICTED: polyadenylate-binding protein RBP...    109   6e-25   Vitis vinifera
emb|CBI16387.3|  unnamed protein product                                109   6e-25   Vitis vinifera
ref|XP_004288602.1|  PREDICTED: polyadenylate-binding protein RBP...    108   7e-25   Fragaria vesca subsp. vesca
ref|XP_010108648.1|  Polyadenylate-binding protein RBP47B'              109   8e-25   
dbj|BAH56983.1|  AT1G11650                                              107   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008437079.1|  PREDICTED: polyadenylate-binding protein RBP...    108   8e-25   Cucumis melo [Oriental melon]
gb|KDO61276.1|  hypothetical protein CISIN_1g014513mg                   108   9e-25   Citrus sinensis [apfelsine]
ref|XP_008437078.1|  PREDICTED: polyadenylate-binding protein RBP...    108   9e-25   Cucumis melo [Oriental melon]
ref|XP_004152401.1|  PREDICTED: polyadenylate-binding protein RBP...    108   9e-25   Cucumis sativus [cucumbers]
ref|XP_008437076.1|  PREDICTED: polyadenylate-binding protein RBP...    108   9e-25   Cucumis melo [Oriental melon]
ref|XP_004164285.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    108   9e-25   
gb|KDP22083.1|  hypothetical protein JCGZ_25914                         108   1e-24   Jatropha curcas
ref|XP_006845940.1|  hypothetical protein AMTR_s00157p00080130          107   1e-24   
ref|XP_006446110.1|  hypothetical protein CICLE_v10015576mg             108   1e-24   
gb|KDO61275.1|  hypothetical protein CISIN_1g014513mg                   108   1e-24   Citrus sinensis [apfelsine]
ref|XP_006850190.1|  hypothetical protein AMTR_s00022p00247520          108   1e-24   Amborella trichopoda
ref|XP_010031800.1|  PREDICTED: polyadenylate-binding protein RBP...    108   1e-24   Eucalyptus grandis [rose gum]
gb|KGN50253.1|  hypothetical protein Csa_5G162020                       108   1e-24   Cucumis sativus [cucumbers]
ref|NP_849641.1|  polyadenylate-binding protein RBP45B                  107   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002513488.1|  nuclear acid binding protein, putative             107   2e-24   
ref|XP_002313332.2|  hypothetical protein POPTR_0009s05920g             107   2e-24   
ref|XP_011025522.1|  PREDICTED: polyadenylate-binding protein RBP...    107   2e-24   Populus euphratica
gb|KJB09397.1|  hypothetical protein B456_001G139100                    107   2e-24   Gossypium raimondii
ref|XP_006594429.1|  PREDICTED: polyadenylate-binding protein RBP...    106   2e-24   Glycine max [soybeans]
ref|XP_006470600.1|  PREDICTED: polyadenylate-binding protein RBP...    107   2e-24   Citrus sinensis [apfelsine]
gb|KJB09396.1|  hypothetical protein B456_001G139100                    107   2e-24   Gossypium raimondii
gb|KHG09232.1|  Polyadenylate-binding RBP47B' -like protein             107   2e-24   Gossypium arboreum [tree cotton]
ref|XP_004153512.1|  PREDICTED: polyadenylate-binding protein RBP...    103   3e-24   
gb|KJB09398.1|  hypothetical protein B456_001G139100                    107   3e-24   Gossypium raimondii
ref|XP_002889883.1|  ATRBP45B                                           107   3e-24   Arabidopsis lyrata subsp. lyrata
ref|NP_172630.1|  polyadenylate-binding protein RBP45B                  106   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64532.1|  putative DNA binding protein                            106   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KJB21880.1|  hypothetical protein B456_004G019500                    106   4e-24   Gossypium raimondii
gb|KJB21879.1|  hypothetical protein B456_004G019500                    106   4e-24   Gossypium raimondii
ref|XP_003542872.1|  PREDICTED: polyadenylate-binding protein RBP...    106   4e-24   Glycine max [soybeans]
ref|XP_010265752.1|  PREDICTED: polyadenylate-binding protein RBP...    106   5e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010265753.1|  PREDICTED: polyadenylate-binding protein RBP...    106   5e-24   Nelumbo nucifera [Indian lotus]
gb|KHG00069.1|  Polyadenylate-binding RBP47B' -like protein             106   6e-24   Gossypium arboreum [tree cotton]
ref|XP_008812246.1|  PREDICTED: polyadenylate-binding protein RBP...    106   6e-24   Phoenix dactylifera
gb|KHN37596.1|  Polyadenylate-binding protein RBP45B                    105   6e-24   Glycine soja [wild soybean]
ref|XP_010938882.1|  PREDICTED: polyadenylate-binding protein RBP...    106   7e-24   Elaeis guineensis
ref|XP_010458570.1|  PREDICTED: polyadenylate-binding protein RBP45B    105   7e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009789022.1|  PREDICTED: polyadenylate-binding protein RBP...    105   7e-24   Nicotiana sylvestris
ref|XP_010536076.1|  PREDICTED: polyadenylate-binding protein RBP...    106   7e-24   Tarenaya hassleriana [spider flower]
ref|XP_003546146.1|  PREDICTED: polyadenylate-binding protein RBP...    105   8e-24   Glycine max [soybeans]
ref|XP_004158014.1|  PREDICTED: polyadenylate-binding protein RBP...    104   8e-24   
ref|XP_004234481.1|  PREDICTED: polyadenylate-binding protein RBP...    105   8e-24   Solanum lycopersicum
ref|XP_010536077.1|  PREDICTED: polyadenylate-binding protein RBP...    105   8e-24   Tarenaya hassleriana [spider flower]
ref|XP_006343293.1|  PREDICTED: polyadenylate-binding protein RBP...    105   9e-24   Solanum tuberosum [potatoes]
ref|XP_009595795.1|  PREDICTED: polyadenylate-binding protein RBP...    105   1e-23   Nicotiana tomentosiformis
ref|XP_010495305.1|  PREDICTED: polyadenylate-binding protein RBP...    105   1e-23   Camelina sativa [gold-of-pleasure]
emb|CDX70874.1|  BnaC03g09580D                                          105   1e-23   
ref|XP_006400492.1|  hypothetical protein EUTSA_v10013617mg             105   1e-23   Eutrema salsugineum [saltwater cress]
ref|XP_010454207.1|  PREDICTED: polyadenylate-binding protein RBP...    105   1e-23   Camelina sativa [gold-of-pleasure]
ref|NP_001078604.1|  polyadenylate-binding protein RBP47B'              105   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871881.1|  hypothetical protein ARALYDRAFT_488820             105   2e-23   
emb|CDY13992.1|  BnaC09g38340D                                          105   2e-23   Brassica napus [oilseed rape]
ref|NP_197436.1|  polyadenylate-binding protein RBP47B'                 105   2e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92537.1|  BnaA10g15760D                                          105   2e-23   
ref|XP_009120895.1|  PREDICTED: polyadenylate-binding protein RBP...    105   2e-23   Brassica rapa
ref|XP_009120896.1|  PREDICTED: polyadenylate-binding protein RBP...    104   2e-23   Brassica rapa
emb|CDX88893.1|  BnaA03g07560D                                          105   2e-23   
ref|XP_007147735.1|  hypothetical protein PHAVU_006G150400g             104   2e-23   Phaseolus vulgaris [French bean]
ref|XP_003549897.1|  PREDICTED: polyadenylate-binding protein RBP...    104   2e-23   Glycine max [soybeans]
gb|AGV54881.1|  RNA-binding post-transcriptional regulator csx1-l...    104   2e-23   Phaseolus vulgaris [French bean]
ref|XP_004145107.1|  PREDICTED: polyadenylate-binding protein RBP...    104   2e-23   Cucumis sativus [cucumbers]
gb|KGN64531.1|  hypothetical protein Csa_1G063550                       104   2e-23   Cucumis sativus [cucumbers]
gb|AGV54456.1|  RNA-binding post-transcriptional regulator csx1-l...    104   3e-23   Phaseolus vulgaris [French bean]
ref|XP_008441163.1|  PREDICTED: polyadenylate-binding protein RBP...    104   3e-23   Cucumis melo [Oriental melon]
gb|KFK26199.1|  hypothetical protein AALP_AA8G215500                    104   3e-23   Arabis alpina [alpine rockcress]
ref|XP_008441139.1|  PREDICTED: polyadenylate-binding protein RBP...    104   3e-23   Cucumis melo [Oriental melon]
ref|XP_003543537.1|  PREDICTED: polyadenylate-binding protein RBP...    104   3e-23   Glycine max [soybeans]
ref|XP_008441138.1|  PREDICTED: polyadenylate-binding protein RBP...    103   3e-23   Cucumis melo [Oriental melon]
ref|XP_004145109.1|  PREDICTED: polyadenylate-binding protein RBP...    103   3e-23   Cucumis sativus [cucumbers]
ref|XP_007153936.1|  hypothetical protein PHAVU_003G077700g             103   3e-23   Phaseolus vulgaris [French bean]
ref|XP_008441142.1|  PREDICTED: polyadenylate-binding protein RBP...    103   3e-23   Cucumis melo [Oriental melon]
ref|XP_008441150.1|  PREDICTED: polyadenylate-binding protein RBP...    103   3e-23   Cucumis melo [Oriental melon]
ref|XP_010476096.1|  PREDICTED: polyadenylate-binding protein RBP...    103   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_001777334.1|  predicted protein                                  103   4e-23   
ref|XP_003543536.1|  PREDICTED: polyadenylate-binding protein RBP...    103   4e-23   Glycine max [soybeans]
ref|XP_010493089.1|  PREDICTED: polyadenylate-binding protein RBP...    103   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010476097.1|  PREDICTED: polyadenylate-binding protein RBP...    103   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010420736.1|  PREDICTED: polyadenylate-binding protein RBP...    103   4e-23   Camelina sativa [gold-of-pleasure]
gb|EPS64177.1|  hypothetical protein M569_10604                         103   4e-23   Genlisea aurea
ref|XP_009390905.1|  PREDICTED: polyadenylate-binding protein RBP...    103   5e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011037672.1|  PREDICTED: polyadenylate-binding protein RBP...    102   6e-23   Populus euphratica
ref|XP_006307499.1|  hypothetical protein CARUB_v10009124mg             103   6e-23   
ref|XP_009380242.1|  PREDICTED: polyadenylate-binding protein RBP...    103   6e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006348103.1|  PREDICTED: polyadenylate-binding protein RBP...    103   6e-23   Solanum tuberosum [potatoes]
ref|XP_007132012.1|  hypothetical protein PHAVU_011G059300g             103   6e-23   Phaseolus vulgaris [French bean]
gb|KEH36838.1|  polyadenylate-binding protein RBP47B                    102   6e-23   Medicago truncatula
ref|XP_003597428.1|  RNA-binding protein                                103   6e-23   Medicago truncatula
gb|KDO75474.1|  hypothetical protein CISIN_1g015091mg                   102   6e-23   Citrus sinensis [apfelsine]
ref|XP_009414748.1|  PREDICTED: polyadenylate-binding protein RBP...    103   6e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007150369.1|  hypothetical protein PHAVU_005G147800g             103   7e-23   Phaseolus vulgaris [French bean]
ref|XP_004153285.1|  PREDICTED: polyadenylate-binding protein RBP...    101   7e-23   
gb|KHN25246.1|  Polyadenylate-binding protein RBP47B'                   103   7e-23   Glycine soja [wild soybean]
ref|XP_003539457.1|  PREDICTED: polyadenylate-binding protein RBP...    103   8e-23   Glycine max [soybeans]
ref|XP_011037673.1|  PREDICTED: polyadenylate-binding protein RBP...    102   8e-23   Populus euphratica
gb|KFK43438.1|  hypothetical protein AALP_AA1G125300                    102   9e-23   Arabis alpina [alpine rockcress]
gb|ACN40970.1|  unknown                                                 102   1e-22   Picea sitchensis
gb|ACN39849.1|  unknown                                                 102   1e-22   Picea sitchensis
ref|XP_006449040.1|  hypothetical protein CICLE_v10015407mg             102   1e-22   
gb|KDO75475.1|  hypothetical protein CISIN_1g015091mg                   102   1e-22   Citrus sinensis [apfelsine]
ref|XP_011037671.1|  PREDICTED: polyadenylate-binding protein RBP...    102   1e-22   Populus euphratica
gb|KEH36837.1|  polyadenylate-binding protein RBP47B                    101   1e-22   Medicago truncatula
ref|XP_009404023.1|  PREDICTED: polyadenylate-binding protein RBP...    102   1e-22   
ref|XP_003537962.1|  PREDICTED: polyadenylate-binding protein RBP...    102   1e-22   
ref|XP_004232721.1|  PREDICTED: polyadenylate-binding protein RBP45     102   1e-22   Solanum lycopersicum
dbj|BAB08769.1|  unnamed protein product                                102   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009631416.1|  PREDICTED: polyadenylate-binding protein RBP...    102   1e-22   Nicotiana tomentosiformis
ref|XP_009631415.1|  PREDICTED: polyadenylate-binding protein RBP...    102   1e-22   Nicotiana tomentosiformis
ref|NP_568815.1|  RNA-binding protein 45A                               102   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417333.1|  hypothetical protein EUTSA_v10007819mg             102   1e-22   Eutrema salsugineum [saltwater cress]
ref|XP_009631417.1|  PREDICTED: polyadenylate-binding protein RBP...    102   1e-22   
ref|XP_011037670.1|  PREDICTED: polyadenylate-binding protein RBP...    102   1e-22   Populus euphratica
ref|XP_009131734.1|  PREDICTED: polyadenylate-binding protein RBP...    102   2e-22   Brassica rapa
ref|XP_002305583.2|  RNA-binding protein 45                             102   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_001784132.1|  predicted protein                                  102   2e-22   
ref|XP_006468021.1|  PREDICTED: polyadenylate-binding protein RBP...    102   2e-22   Citrus sinensis [apfelsine]
gb|KEH36836.1|  polyadenylate-binding protein RBP47B                    102   2e-22   Medicago truncatula
ref|XP_008782204.1|  PREDICTED: polyadenylate-binding protein RBP...    102   2e-22   Phoenix dactylifera
ref|XP_006449038.1|  hypothetical protein CICLE_v10015407mg             102   2e-22   Citrus clementina [clementine]
ref|XP_010278713.1|  PREDICTED: polyadenylate-binding protein RBP...    101   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_009417617.1|  PREDICTED: polyadenylate-binding protein RBP...    101   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010268845.1|  PREDICTED: polyadenylate-binding protein RBP...    102   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_006468022.1|  PREDICTED: polyadenylate-binding protein RBP...    102   2e-22   Citrus sinensis [apfelsine]
ref|XP_006449039.1|  hypothetical protein CICLE_v10015407mg             102   2e-22   Citrus clementina [clementine]
ref|XP_011096084.1|  PREDICTED: polyadenylate-binding protein RBP...    102   2e-22   Sesamum indicum [beniseed]
ref|XP_011096085.1|  PREDICTED: polyadenylate-binding protein RBP...    102   2e-22   Sesamum indicum [beniseed]
ref|XP_010268853.1|  PREDICTED: polyadenylate-binding protein RBP...    101   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010275609.1|  PREDICTED: polyadenylate-binding protein RBP...    101   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_002979510.1|  hypothetical protein SELMODRAFT_111082             102   2e-22   
ref|XP_010275610.1|  PREDICTED: polyadenylate-binding protein RBP...    101   3e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010278711.1|  PREDICTED: polyadenylate-binding protein RBP...    101   3e-22   Nelumbo nucifera [Indian lotus]
ref|XP_008782206.1|  PREDICTED: polyadenylate-binding protein RBP...    101   3e-22   
ref|XP_009772574.1|  PREDICTED: polyadenylate-binding protein RBP...    101   3e-22   Nicotiana sylvestris
ref|XP_002977811.1|  hypothetical protein SELMODRAFT_232989             102   3e-22   
ref|XP_003529629.1|  PREDICTED: polyadenylate-binding protein RBP45     101   3e-22   Glycine max [soybeans]
ref|XP_009772575.1|  PREDICTED: polyadenylate-binding protein RBP...    101   3e-22   Nicotiana sylvestris
ref|XP_010278708.1|  PREDICTED: polyadenylate-binding protein RBP...    101   3e-22   Nelumbo nucifera [Indian lotus]
dbj|BAK03410.1|  predicted protein                                      101   3e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN35750.1|  Polyadenylate-binding protein RBP45                     101   3e-22   Glycine soja [wild soybean]
dbj|BAE71244.1|  putative DNA binding protein                           101   3e-22   Trifolium pratense [peavine clover]
ref|XP_004486120.1|  PREDICTED: polyadenylate-binding protein RBP...    101   3e-22   Cicer arietinum [garbanzo]
ref|XP_010673626.1|  PREDICTED: polyadenylate-binding protein RBP...    101   4e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009418782.1|  PREDICTED: polyadenylate-binding protein RBP...    101   4e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004486966.1|  PREDICTED: polyadenylate-binding protein RBP...    101   4e-22   Cicer arietinum [garbanzo]
dbj|BAD05744.1|  putative RNA Binding Protein 45                        101   4e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004486967.1|  PREDICTED: polyadenylate-binding protein RBP...    101   4e-22   
ref|XP_010327242.1|  PREDICTED: polyadenylate-binding protein RBP...    100   5e-22   
ref|XP_006858185.1|  hypothetical protein AMTR_s00062p00161920          102   5e-22   
ref|NP_001144988.1|  uncharacterized protein LOC100278143               101   5e-22   Zea mays [maize]
ref|XP_004507696.1|  PREDICTED: polyadenylate-binding protein RBP...    100   5e-22   
ref|XP_004507695.1|  PREDICTED: polyadenylate-binding protein RBP...    100   5e-22   Cicer arietinum [garbanzo]
dbj|BAJ85879.1|  predicted protein                                      101   6e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004145357.1|  PREDICTED: polyadenylate-binding protein RBP...    100   6e-22   
ref|XP_010665562.1|  PREDICTED: polyadenylate-binding protein RBP...    100   7e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003580589.1|  PREDICTED: polyadenylate-binding protein RBP...    100   7e-22   Brachypodium distachyon [annual false brome]
gb|ACF87959.1|  unknown                                                 100   7e-22   Zea mays [maize]
ref|XP_004168889.1|  PREDICTED: polyadenylate-binding protein RBP...    100   7e-22   
ref|XP_010240455.1|  PREDICTED: polyadenylate-binding protein RBP...    100   8e-22   Brachypodium distachyon [annual false brome]
ref|XP_004248403.1|  PREDICTED: polyadenylate-binding protein RBP...    100   8e-22   Solanum lycopersicum
ref|XP_003578248.1|  PREDICTED: polyadenylate-binding protein RBP...    100   8e-22   Brachypodium distachyon [annual false brome]
ref|XP_009420609.1|  PREDICTED: polyadenylate-binding protein RBP45     100   8e-22   
ref|XP_009118182.1|  PREDICTED: polyadenylate-binding protein RBP...    100   8e-22   Brassica rapa
ref|XP_010327241.1|  PREDICTED: polyadenylate-binding protein RBP...    100   9e-22   Solanum lycopersicum
ref|XP_006649483.1|  PREDICTED: polyadenylate-binding protein RBP...    100   9e-22   Oryza brachyantha
ref|XP_010101438.1|  Polyadenylate-binding protein RBP45B               100   9e-22   
ref|XP_009118181.1|  PREDICTED: polyadenylate-binding protein RBP...    100   9e-22   Brassica rapa
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...    102   9e-22   Elaeis guineensis
gb|EYU27806.1|  hypothetical protein MIMGU_mgv1a007668mg                100   1e-21   Erythranthe guttata [common monkey flower]
ref|XP_008459212.1|  PREDICTED: polyadenylate-binding protein RBP47     100   1e-21   Cucumis melo [Oriental melon]
gb|AEW68341.1|  putative nuclear acid binding protein                 99.8    1e-21   Medicago sativa [alfalfa]
ref|XP_003610418.1|  RNA-binding protein                              99.0    1e-21   
ref|XP_006660711.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    1e-21   Oryza brachyantha
ref|XP_010910520.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    1e-21   
gb|KJB69302.1|  hypothetical protein B456_011G015300                  98.6    2e-21   Gossypium raimondii
ref|XP_006352618.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    2e-21   Solanum tuberosum [potatoes]
ref|XP_006352617.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    2e-21   Solanum tuberosum [potatoes]
ref|XP_007015033.1|  RNA-binding family protein isoform 1               100   2e-21   
emb|CDP04386.1|  unnamed protein product                              98.6    2e-21   Coffea canephora [robusta coffee]
gb|KJB69304.1|  hypothetical protein B456_011G015300                  98.6    2e-21   Gossypium raimondii
ref|XP_006287675.1|  hypothetical protein CARUB_v10000890mg             100   2e-21   
ref|XP_009614215.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    2e-21   Nicotiana tomentosiformis
ref|XP_009406502.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009776437.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    2e-21   Nicotiana sylvestris
ref|XP_009776429.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    2e-21   Nicotiana sylvestris
ref|XP_003610417.1|  RNA-binding protein                              99.0    2e-21   Medicago truncatula
emb|CAL25353.1|  ACBF-like dna binding protein                        97.1    2e-21   Platanus x hispanica [London plane tree]
ref|NP_001063403.1|  Os09g0462700                                     99.4    2e-21   
dbj|BAG87507.1|  unnamed protein product                              98.6    2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009406503.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006406534.1|  hypothetical protein EUTSA_v10020763mg           98.6    2e-21   
emb|CBI32444.3|  unnamed protein product                              98.6    2e-21   Vitis vinifera
ref|XP_002468416.1|  hypothetical protein SORBIDRAFT_01g045570        99.0    2e-21   Sorghum bicolor [broomcorn]
ref|XP_006401513.1|  hypothetical protein EUTSA_v10013710mg           99.0    2e-21   Eutrema salsugineum [saltwater cress]
emb|CDY34835.1|  BnaA09g47610D                                        99.0    2e-21   Brassica napus [oilseed rape]
gb|ACR34003.1|  unknown                                               99.0    2e-21   Zea mays [maize]
ref|NP_001152183.1|  LOC100285821                                     99.0    2e-21   Zea mays [maize]
ref|XP_006401514.1|  hypothetical protein EUTSA_v10013710mg           99.0    2e-21   Eutrema salsugineum [saltwater cress]
gb|KJB69305.1|  hypothetical protein B456_011G015300                  98.2    2e-21   Gossypium raimondii
ref|XP_003529385.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    2e-21   Glycine max [soybeans]
dbj|BAJ93453.1|  predicted protein                                    99.0    3e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010647773.1|  PREDICTED: polyadenylate-binding protein RBP...  99.0    3e-21   Vitis vinifera
gb|EMS68789.1|  Uncharacterized RNA-binding protein C23E6.01c         98.6    3e-21   Triticum urartu
gb|EEC74608.1|  hypothetical protein OsI_10216                        98.6    3e-21   Oryza sativa Indica Group [Indian rice]
gb|KCW63816.1|  hypothetical protein EUGRSUZ_G01492                   99.0    3e-21   Eucalyptus grandis [rose gum]
gb|ABF94248.1|  RNA recognition motif family protein, expressed       98.6    3e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CDY19874.1|  BnaC09g31400D                                        98.6    4e-21   Brassica napus [oilseed rape]
gb|AAM67293.1|  nuclear acid binding protein, putative                98.2    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010276065.1|  PREDICTED: polyadenylate-binding protein RBP...  98.6    4e-21   Nelumbo nucifera [Indian lotus]
dbj|BAE71189.1|  putative DNA binding protein                         97.1    4e-21   Trifolium pratense [peavine clover]
ref|XP_010066047.1|  PREDICTED: polyadenylate-binding protein RBP47   99.0    4e-21   
ref|XP_010276064.1|  PREDICTED: polyadenylate-binding protein RBP...  98.6    4e-21   Nelumbo nucifera [Indian lotus]
ref|NP_001049124.1|  Os03g0174100                                     98.6    5e-21   
ref|NP_188544.1|  RNA-binding protein 47B                             98.2    5e-21   Arabidopsis thaliana [mouse-ear cress]
gb|KJB69303.1|  hypothetical protein B456_011G015300                  98.2    5e-21   Gossypium raimondii
dbj|BAB02953.1|  DNA/RNA binding protein-like                         99.0    5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001132004.1|  uncharacterized protein LOC100193409             98.2    5e-21   Zea mays [maize]
ref|XP_009135617.1|  PREDICTED: polyadenylate-binding protein RBP...  97.8    5e-21   Brassica rapa
gb|KFK27100.1|  hypothetical protein AALP_AA8G334500                  97.8    5e-21   Arabis alpina [alpine rockcress]
gb|KJB69301.1|  hypothetical protein B456_011G015300                  98.2    5e-21   Gossypium raimondii
ref|XP_010546929.1|  PREDICTED: polyadenylate-binding protein RBP45B  97.8    6e-21   Tarenaya hassleriana [spider flower]
gb|KFK27101.1|  hypothetical protein AALP_AA8G334500                  97.8    6e-21   Arabis alpina [alpine rockcress]
gb|KDP20762.1|  hypothetical protein JCGZ_21233                       98.2    6e-21   Jatropha curcas
ref|XP_008667171.1|  PREDICTED: uncharacterized protein LOC100193...  98.2    6e-21   Zea mays [maize]
gb|EAZ27536.1|  hypothetical protein OsJ_11491                        96.7    6e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004957051.1|  PREDICTED: polyadenylate-binding protein RBP...  98.2    6e-21   Setaria italica
ref|XP_003573391.1|  PREDICTED: polyadenylate-binding protein RBP...  98.2    6e-21   Brachypodium distachyon [annual false brome]
ref|XP_008796097.1|  PREDICTED: polyadenylate-binding protein RBP45   97.8    7e-21   Phoenix dactylifera
ref|XP_003518846.1|  PREDICTED: polyadenylate-binding protein RBP...  97.8    7e-21   Glycine max [soybeans]
emb|CDX95462.1|  BnaC01g33540D                                        97.8    7e-21   
ref|XP_008813039.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    7e-21   Phoenix dactylifera
ref|XP_008813037.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    8e-21   
ref|XP_008797245.1|  PREDICTED: polyadenylate-binding protein RBP...  97.4    8e-21   Phoenix dactylifera
gb|AFK41944.1|  unknown                                               97.4    9e-21   Medicago truncatula
gb|ABF97193.1|  RNA recognition motif family protein, expressed       97.4    9e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009412453.1|  PREDICTED: polyadenylate-binding protein RBP45   97.8    9e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAG59664.1|AC084319_22  putative RNA binding protein               97.1    9e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CDY22988.1|  BnaC03g40810D                                        97.4    9e-21   Brassica napus [oilseed rape]
gb|EEC75600.1|  hypothetical protein OsI_12307                        97.4    9e-21   Oryza sativa Indica Group [Indian rice]
emb|CDY34639.1|  BnaC08g41980D                                        98.6    1e-20   Brassica napus [oilseed rape]
ref|XP_007156541.1|  hypothetical protein PHAVU_003G294800g           96.7    1e-20   Phaseolus vulgaris [French bean]
ref|XP_007156542.1|  hypothetical protein PHAVU_003G294800g           97.1    1e-20   Phaseolus vulgaris [French bean]
ref|XP_002885294.1|  RNA-binding protein 47B                          97.4    1e-20   
gb|AIN39817.1|  hypothetical protein                                  96.3    1e-20   Zoysia matrella [Japanese carpet grass]
ref|XP_002864364.1|  hypothetical protein ARALYDRAFT_495572           97.1    1e-20   
ref|XP_010907889.1|  PREDICTED: polyadenylate-binding protein RBP47   97.1    1e-20   Elaeis guineensis
ref|XP_006406535.1|  hypothetical protein EUTSA_v10020763mg           97.4    1e-20   Eutrema salsugineum [saltwater cress]
ref|XP_008813036.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    1e-20   Phoenix dactylifera
ref|XP_008806741.1|  PREDICTED: polyadenylate-binding protein RBP45   97.1    1e-20   Phoenix dactylifera
gb|KDP23018.1|  hypothetical protein JCGZ_01681                       97.1    1e-20   Jatropha curcas
ref|NP_001275480.1|  DNA binding protein ACBF-like                    96.7    1e-20   Solanum tuberosum [potatoes]
ref|XP_004985527.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    1e-20   Setaria italica
emb|CDY18570.1|  BnaA01g26250D                                        97.4    1e-20   Brassica napus [oilseed rape]
ref|XP_009112131.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    1e-20   Brassica rapa
gb|KJB79290.1|  hypothetical protein B456_013G042300                  95.9    1e-20   Gossypium raimondii
ref|NP_001168324.1|  hypothetical protein                             96.7    1e-20   Zea mays [maize]
ref|XP_010466046.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010487840.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    2e-20   Camelina sativa [gold-of-pleasure]
ref|NP_001050516.1|  Os03g0569900                                     97.1    2e-20   
ref|XP_010487839.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_004982540.1|  PREDICTED: polyadenylate-binding protein RBP...  96.7    2e-20   
ref|XP_009112124.1|  PREDICTED: polyadenylate-binding protein RBP...  97.4    2e-20   
ref|XP_010052834.1|  PREDICTED: polyadenylate-binding protein RBP...  95.9    2e-20   
ref|XP_010545222.1|  PREDICTED: polyadenylate-binding protein RBP...  96.7    2e-20   
ref|XP_009391347.1|  PREDICTED: polyadenylate-binding protein RBP...  96.3    2e-20   
ref|XP_010052833.1|  PREDICTED: polyadenylate-binding protein RBP...  95.9    2e-20   
gb|AGV54251.1|  RNA binding post-transcriptional regulator csx1 l...  96.3    2e-20   
ref|XP_006297696.1|  hypothetical protein CARUB_v10013726mg           96.7    2e-20   
ref|XP_011080284.1|  PREDICTED: polyadenylate-binding protein RBP...  96.3    2e-20   
ref|XP_006297697.1|  hypothetical protein CARUB_v10013726mg           96.7    2e-20   
ref|XP_002313840.2|  RNA-binding protein 47                           96.3    2e-20   
ref|XP_002973844.1|  hypothetical protein SELMODRAFT_100454           95.5    2e-20   
ref|XP_004505196.1|  PREDICTED: polyadenylate-binding protein RBP...  96.7    2e-20   
ref|XP_006346456.1|  PREDICTED: polyadenylate-binding protein RBP47   96.3    3e-20   
ref|XP_008349308.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    3e-20   
gb|KFK39249.1|  hypothetical protein AALP_AA3G219800                  96.3    3e-20   
gb|KHG16958.1|  Polyadenylate-binding RBP45B -like protein            96.7    3e-20   
ref|XP_006413118.1|  hypothetical protein EUTSA_v10025342mg           95.9    3e-20   
gb|KFK39248.1|  hypothetical protein AALP_AA3G219800                  96.3    3e-20   
ref|XP_002518798.1|  nuclear acid binding protein, putative           96.3    3e-20   
ref|XP_011010322.1|  PREDICTED: polyadenylate-binding protein RBP...  96.3    3e-20   
ref|XP_011010320.1|  PREDICTED: polyadenylate-binding protein RBP...  96.3    3e-20   
ref|XP_007042377.1|  RNA-binding protein 47A                          96.3    3e-20   
ref|XP_003549410.2|  PREDICTED: polyadenylate-binding protein RBP...  95.9    3e-20   
gb|AFW58430.1|  nucleic acid binding protein                          94.4    3e-20   
ref|XP_002464324.1|  hypothetical protein SORBIDRAFT_01g016170        95.9    3e-20   
gb|KJB79291.1|  hypothetical protein B456_013G042300                  95.9    3e-20   
gb|KJB79289.1|  hypothetical protein B456_013G042300                  96.3    3e-20   
ref|XP_008444645.1|  PREDICTED: polyadenylate-binding protein RBP...  95.9    3e-20   
ref|XP_004152729.1|  PREDICTED: polyadenylate-binding protein RBP...  95.9    4e-20   
ref|XP_009357435.1|  PREDICTED: polyadenylate-binding protein RBP...  95.1    4e-20   
ref|XP_003544447.1|  PREDICTED: polyadenylate-binding protein RBP...  95.9    4e-20   
ref|XP_002979028.1|  hypothetical protein SELMODRAFT_418663           95.5    4e-20   
ref|XP_007160823.1|  hypothetical protein PHAVU_001G019600g           95.5    4e-20   
ref|XP_010930147.1|  PREDICTED: polyadenylate-binding protein RBP45   95.5    4e-20   
ref|XP_008365193.1|  PREDICTED: polyadenylate-binding protein RBP...  95.5    4e-20   
ref|XP_002446570.1|  hypothetical protein SORBIDRAFT_06g018280        95.5    4e-20   
ref|XP_004230808.1|  PREDICTED: polyadenylate-binding protein RBP47   95.5    4e-20   
gb|ACG32072.1|  nucleic acid binding protein                          95.1    4e-20   
ref|XP_010923889.1|  PREDICTED: polyadenylate-binding protein RBP...  95.9    4e-20   
ref|XP_007017334.1|  RNA-binding protein 47C isoform 6                94.7    5e-20   
ref|XP_010507446.1|  PREDICTED: polyadenylate-binding protein RBP...  95.9    5e-20   
gb|KDO84283.1|  hypothetical protein CISIN_1g037458mg                 93.2    5e-20   
ref|XP_010507452.1|  PREDICTED: polyadenylate-binding protein RBP...  95.9    5e-20   
ref|XP_009358068.1|  PREDICTED: polyadenylate-binding protein RBP...  95.1    5e-20   
ref|XP_003634360.1|  PREDICTED: polyadenylate-binding protein RBP...  95.5    5e-20   
ref|XP_008349307.1|  PREDICTED: polyadenylate-binding protein RBP...  94.4    5e-20   
ref|XP_006280607.1|  hypothetical protein CARUB_v10026566mg           95.1    5e-20   
ref|XP_010052832.1|  PREDICTED: polyadenylate-binding protein RBP...  95.5    6e-20   
ref|XP_004976877.1|  PREDICTED: polyadenylate-binding protein RBP...  95.5    6e-20   
ref|XP_007017335.1|  RNA-binding protein 47C isoform 7                94.4    6e-20   
ref|XP_009120017.1|  PREDICTED: polyadenylate-binding protein RBP45A  95.1    6e-20   
ref|XP_007026047.1|  RNA-binding family protein                       95.1    6e-20   
ref|XP_006370698.1|  hypothetical protein POPTR_0001s45000g           95.1    6e-20   
gb|KJB47422.1|  hypothetical protein B456_008G025400                  94.7    7e-20   
gb|KJB47423.1|  hypothetical protein B456_008G025400                  94.7    7e-20   
ref|NP_001150649.1|  nucleic acid binding protein                     95.1    7e-20   
gb|ACF85767.1|  unknown                                               95.1    7e-20   
gb|KJB63806.1|  hypothetical protein B456_010G017300                  94.4    7e-20   
emb|CDY17286.1|  BnaA10g09200D                                        94.7    7e-20   
ref|NP_001052934.2|  Os04g0449900                                     94.7    7e-20   
emb|CDX92304.1|  BnaA05g21030D                                        95.1    7e-20   
gb|ABR18422.1|  unknown                                               95.1    7e-20   
gb|EYU46265.1|  hypothetical protein MIMGU_mgv1a007107mg              95.1    7e-20   
ref|XP_010313279.1|  PREDICTED: polyadenylate-binding protein RBP...  95.1    7e-20   
ref|XP_004250947.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    7e-20   
gb|KHG27259.1|  Polyadenylate-binding RBP47                           94.4    7e-20   
ref|XP_007017333.1|  RNA-binding protein 47C isoform 5                94.4    8e-20   
gb|KDP38389.1|  hypothetical protein JCGZ_04314                       95.1    8e-20   
ref|XP_007017332.1|  RNA-binding protein 47C isoform 4                94.4    8e-20   
emb|CDX99265.1|  BnaC05g33800D                                        94.7    9e-20   
gb|EMS52025.1|  RNA-binding post-transcriptional regulator csx1       95.9    9e-20   
gb|EPS57677.1|  hypothetical protein M569_17140                       94.7    9e-20   
ref|XP_007017330.1|  RNA-binding protein 47C isoform 2                94.4    9e-20   
gb|EPS67039.1|  hypothetical protein M569_07737                       94.4    1e-19   
ref|XP_009352469.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    1e-19   
ref|XP_008349306.1|  PREDICTED: polyadenylate-binding protein RBP...  94.0    1e-19   
gb|EAY94326.1|  hypothetical protein OsI_16094                        94.7    1e-19   
emb|CAH67097.1|  H0818E04.14                                          94.7    1e-19   
ref|XP_008392304.1|  PREDICTED: polyadenylate-binding protein RBP47   94.7    1e-19   
ref|XP_011030480.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    1e-19   
ref|XP_011030472.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    1e-19   
ref|XP_011030463.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    1e-19   
ref|XP_007020874.1|  RNA-binding family protein                       94.4    1e-19   
ref|XP_006653468.1|  PREDICTED: polyadenylate-binding protein RBP...  94.4    1e-19   
ref|XP_003608019.1|  RNA Binding Protein                              94.7    1e-19   
dbj|BAJ85753.1|  predicted protein                                    94.0    1e-19   
ref|XP_009145825.1|  PREDICTED: polyadenylate-binding protein RBP...  94.4    1e-19   
ref|XP_008349848.1|  PREDICTED: polyadenylate-binding protein RBP...  93.2    1e-19   
dbj|BAJ87828.1|  predicted protein                                    94.0    1e-19   
ref|XP_006434825.1|  hypothetical protein CICLE_v10001214mg           93.2    1e-19   
ref|XP_009137630.1|  PREDICTED: polyadenylate-binding protein RBP...  94.4    1e-19   
ref|XP_010540323.1|  PREDICTED: polyadenylate-binding protein RBP47B  94.4    1e-19   
gb|AFK40720.1|  unknown                                               94.7    1e-19   
ref|XP_010525621.1|  PREDICTED: polyadenylate-binding protein RBP...  94.4    1e-19   
dbj|BAC83714.1|  RNA Binding Protein-like                             92.0    1e-19   
emb|CDY46671.1|  BnaA03g48370D                                        94.4    1e-19   
gb|KDP39118.1|  hypothetical protein JCGZ_00875                       94.0    1e-19   
ref|XP_007017331.1|  RNA-binding protein 47C isoform 3                94.4    1e-19   
ref|XP_010098709.1|  Polyadenylate-binding protein RBP47C             94.4    1e-19   
emb|CDX92786.1|  BnaC07g40440D                                        94.4    1e-19   
ref|XP_010675694.1|  PREDICTED: polyadenylate-binding protein RBP45   94.0    1e-19   
ref|XP_004975779.1|  PREDICTED: polyadenylate-binding protein RBP...  94.4    1e-19   
ref|XP_007017329.1|  RNA-binding protein 47C isoform 1                94.4    1e-19   
ref|XP_006434824.1|  hypothetical protein CICLE_v10001214mg           93.2    2e-19   
gb|KJB63805.1|  hypothetical protein B456_010G017300                  94.4    2e-19   
ref|XP_002510266.1|  nuclear acid binding protein, putative           94.4    2e-19   
ref|XP_004972674.1|  PREDICTED: polyadenylate-binding protein RBP...  94.4    2e-19   
ref|XP_009615947.1|  PREDICTED: polyadenylate-binding protein RBP...  94.0    2e-19   
ref|XP_009768585.1|  PREDICTED: polyadenylate-binding protein RBP...  94.0    2e-19   
ref|XP_004972673.1|  PREDICTED: polyadenylate-binding protein RBP...  94.4    2e-19   
ref|XP_003579863.1|  PREDICTED: polyadenylate-binding protein RBP...  94.0    2e-19   
ref|XP_002285031.1|  PREDICTED: polyadenylate-binding protein RBP...  94.0    2e-19   
gb|KJB58433.1|  hypothetical protein B456_009G209600                  93.2    2e-19   
ref|XP_002963882.1|  hypothetical protein SELMODRAFT_80061            92.8    2e-19   
gb|AFW61057.1|  hypothetical protein ZEAMMB73_234884                  92.8    2e-19   
gb|KJB59840.1|  hypothetical protein B456_009G275200                  93.6    2e-19   
ref|XP_009372712.1|  PREDICTED: polyadenylate-binding protein RBP...  93.6    2e-19   
ref|XP_009356988.1|  PREDICTED: polyadenylate-binding protein RBP...  94.0    2e-19   
ref|XP_006361747.1|  PREDICTED: polyadenylate-binding protein RBP...  93.6    2e-19   
ref|XP_006361746.1|  PREDICTED: polyadenylate-binding protein RBP...  93.6    2e-19   
ref|XP_008385660.1|  PREDICTED: polyadenylate-binding protein RBP...  93.6    2e-19   
gb|EAZ04063.1|  hypothetical protein OsI_26200                        92.8    2e-19   
gb|EAZ40017.1|  hypothetical protein OsJ_24455                        92.4    3e-19   
ref|XP_010519119.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  93.6    3e-19   
gb|ABK25253.1|  unknown                                               94.4    3e-19   
ref|XP_006659900.1|  PREDICTED: polyadenylate-binding protein RBP...  93.6    3e-19   
gb|KJB81765.1|  hypothetical protein B456_013G160200                  92.4    3e-19   
ref|XP_011000065.1|  PREDICTED: polyadenylate-binding protein RBP47   93.6    3e-19   
gb|KHG24367.1|  Polyadenylate-binding RBP47                           92.8    3e-19   
ref|XP_006473363.1|  PREDICTED: polyadenylate-binding protein RBP...  93.6    3e-19   
ref|XP_002988285.1|  hypothetical protein SELMODRAFT_447249           92.8    3e-19   
ref|XP_006434827.1|  hypothetical protein CICLE_v10001214mg           93.6    3e-19   
ref|XP_003558701.1|  PREDICTED: polyadenylate-binding protein RBP...  93.2    3e-19   
gb|ABK24911.1|  unknown                                               92.8    3e-19   
ref|XP_010523211.1|  PREDICTED: polyadenylate-binding protein RBP...  93.6    4e-19   
ref|XP_007136663.1|  hypothetical protein PHAVU_009G063200g           93.2    4e-19   
emb|CDX95176.1|  BnaC09g16940D                                        93.2    4e-19   
ref|XP_008224811.1|  PREDICTED: polyadenylate-binding protein RBP...  92.0    4e-19   
ref|XP_011004995.1|  PREDICTED: polyadenylate-binding protein RBP...  93.2    4e-19   
gb|KJB13665.1|  hypothetical protein B456_002G088100                  92.8    4e-19   
ref|XP_010448802.1|  PREDICTED: polyadenylate-binding protein RBP...  92.4    4e-19   
ref|XP_011092727.1|  PREDICTED: polyadenylate-binding protein RBP...  92.4    4e-19   
gb|KJB58432.1|  hypothetical protein B456_009G209600                  93.2    4e-19   
gb|KJB13664.1|  hypothetical protein B456_002G088100                  92.8    4e-19   
gb|KJB13666.1|  hypothetical protein B456_002G088100                  92.8    4e-19   
gb|KHG01774.1|  Polyadenylate-binding RBP45C -like protein            92.8    4e-19   
ref|XP_011092726.1|  PREDICTED: polyadenylate-binding protein RBP...  92.8    4e-19   
emb|CDY32840.1|  BnaC08g02620D                                        92.8    4e-19   
gb|KEH40057.1|  polyadenylate-binding protein RBP47C                  92.0    4e-19   
ref|XP_006384437.1|  hypothetical protein POPTR_0004s15080g           92.8    5e-19   
gb|KHG01821.1|  Polyadenylate-binding RBP47C -like protein            92.4    5e-19   
ref|XP_008792645.1|  PREDICTED: polyadenylate-binding protein RBP...  92.8    5e-19   
ref|XP_006374988.1|  RNA-binding protein 47                           92.8    5e-19   
gb|KJB81762.1|  hypothetical protein B456_013G160200                  92.0    5e-19   
ref|XP_011013053.1|  PREDICTED: polyadenylate-binding protein RBP...  92.8    5e-19   
emb|CDY28101.1|  BnaC06g02820D                                        92.8    5e-19   
ref|XP_008226922.1|  PREDICTED: polyadenylate-binding protein RBP45C  92.4    5e-19   
ref|XP_011017227.1|  PREDICTED: polyadenylate-binding protein RBP...  92.8    5e-19   
gb|AFW61056.1|  hypothetical protein ZEAMMB73_234884                  93.2    5e-19   
gb|KEH35744.1|  polyadenylate-binding protein RBP47C                  91.7    5e-19   
emb|CDY50959.1|  BnaA06g37550D                                        92.8    5e-19   
ref|XP_009147873.1|  PREDICTED: polyadenylate-binding protein RBP47A  92.8    5e-19   
ref|XP_010438672.1|  PREDICTED: polyadenylate-binding protein RBP45C  92.8    5e-19   
ref|XP_010448184.1|  PREDICTED: polyadenylate-binding protein RBP...  92.8    5e-19   
ref|XP_008676816.1|  PREDICTED: uncharacterized protein LOC100273...  93.2    5e-19   
ref|XP_009107272.1|  PREDICTED: polyadenylate-binding protein RBP...  92.8    5e-19   
emb|CDY16528.1|  BnaA08g02390D                                        92.8    5e-19   
ref|XP_007213954.1|  hypothetical protein PRUPE_ppa006577mg           92.4    5e-19   
gb|KCW70174.1|  hypothetical protein EUGRSUZ_F03462                   91.3    5e-19   
ref|NP_001141359.1|  uncharacterized protein LOC100273450             92.8    5e-19   
gb|KDO49121.1|  hypothetical protein CISIN_1g013061mg                 91.7    5e-19   
emb|CDY52067.1|  BnaA09g53390D                                        92.4    6e-19   
ref|XP_009114049.1|  PREDICTED: polyadenylate-binding protein RBP...  92.4    6e-19   
gb|EYU37704.1|  hypothetical protein MIMGU_mgv1a006826mg              92.8    6e-19   
gb|KHN04518.1|  Polyadenylate-binding protein RBP47C                  92.0    6e-19   
gb|KDO49118.1|  hypothetical protein CISIN_1g013061mg                 91.7    6e-19   
gb|KFK29206.1|  hypothetical protein AALP_AA7G103000                  92.0    6e-19   
gb|KJB81761.1|  hypothetical protein B456_013G160200                  92.4    6e-19   
ref|XP_009367486.1|  PREDICTED: polyadenylate-binding protein RBP...  92.4    6e-19   
gb|KJB81764.1|  hypothetical protein B456_013G160200                  92.4    6e-19   
gb|KDO49120.1|  hypothetical protein CISIN_1g013061mg                 91.3    6e-19   
ref|XP_004501589.1|  PREDICTED: polyadenylate-binding protein RBP...  92.4    7e-19   
gb|KDO49119.1|  hypothetical protein CISIN_1g013061mg                 91.7    7e-19   
ref|XP_003523906.1|  PREDICTED: polyadenylate-binding protein RBP...  92.0    7e-19   
ref|XP_006423053.1|  hypothetical protein CICLE_v10028454mg           91.7    7e-19   
ref|XP_006283830.1|  hypothetical protein CARUB_v10004931mg           92.0    8e-19   
ref|XP_002316998.2|  RNA-binding protein 45                           92.0    8e-19   
ref|XP_008393835.1|  PREDICTED: polyadenylate-binding protein RBP...  92.4    8e-19   
ref|XP_008220171.1|  PREDICTED: polyadenylate-binding protein RBP...  92.4    9e-19   
ref|XP_008220170.1|  PREDICTED: polyadenylate-binding protein RBP...  92.4    9e-19   
ref|XP_008361011.1|  PREDICTED: polyadenylate-binding protein RBP...  92.4    9e-19   
ref|XP_008224810.1|  PREDICTED: polyadenylate-binding protein RBP...  91.7    9e-19   
ref|XP_007222286.1|  hypothetical protein PRUPE_ppa005903mg           92.0    9e-19   
gb|AFW59518.1|  hypothetical protein ZEAMMB73_768040                  90.9    9e-19   
ref|XP_004294372.1|  PREDICTED: polyadenylate-binding protein RBP45C  92.0    9e-19   
ref|NP_001168401.1|  hypothetical protein                             92.0    9e-19   
ref|XP_011030800.1|  PREDICTED: polyadenylate-binding protein RBP...  91.7    1e-18   
emb|CDY66423.1|  BnaAnng22220D                                        92.0    1e-18   
ref|XP_007211969.1|  hypothetical protein PRUPE_ppa006617mg           91.7    1e-18   
ref|XP_010433418.1|  PREDICTED: polyadenylate-binding protein RBP45C  91.7    1e-18   
ref|XP_011083821.1|  PREDICTED: polyadenylate-binding protein RBP...  92.0    1e-18   
ref|XP_009794615.1|  PREDICTED: polyadenylate-binding protein RBP...  91.3    1e-18   
ref|XP_006452315.1|  hypothetical protein CICLE_v10008440mg           90.5    1e-18   
ref|XP_010482899.1|  PREDICTED: polyadenylate-binding protein RBP...  91.3    1e-18   
gb|KHN22302.1|  Polyadenylate-binding protein RBP47C                  91.3    1e-18   
ref|XP_009145104.1|  PREDICTED: polyadenylate-binding protein RBP...  91.7    1e-18   
emb|CDP18029.1|  unnamed protein product                              92.0    1e-18   
ref|XP_010092144.1|  Polyadenylate-binding protein RBP45              92.4    1e-18   
ref|XP_009370172.1|  PREDICTED: polyadenylate-binding protein RBP...  91.7    2e-18   
ref|XP_009370171.1|  PREDICTED: polyadenylate-binding protein RBP...  91.7    2e-18   
gb|AFK35123.1|  unknown                                               91.3    2e-18   
emb|CDP01376.1|  unnamed protein product                              90.9    2e-18   
gb|KEH40058.1|  polyadenylate-binding protein RBP47C                  91.3    2e-18   
ref|XP_002280601.1|  PREDICTED: polyadenylate-binding protein RBP...  91.3    2e-18   
ref|XP_003528246.1|  PREDICTED: polyadenylate-binding protein RBP...  91.3    2e-18   
emb|CDY29341.1|  BnaA05g16080D                                        91.3    2e-18   
ref|XP_006480131.1|  PREDICTED: polyadenylate-binding protein RBP...  91.7    2e-18   
gb|KDO49116.1|  hypothetical protein CISIN_1g013061mg                 91.7    2e-18   
gb|AFW59516.1|  hypothetical protein ZEAMMB73_768040                  91.3    2e-18   
ref|XP_006393234.1|  hypothetical protein EUTSA_v10011485mg           91.3    2e-18   



>sp|Q9LEB4.1|RBP45_NICPL RecName: Full=Polyadenylate-binding protein RBP45; Short=Poly(A)-binding 
protein RBP45; AltName: Full=RNA-binding protein 
45; Short=NplRBP45 [Nicotiana plumbaginifolia]
 emb|CAC01237.1| RNA Binding Protein 45 [Nicotiana plumbaginifolia]
Length=409

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV+SLWIGDLQYWMDENY++TCF HTGEL S+KVIRNK TGQSEGYGF+EFRSHAAAE I
Sbjct  82   EVRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQTGQSEGYGFLEFRSHAAAETI  141



>ref|XP_009795696.1| PREDICTED: polyadenylate-binding protein RBP45 [Nicotiana sylvestris]
Length=409

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV+SLWIGDLQYWMDENY++TCF HTGEL S+KVIRNK TGQSEGYGF+EFRSHAAAE I
Sbjct  82   EVRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQTGQSEGYGFLEFRSHAAAETI  141



>ref|XP_009600135.1| PREDICTED: polyadenylate-binding protein RBP45 [Nicotiana tomentosiformis]
Length=410

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV+SLWIGDLQYWMDENY++TCF HTGEL S+KVIRNK TGQSEGYGF+EFRSHAAAE I
Sbjct  83   EVRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQTGQSEGYGFLEFRSHAAAETI  142



>gb|EYU33637.1| hypothetical protein MIMGU_mgv1a007175mg [Erythranthe guttata]
Length=416

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E++SLWIGDLQYWMDENY+NTCF HTGEL S+KVIRNK +GQSEGYGF+EFR+HAAAE I
Sbjct  77   EIRSLWIGDLQYWMDENYLNTCFYHTGELVSAKVIRNKQSGQSEGYGFLEFRTHAAAETI  136



>ref|XP_006346222.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=414

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E++SLWIGDLQYWMDENY++TCF HTGEL S+KVIRNK +GQSEGYGF+EFRSHAAAE +
Sbjct  83   ELRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQSGQSEGYGFLEFRSHAAAETV  142



>ref|XP_011097972.1| PREDICTED: polyadenylate-binding protein RBP45-like [Sesamum 
indicum]
Length=376

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV+SLWIGDLQYWMDENY+ +CF HTGEL S+K+IRNK TGQSEGYGF+EFR+HA AENI
Sbjct  50   EVRSLWIGDLQYWMDENYLTSCFYHTGELVSAKIIRNKQTGQSEGYGFLEFRTHATAENI  109



>ref|XP_004244127.1| PREDICTED: polyadenylate-binding protein RBP45 [Solanum lycopersicum]
Length=410

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV+SLWIGDLQYWMDE+Y++TCF HTGEL S+KVIRNK +GQSEGYGF+EFRSHAAAE +
Sbjct  79   EVRSLWIGDLQYWMDESYLSTCFYHTGELVSAKVIRNKQSGQSEGYGFLEFRSHAAAETV  138



>ref|XP_008345010.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Malus 
domestica]
 ref|XP_008363573.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Malus 
domestica]
Length=442

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DENY+NTCFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  35   EVRTLWIGDLQYWVDENYLNTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERV  94



>ref|XP_009375056.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Pyrus 
x bretschneideri]
Length=442

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DENY+NTCFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  35   EVRTLWIGDLQYWVDENYLNTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERV  94



>ref|XP_009376881.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Pyrus 
x bretschneideri]
 ref|XP_009347313.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Pyrus 
x bretschneideri]
 ref|XP_009347319.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Pyrus 
x bretschneideri]
Length=442

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DENY+NTCFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  35   EVRTLWIGDLQYWVDENYLNTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERV  94



>ref|XP_008377253.1| PREDICTED: polyadenylate-binding protein RBP47B' [Malus domestica]
Length=431

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DENY+NTCFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  24   EVRTLWIGDLQYWVDENYLNTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERV  83



>ref|XP_007209154.1| hypothetical protein PRUPE_ppa005940mg [Prunus persica]
 gb|EMJ10353.1| hypothetical protein PRUPE_ppa005940mg [Prunus persica]
Length=436

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DENY+ TCFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  31   EVRTLWIGDLQYWVDENYLTTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERV  90



>ref|XP_007015035.1| RNA-binding family protein isoform 3 [Theobroma cacao]
 gb|EOY32654.1| RNA-binding family protein isoform 3 [Theobroma cacao]
Length=423

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHAAAERI  77



>ref|XP_002518499.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF43886.1| nuclear acid binding protein, putative [Ricinus communis]
Length=430

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYIN+CFAHTGE+TS KVIRNK TGQ EGYGF+EF SH  AE I
Sbjct  87   EVRTLWIGDLQYWMDENYINSCFAHTGEVTSVKVIRNKQTGQVEGYGFIEFGSHGTAERI  146



>ref|XP_007015034.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY32653.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=423

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHAAAERI  77



>ref|XP_008238181.1| PREDICTED: polyadenylate-binding protein RBP47B' [Prunus mume]
Length=437

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DENY+ TCFAHTG L S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  31   EVRTLWIGDLQYWVDENYLTTCFAHTGSLISIKIIRNKITGQPEGYGFVEFVSHAAAERV  90



>ref|XP_002285479.1| PREDICTED: polyadenylate-binding protein RBP47B' [Vitis vinifera]
Length=447

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DENY+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  39   EVRTLWIGDLQYWVDENYLHSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  98



>emb|CBI16387.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DENY+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  39   EVRTLWIGDLQYWVDENYLHSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  98



>ref|XP_004288602.1| PREDICTED: polyadenylate-binding protein RBP47B' [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DENY+ +CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  10   EVRTLWIGDLQYWVDENYLTSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  69



>ref|XP_010108648.1| Polyadenylate-binding protein RBP47B' [Morus notabilis]
 gb|EXC19904.1| Polyadenylate-binding protein RBP47B' [Morus notabilis]
Length=469

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQ+W+DENY+N+CF+HTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  34   EVRTLWIGDLQFWVDENYLNSCFSHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAERI  93



>dbj|BAH56983.1| AT1G11650 [Arabidopsis thaliana]
Length=271

 Score =   107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWMDEN++  CFAHTGE+ S+KVIRNK TGQ EGYGF+EF SHAAAE +
Sbjct  60   EIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERV  119



>ref|XP_008437079.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X3 [Cucumis 
melo]
Length=422

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DE+Y+N+CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  77



>gb|KDO61276.1| hypothetical protein CISIN_1g014513mg [Citrus sinensis]
Length=394

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DENY+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  22   EVRTLWIGDLQYWFDENYLSSCFAHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAERV  81



>ref|XP_008437078.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X2 [Cucumis 
melo]
Length=425

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DE+Y+N+CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  77



>ref|XP_004152401.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Cucumis 
sativus]
Length=422

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DE+Y+N+CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  77



>ref|XP_008437076.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Cucumis 
melo]
 ref|XP_008437077.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Cucumis 
melo]
Length=427

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DE+Y+N+CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  77



>ref|XP_004164285.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
RBP47B'-like [Cucumis sativus]
Length=427

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DE+Y+N+CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  77



>gb|KDP22083.1| hypothetical protein JCGZ_25914 [Jatropha curcas]
Length=416

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DENY+++CFAHTGE+ + K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  20   EVRTLWIGDLQYWVDENYLSSCFAHTGEVVTIKIIRNKITGQPEGYGFVEFVSHAAAERI  79



>ref|XP_006845940.1| hypothetical protein AMTR_s00157p00080130 [Amborella trichopoda]
 gb|ERN07615.1| hypothetical protein AMTR_s00157p00080130 [Amborella trichopoda]
Length=291

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E KSLW+GDLQYWMDENY+N+CF HTGE+ S KVIRNK TGQSEGYGFVEF S AAAE I
Sbjct  77   ENKSLWVGDLQYWMDENYLNSCFGHTGEVVSLKVIRNKQTGQSEGYGFVEFVSRAAAEKI  136



>ref|XP_006446110.1| hypothetical protein CICLE_v10015576mg [Citrus clementina]
 gb|ESR59350.1| hypothetical protein CICLE_v10015576mg [Citrus clementina]
Length=385

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DENY+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  22   EVRTLWIGDLQYWFDENYLSSCFAHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAERV  81



>gb|KDO61275.1| hypothetical protein CISIN_1g014513mg [Citrus sinensis]
Length=423

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DENY+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  22   EVRTLWIGDLQYWFDENYLSSCFAHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAERV  81



>ref|XP_006850190.1| hypothetical protein AMTR_s00022p00247520 [Amborella trichopoda]
 gb|ERN11771.1| hypothetical protein AMTR_s00022p00247520 [Amborella trichopoda]
Length=451

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYW+DENY++TCF+HTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  43   EIRTLWIGDLQYWVDENYLHTCFSHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  102



>ref|XP_010031800.1| PREDICTED: polyadenylate-binding protein RBP47B' [Eucalyptus 
grandis]
 gb|KCW51191.1| hypothetical protein EUGRSUZ_J00778 [Eucalyptus grandis]
Length=421

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EVK+LWIGDLQYW+DE+Y+  CFAHTGE+ S K+IRNKLTGQ EGYGFVEF SHAAAE I
Sbjct  20   EVKTLWIGDLQYWVDESYLYGCFAHTGEVVSVKIIRNKLTGQPEGYGFVEFMSHAAAERI  79



>gb|KGN50253.1| hypothetical protein Csa_5G162020 [Cucumis sativus]
Length=420

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DE+Y+N+CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  77



>ref|NP_849641.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
 gb|AEE28765.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
Length=306

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWMDEN++  CFAHTGE+ S+KVIRNK TGQ EGYGF+EF SHAAAE +
Sbjct  60   EIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERV  119



>ref|XP_002513488.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF48891.1| nuclear acid binding protein, putative [Ricinus communis]
Length=412

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DENY+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SH AAE I
Sbjct  20   EVRTLWIGDLQYWVDENYLSSCFAHTGEVLSIKIIRNKITGQPEGYGFVEFVSHVAAERI  79



>ref|XP_002313332.2| hypothetical protein POPTR_0009s05920g [Populus trichocarpa]
 gb|EEE87287.2| hypothetical protein POPTR_0009s05920g [Populus trichocarpa]
Length=416

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DE+Y+ +CFAHTGE+ S K+IRNKLTGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWADESYLTSCFAHTGEVVSIKIIRNKLTGQPEGYGFVEFVSHAAAERI  77



>ref|XP_011025522.1| PREDICTED: polyadenylate-binding protein RBP47B' [Populus euphratica]
Length=416

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DE+Y+ +CFAHTGE+ S K+IRNKLTGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWADESYLTSCFAHTGEVVSIKIIRNKLTGQPEGYGFVEFVSHAAAERI  77



>gb|KJB09397.1| hypothetical protein B456_001G139100 [Gossypium raimondii]
Length=395

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TGQ EGYGFVEF SH AAE I
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHQAAERI  77



>ref|XP_006594429.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Glycine 
max]
Length=314

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCFAHTGE+TS KVIRNK T QSEGYGF+EF S A AE I
Sbjct  64   EVRTLWIGDLQYWMDENYLYTCFAHTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAGAERI  123



>ref|XP_006470600.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Citrus 
sinensis]
Length=424

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DENY+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  22   EVRTLWIGDLQYWFDENYLSSCFAHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAERV  81



>gb|KJB09396.1| hypothetical protein B456_001G139100 [Gossypium raimondii]
Length=423

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TGQ EGYGFVEF SH AAE I
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHQAAERI  77



>gb|KHG09232.1| Polyadenylate-binding RBP47B' -like protein [Gossypium arboreum]
Length=423

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TGQ EGYGFVEF SH AAE I
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHQAAERI  77



>ref|XP_004153512.1| PREDICTED: polyadenylate-binding protein RBP45-like, partial 
[Cucumis sativus]
Length=176

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123



>gb|KJB09398.1| hypothetical protein B456_001G139100 [Gossypium raimondii]
Length=372

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TGQ EGYGFVEF SH AAE I
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHQAAERI  77



>ref|XP_002889883.1| ATRBP45B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66142.1| ATRBP45B [Arabidopsis lyrata subsp. lyrata]
Length=408

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWMDEN++  CFAHTGE+ S+KVIRNK TGQ EGYGF+EF SHAAAE +
Sbjct  62   EIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERV  121



>ref|NP_172630.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
 sp|Q9SAB3.1|RB45B_ARATH RecName: Full=Polyadenylate-binding protein RBP45B; Short=Poly(A)-binding 
protein RBP45B; AltName: Full=RNA-binding protein 
45B; Short=AtRBP45B [Arabidopsis thaliana]
 gb|AAD30259.1|AC007296_20 Similar to gb|U90212 DNA binding protein ACBF from Nicotiana 
tabacum and contains 3 PF|00076 RNA recognition motif domains. 
ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, 
gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, 
gb|F15495 and gb|Z30868 come from this gene [Arabidopsis 
thaliana]
 gb|AAM13200.1| similar to gb|U90212 DNA binding protein ACBF from Nicotiana 
tabacum and contains 3 PF|00076 RNA recognition motif domains 
[Arabidopsis thaliana]
 gb|AAP37853.1| At1g11650 [Arabidopsis thaliana]
 gb|AEE28764.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
Length=405

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWMDEN++  CFAHTGE+ S+KVIRNK TGQ EGYGF+EF SHAAAE +
Sbjct  60   EIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERV  119



>gb|AAM64532.1| putative DNA binding protein [Arabidopsis thaliana]
Length=404

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWMDEN++  CFAHTGE+ S+KVIRNK TGQ EGYGF+EF SHAAAE +
Sbjct  59   EIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERV  118



>gb|KJB21880.1| hypothetical protein B456_004G019500 [Gossypium raimondii]
Length=424

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TG  EGYGFVEF SHAAAE I
Sbjct  21   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGLPEGYGFVEFVSHAAAERI  80



>gb|KJB21879.1| hypothetical protein B456_004G019500 [Gossypium raimondii]
 gb|KJB21881.1| hypothetical protein B456_004G019500 [Gossypium raimondii]
Length=425

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TG  EGYGFVEF SHAAAE I
Sbjct  21   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGLPEGYGFVEFVSHAAAERI  80



>ref|XP_003542872.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Glycine 
max]
Length=409

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCFAHTGE+TS KVIRNK T QSEGYGF+EF S A AE I
Sbjct  64   EVRTLWIGDLQYWMDENYLYTCFAHTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAGAERI  123



>ref|XP_010265752.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Nelumbo 
nucifera]
Length=449

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYW+DE+Y+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  41   EIRTLWIGDLQYWVDESYLHSCFAHTGEVLSIKIIRNKITGQPEGYGFVEFVSHAAAERI  100



>ref|XP_010265753.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYW+DE+Y+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  41   EIRTLWIGDLQYWVDESYLHSCFAHTGEVLSIKIIRNKITGQPEGYGFVEFVSHAAAERI  100



>gb|KHG00069.1| Polyadenylate-binding RBP47B' -like protein [Gossypium arboreum]
Length=441

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TG  EGYGFVEF SHAAAE I
Sbjct  21   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGLPEGYGFVEFVSHAAAERI  80



>ref|XP_008812246.1| PREDICTED: polyadenylate-binding protein RBP47B' [Phoenix dactylifera]
Length=447

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DE+Y+++CFAHTGE+ S KVIRNK+TG  EGYGFVEF SHAAAE I
Sbjct  45   EVRTLWIGDLQYWVDESYLHSCFAHTGEVVSVKVIRNKITGHPEGYGFVEFVSHAAAERI  104



>gb|KHN37596.1| Polyadenylate-binding protein RBP45B, partial [Glycine soja]
Length=357

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCFAHTGE+TS KVIRNK T QSEGYGF+EF S A AE I
Sbjct  10   EVRTLWIGDLQYWMDENYLYTCFAHTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAGAERI  69



>ref|XP_010938882.1| PREDICTED: polyadenylate-binding protein RBP47B' [Elaeis guineensis]
Length=448

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DE+Y+++CFAHTGE+ S KVIRNK+TG  EGYGFVEF SHAAAE I
Sbjct  46   EVRTLWIGDLQYWVDESYLHSCFAHTGEVVSVKVIRNKITGHPEGYGFVEFVSHAAAERI  105



>ref|XP_010458570.1| PREDICTED: polyadenylate-binding protein RBP45B [Camelina sativa]
Length=406

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E+++LWIGDLQYWMDEN++  CFAHTGEL S+KVIRNK TGQ EGYGF+EF SHAAAE
Sbjct  61   EIRTLWIGDLQYWMDENFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAAE  118



>ref|XP_009789022.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
sylvestris]
Length=413

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E++SLWIGDLQ+WMDE YI+ CFAHTGE+ S KVIRNK TGQSEGYGF+EF SHAAAE
Sbjct  74   EIRSLWIGDLQFWMDEQYIHNCFAHTGEVVSVKVIRNKQTGQSEGYGFIEFISHAAAE  131



>ref|XP_010536076.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Tarenaya 
hassleriana]
Length=432

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+++NY+ +CF+HTGEL S K+IRNK+TGQ EGYGF+EF SHAAAE I
Sbjct  19   EVRTLWIGDLQYWVEDNYLTSCFSHTGELVSVKIIRNKITGQPEGYGFIEFVSHAAAERI  78



>ref|XP_003546146.1| PREDICTED: polyadenylate-binding protein RBP45-like [Glycine 
max]
Length=411

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCFAHTGE++S KVIRNK T QSEGYGF+EF S A AE I
Sbjct  65   EVRTLWIGDLQYWMDENYLYTCFAHTGEVSSVKVIRNKQTSQSEGYGFIEFNSRAGAERI  124



>ref|XP_004158014.1| PREDICTED: polyadenylate-binding protein RBP45B-like [Cucumis 
sativus]
Length=260

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123



>ref|XP_004234481.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
lycopersicum]
Length=405

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E++SLWIGDLQ+WMDE YI  CFAHTGE+ S KVIRNK +GQSEGYGFVEF SHAAAE
Sbjct  70   EIRSLWIGDLQFWMDEQYIQNCFAHTGEVASVKVIRNKQSGQSEGYGFVEFISHAAAE  127



>ref|XP_010536077.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X2 [Tarenaya 
hassleriana]
Length=431

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+++NY+ +CF+HTGEL S K+IRNK+TGQ EGYGF+EF SHAAAE I
Sbjct  19   EVRTLWIGDLQYWVEDNYLTSCFSHTGELVSVKIIRNKITGQPEGYGFIEFVSHAAAERI  78



>ref|XP_006343293.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=411

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E++SLWIGDLQ+WMDE YI  CFAHTGE+ S KVIRNK +GQSEGYGFVEF SHAAAE
Sbjct  76   EIRSLWIGDLQFWMDEPYIQNCFAHTGEVASVKVIRNKQSGQSEGYGFVEFISHAAAE  133



>ref|XP_009595795.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E++SLWIGDLQ+WMDE YI+ CFAHTGE+ S KVIRNK TGQSEGYGF+EF SHAAAE
Sbjct  72   ELRSLWIGDLQFWMDEQYIHNCFAHTGEVVSVKVIRNKQTGQSEGYGFIEFISHAAAE  129



>ref|XP_010495305.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Camelina 
sativa]
Length=418

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE
Sbjct  21   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAE  78



>emb|CDX70874.1| BnaC03g09580D [Brassica napus]
Length=430

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+++CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE
Sbjct  21   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAE  78



>ref|XP_006400492.1| hypothetical protein EUTSA_v10013617mg [Eutrema salsugineum]
 gb|ESQ41945.1| hypothetical protein EUTSA_v10013617mg [Eutrema salsugineum]
Length=429

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+++CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE
Sbjct  21   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAE  78



>ref|XP_010454207.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Camelina 
sativa]
Length=424

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE
Sbjct  21   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAE  78



>ref|NP_001078604.1| polyadenylate-binding protein RBP47B' [Arabidopsis thaliana]
 gb|AED92690.1| polyadenylate-binding protein RBP47B' [Arabidopsis thaliana]
Length=421

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE
Sbjct  22   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAE  79



>ref|XP_002871881.1| hypothetical protein ARALYDRAFT_488820 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48140.1| hypothetical protein ARALYDRAFT_488820 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE
Sbjct  21   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAE  78



>emb|CDY13992.1| BnaC09g38340D [Brassica napus]
Length=419

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+++CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE
Sbjct  20   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAE  77



>ref|NP_197436.1| polyadenylate-binding protein RBP47B' [Arabidopsis thaliana]
 sp|Q8VXZ9.1|R47BP_ARATH RecName: Full=Polyadenylate-binding protein RBP47B'; Short=Poly(A)-binding 
protein RBP47B'; AltName: Full=RNA-binding protein 
47B'; Short=AtRBP47B prime; Short=AtRBP47B' [Arabidopsis 
thaliana]
 gb|AAL67015.1| putative DNA binding protein ACBF [Arabidopsis thaliana]
 gb|AAM45052.1| putative DNA binding protein ACBF [Arabidopsis thaliana]
 gb|AED92689.1| polyadenylate-binding protein RBP47B' [Arabidopsis thaliana]
Length=425

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE
Sbjct  22   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAE  79



>emb|CDX92537.1| BnaA10g15760D [Brassica napus]
Length=419

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+++CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE
Sbjct  20   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAE  77



>ref|XP_009120895.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Brassica 
rapa]
Length=419

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+++CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE
Sbjct  20   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAE  77



>ref|XP_009120896.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X2 [Brassica 
rapa]
Length=409

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+++CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE
Sbjct  20   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAE  77



>emb|CDX88893.1| BnaA03g07560D [Brassica napus]
Length=430

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE
Sbjct  21   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAE  78



>ref|XP_007147735.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
 gb|ESW19729.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
Length=399

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCFA TGE+TS KVIRNK T QSEGYGF+EF S AAAE I
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFASTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAAAERI  122



>ref|XP_003549897.1| PREDICTED: polyadenylate-binding protein RBP45-like [Glycine 
max]
 gb|KHN03463.1| Polyadenylate-binding protein RBP45 [Glycine soja]
Length=402

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCFAHTGEL S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFAHTGELASVKVIRNKQTSQSEGYGFIEFTSRAGAERV  122



>gb|AGV54881.1| RNA-binding post-transcriptional regulator csx1-like protein 
[Phaseolus vulgaris]
Length=399

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCFA TGE+TS KVIRNK T QSEGYGF+EF S AAAE I
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFASTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAAAERI  122



>ref|XP_004145107.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cucumis 
sativus]
 ref|XP_004153511.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cucumis 
sativus]
Length=408

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123



>gb|KGN64531.1| hypothetical protein Csa_1G063550 [Cucumis sativus]
Length=369

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  165  EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  224



>gb|AGV54456.1| RNA-binding post-transcriptional regulator csx1-like protein 
[Phaseolus vulgaris]
Length=399

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCFA TGE+TS KVIRNK T QSEGYGF+EF S AAAE I
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFASTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAAAERI  122



>ref|XP_008441163.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cucumis 
melo]
Length=407

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123



>gb|KFK26199.1| hypothetical protein AALP_AA8G215500 [Arabis alpina]
Length=429

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+++CF+ TGEL S KVIRNK+TGQ EGYGF+EF SH AAE
Sbjct  21   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHPAAE  78



>ref|XP_008441139.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Cucumis melo]
Length=404

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123



>ref|XP_003543537.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoformX2 
[Glycine max]
Length=410

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DE Y++ CF HTGE+ S K+IRNKLTGQ EGYGFVEF SHAAAE +
Sbjct  12   EVRTLWIGDLQYWVDEGYLSHCFGHTGEVISIKIIRNKLTGQPEGYGFVEFVSHAAAERV  71



>ref|XP_008441138.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Cucumis melo]
Length=405

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123



>ref|XP_004145109.1| PREDICTED: polyadenylate-binding protein RBP45B-like [Cucumis 
sativus]
Length=404

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123



>ref|XP_007153936.1| hypothetical protein PHAVU_003G077700g [Phaseolus vulgaris]
 gb|ESW25930.1| hypothetical protein PHAVU_003G077700g [Phaseolus vulgaris]
Length=398

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCFAHTGE+ S KVIRNK T QSEGYGF+EF S A AE I
Sbjct  61   EVRTLWIGDLQYWMDENYLYTCFAHTGEVASVKVIRNKQTSQSEGYGFIEFTSRAGAERI  120



>ref|XP_008441142.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Cucumis melo]
Length=403

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123



>ref|XP_008441150.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X4 
[Cucumis melo]
Length=402

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123



>ref|XP_010476096.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Camelina sativa]
Length=407

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E+++LWIGDLQYWMDE+++  CFAHTGEL S+KVIRNK TGQ EGYGF+EF SHAAAE
Sbjct  61   EIRTLWIGDLQYWMDESFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAAE  118



>ref|XP_001777334.1| predicted protein [Physcomitrella patens]
 ref|XP_001782740.1| predicted protein, partial [Physcomitrella patens]
 gb|EDQ52446.1| predicted protein, partial [Physcomitrella patens]
 gb|EDQ57864.1| predicted protein, partial [Physcomitrella patens]
Length=416

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EVK+LW+GDLQYWMDENY++T F HTGE+ S K+IRNK TG SEGYGFVEF SHAAAE I
Sbjct  6    EVKTLWVGDLQYWMDENYLHTAFVHTGEVQSVKIIRNKQTGYSEGYGFVEFVSHAAAEKI  65



>ref|XP_003543536.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoformX1 
[Glycine max]
Length=419

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DE Y++ CF HTGE+ S K+IRNKLTGQ EGYGFVEF SHAAAE +
Sbjct  12   EVRTLWIGDLQYWVDEGYLSHCFGHTGEVISIKIIRNKLTGQPEGYGFVEFVSHAAAERV  71



>ref|XP_010493089.1| PREDICTED: polyadenylate-binding protein RBP45B-like [Camelina 
sativa]
Length=406

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E+++LWIGDLQYWMDE+++  CFAHTGEL S+KVIRNK TGQ EGYGF+EF SHAAAE
Sbjct  61   EIRTLWIGDLQYWMDESFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAAE  118



>ref|XP_010476097.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X2 [Camelina sativa]
Length=397

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E+++LWIGDLQYWMDE+++  CFAHTGEL S+KVIRNK TGQ EGYGF+EF SHAAAE
Sbjct  61   EIRTLWIGDLQYWMDESFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAAE  118



>ref|XP_010420736.1| PREDICTED: polyadenylate-binding protein RBP47B' [Camelina sativa]
Length=423

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SH AAE
Sbjct  21   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHGAAE  78



>gb|EPS64177.1| hypothetical protein M569_10604, partial [Genlisea aurea]
Length=438

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  336  VKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            ++SLWIGDLQYWMDE Y+ +CFAHTGE+ S+KVIRN+ TGQSEGYGF+EF SHAAAE
Sbjct  89   IRSLWIGDLQYWMDEQYLYSCFAHTGEVASAKVIRNRHTGQSEGYGFIEFVSHAAAE  145



>ref|XP_009390905.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=403

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E +++W+GDL YWMDENY+++CF H+GE+ S KVIRNK TGQSEGYGFVEF SHA AENI
Sbjct  76   EKRTIWVGDLHYWMDENYLHSCFGHSGEVVSIKVIRNKQTGQSEGYGFVEFHSHATAENI  135



>ref|XP_011037672.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X3 [Populus 
euphratica]
Length=280

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI +CFAHTGE+ S K+IRNK T Q EGYGF+E  SH AAE I
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIELTSHGAAERI  134



>ref|XP_006307499.1| hypothetical protein CARUB_v10009124mg, partial [Capsella rubella]
 gb|EOA40397.1| hypothetical protein CARUB_v10009124mg, partial [Capsella rubella]
Length=448

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E+++LWIGDLQYWMDE+++  CFAHTGEL S+KVIRNK TGQ EGYGF+EF SHAAAE
Sbjct  101  EIRTLWIGDLQYWMDESFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAAE  158



>ref|XP_009380242.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E +++W+GDLQYWMDENY+++CF HTGE+ S KVIRNK TGQSEGYGFVEF SHA AE +
Sbjct  78   ERRTIWVGDLQYWMDENYLHSCFGHTGEVISIKVIRNKQTGQSEGYGFVEFHSHATAEKV  137



>ref|XP_006348103.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=413

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E++SLWIGDLQ+WMDE YI  CFA TGE+TS+KVIRNK +GQSEGYGF+EF SHAAAE
Sbjct  77   EIRSLWIGDLQFWMDEQYILNCFAQTGEVTSAKVIRNKQSGQSEGYGFIEFISHAAAE  134



>ref|XP_007132012.1| hypothetical protein PHAVU_011G059300g [Phaseolus vulgaris]
 gb|ESW04006.1| hypothetical protein PHAVU_011G059300g [Phaseolus vulgaris]
Length=401

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DE+Y++ CFAH+GE+ S K+IRNK+TGQ EGYGFVEF SHAAAE
Sbjct  8    EVRTLWIGDLQYWVDESYLSQCFAHSGEVVSIKIIRNKMTGQPEGYGFVEFVSHAAAE  65



>gb|KEH36838.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=271

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCF +TGELTS KVIRNK T QSEGYGF+EF + A AE +
Sbjct  58   EVRTLWIGDLQYWMDENYLYTCFGNTGELTSVKVIRNKQTSQSEGYGFIEFNTRATAERV  117



>ref|XP_003597428.1| RNA-binding protein [Medicago truncatula]
 gb|AES67679.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=428

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DENY+  CF+HTGE+ S K+IRNK+TGQ EGYGF+EF SH+AAE +
Sbjct  13   EVRTLWIGDLQYWVDENYLTHCFSHTGEVISIKIIRNKITGQPEGYGFIEFVSHSAAERV  72



>gb|KDO75474.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=303

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWMDE Y+NTCFAHTGE+ + KVIRNK TGQ EGYGF+EF S A AE +
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139



>ref|XP_009414748.1| PREDICTED: polyadenylate-binding protein RBP47B' [Musa acuminata 
subsp. malaccensis]
Length=440

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV+SLWIGDLQYW+DE+Y++ CFAHTGE+ S K+IRNK+TG  EGYGF+EF SH AAE I
Sbjct  39   EVRSLWIGDLQYWVDESYLHNCFAHTGEVVSVKIIRNKITGLPEGYGFIEFVSHPAAERI  98



>ref|XP_007150369.1| hypothetical protein PHAVU_005G147800g [Phaseolus vulgaris]
 gb|ESW22363.1| hypothetical protein PHAVU_005G147800g [Phaseolus vulgaris]
Length=424

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DE Y++ CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHA+AE +
Sbjct  16   EVRTLWIGDLQYWVDEAYLSHCFAHTGEVLSIKIIRNKMTGQPEGYGFVEFVSHASAERV  75



>ref|XP_004153285.1| PREDICTED: polyadenylate-binding protein RBP47B-like, partial 
[Cucumis sativus]
Length=218

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EVK+LWIGDLQ WMDE Y+N CFAHTGE++S KVI NK TGQSEGYGFVEF SH  AE +
Sbjct  98   EVKTLWIGDLQPWMDETYLNNCFAHTGEVSSVKVICNKQTGQSEGYGFVEFFSHTTAEKV  157



>gb|KHN25246.1| Polyadenylate-binding protein RBP47B' [Glycine soja]
Length=373

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DE+Y++ CFAH+GE+ S K+IRNKLTGQ EGYGFVEF SHA+AE
Sbjct  8    EVRTLWIGDLQYWVDESYLSQCFAHSGEVVSIKIIRNKLTGQPEGYGFVEFVSHASAE  65



>ref|XP_003539457.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoform 
1 [Glycine max]
Length=401

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DE+Y++ CFAH+GE+ S K+IRNKLTGQ EGYGFVEF SHA+AE
Sbjct  8    EVRTLWIGDLQYWVDESYLSQCFAHSGEVVSIKIIRNKLTGQPEGYGFVEFVSHASAE  65



>ref|XP_011037673.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X4 [Populus 
euphratica]
Length=273

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI +CFAHTGE+ S K+IRNK T Q EGYGF+E  SH AAE I
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIELTSHGAAERI  134



>gb|KFK43438.1| hypothetical protein AALP_AA1G125300 [Arabis alpina]
Length=403

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E+++LWIGDLQ+WMDEN++  CFAHTGE+ S+KVIRNK TGQ EGYGF+EF SHAAAE
Sbjct  60   EIRTLWIGDLQFWMDENFLFGCFAHTGEVVSAKVIRNKQTGQVEGYGFIEFVSHAAAE  117



>gb|ACN40970.1| unknown [Picea sitchensis]
Length=430

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EVK+LW+GDLQ+WMDE Y++TCF+HTGEL S+K+IRNK TGQSEGYGF+EF +  AAE I
Sbjct  90   EVKTLWVGDLQFWMDEGYLHTCFSHTGELVSAKIIRNKYTGQSEGYGFMEFITRTAAEKI  149



>gb|ACN39849.1| unknown [Picea sitchensis]
Length=429

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EVK+LW+GDLQ+WMDE Y++TCF+HTGEL S+K+IRNK TGQSEGYGF+EF +  AAE I
Sbjct  90   EVKTLWVGDLQFWMDEGYLHTCFSHTGELVSAKIIRNKYTGQSEGYGFMEFITRTAAEKI  149



>ref|XP_006449040.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62280.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=305

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWMDE Y+NTCFAHTGE+ + KVIRNK TGQ EGYGF+EF S A AE +
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139



>gb|KDO75475.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
 gb|KDO75476.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=305

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWMDE Y+NTCFAHTGE+ + KVIRNK TGQ EGYGF+EF S A AE +
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139



>ref|XP_011037671.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Populus 
euphratica]
Length=321

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI +CFAHTGE+ S K+IRNK T Q EGYGF+E  SH AAE I
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIELTSHGAAERI  134



>gb|KEH36837.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=284

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCF +TGELTS KVIRNK T QSEGYGF+EF + A AE +
Sbjct  58   EVRTLWIGDLQYWMDENYLYTCFGNTGELTSVKVIRNKQTSQSEGYGFIEFNTRATAERV  117



>ref|XP_009404023.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=403

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E +++W+GDLQYWMDENY+ +CF HTGE+ S KVIRNK TGQSEGYGFVEF SHA AE I
Sbjct  78   EKRTIWVGDLQYWMDENYLLSCFVHTGEVVSIKVIRNKQTGQSEGYGFVEFHSHATAEKI  137



>ref|XP_003537962.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoform 
1 [Glycine max]
Length=401

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DE+Y++ CFAH GE+ S K+IRNKLTGQ EGYGFVEF SHA+AE
Sbjct  8    EVRTLWIGDLQYWVDESYLSQCFAHNGEVVSIKIIRNKLTGQPEGYGFVEFVSHASAE  65



>ref|XP_004232721.1| PREDICTED: polyadenylate-binding protein RBP45 [Solanum lycopersicum]
Length=413

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E++SLWIGDLQ+WMDE Y+  CFA TGE+TS+KVIRNK +GQSEGYGF+EF SHAAAE
Sbjct  77   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVTSAKVIRNKQSGQSEGYGFIEFISHAAAE  134



>dbj|BAB08769.1| unnamed protein product [Arabidopsis thaliana]
Length=390

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            +VKSLWIGDLQ WMDENYI + FA +GE TS+KVIRNKLTGQSEGYGF+EF SH+ AE +
Sbjct  58   DVKSLWIGDLQQWMDENYIMSVFAQSGEATSAKVIRNKLTGQSEGYGFIEFVSHSVAERV  117



>ref|XP_009631416.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana tomentosiformis]
Length=398

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E++SLWIGDLQ+WMDE Y+  CFA TGE+ ++KVIRNK TGQSEGYGFVEF SHAAAE
Sbjct  71   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFVEFNSHAAAE  128



>ref|XP_009631415.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana tomentosiformis]
Length=399

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E++SLWIGDLQ+WMDE Y+  CFA TGE+ ++KVIRNK TGQSEGYGFVEF SHAAAE
Sbjct  71   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFVEFNSHAAAE  128



>ref|NP_568815.1| RNA-binding protein 45A [Arabidopsis thaliana]
 sp|Q9FPJ8.1|RB45A_ARATH RecName: Full=Polyadenylate-binding protein RBP45A; Short=Poly(A)-binding 
protein RBP45A; AltName: Full=RNA-binding protein 
45A; Short=AtRBP45A [Arabidopsis thaliana]
 gb|AAG40335.1|AF324983_1 AT5g54900 [Arabidopsis thaliana]
 gb|ABL66801.1| At5g54900 [Arabidopsis thaliana]
 gb|AED96554.1| RNA-binding protein 45A [Arabidopsis thaliana]
Length=387

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            +VKSLWIGDLQ WMDENYI + FA +GE TS+KVIRNKLTGQSEGYGF+EF SH+ AE +
Sbjct  58   DVKSLWIGDLQQWMDENYIMSVFAQSGEATSAKVIRNKLTGQSEGYGFIEFVSHSVAERV  117



>ref|XP_006417333.1| hypothetical protein EUTSA_v10007819mg [Eutrema salsugineum]
 gb|ESQ35686.1| hypothetical protein EUTSA_v10007819mg [Eutrema salsugineum]
Length=397

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E+++LWIGDLQ+WMDEN++ +CFAHTGE+ S+KVIRNK T Q EGYGF+EF SHAAAE
Sbjct  61   EIRTLWIGDLQFWMDENFLYSCFAHTGEVVSAKVIRNKQTAQVEGYGFIEFVSHAAAE  118



>ref|XP_009631417.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Nicotiana tomentosiformis]
Length=396

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E++SLWIGDLQ+WMDE Y+  CFA TGE+ ++KVIRNK TGQSEGYGFVEF SHAAAE
Sbjct  71   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFVEFNSHAAAE  128



>ref|XP_011037670.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Populus 
euphratica]
Length=409

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI +CFAHTGE+ S K+IRNK T Q EGYGF+E  SH AAE I
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIELTSHGAAERI  134



>ref|XP_009131734.1| PREDICTED: polyadenylate-binding protein RBP47B' [Brassica rapa]
Length=430

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYG +EF SHAAAE
Sbjct  21   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGVIEFVSHAAAE  78



>ref|XP_002305583.2| RNA-binding protein 45 [Populus trichocarpa]
 gb|EEE86094.2| RNA-binding protein 45 [Populus trichocarpa]
Length=409

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI +CFAHTGE+ S K+IRNK T Q EGYGF+E  SH AAE I
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIEMTSHGAAERI  134



>ref|XP_001784132.1| predicted protein [Physcomitrella patens]
 gb|EDQ51056.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EVK+LW+GDLQYWMDENY++T F HTGE+ S K+IRNK TG SEGYGFVEF SH AAE I
Sbjct  41   EVKTLWVGDLQYWMDENYLHTAFVHTGEVQSVKIIRNKQTGYSEGYGFVEFVSHVAAEKI  100



>ref|XP_006468021.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Citrus sinensis]
 gb|KDO75473.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=413

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWMDE Y+NTCFAHTGE+ + KVIRNK TGQ EGYGF+EF S A AE +
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139



>gb|KEH36836.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=401

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCF +TGELTS KVIRNK T QSEGYGF+EF + A AE +
Sbjct  58   EVRTLWIGDLQYWMDENYLYTCFGNTGELTSVKVIRNKQTSQSEGYGFIEFNTRATAERV  117



>ref|XP_008782204.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Phoenix dactylifera]
Length=409

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL YWMDE+YI++CF HTGE+ S KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  81   ENKTIWVGDLHYWMDESYIHSCFGHTGEVVSIKVIRNKKTGQSEGYGFVEFFSHAAAEKV  140



>ref|XP_006449038.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62278.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=413

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWMDE Y+NTCFAHTGE+ + KVIRNK TGQ EGYGF+EF S A AE +
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139



>ref|XP_010278713.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nelumbo 
nucifera]
Length=310

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWM+E+YI++CFAHTGE+ S KVIRNK TGQSEGYGF+EF +  AAE I
Sbjct  95   EVRTLWIGDLQYWMEESYIHSCFAHTGEVASVKVIRNKQTGQSEGYGFIEFVTRPAAERI  154



>ref|XP_009417617.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Musa acuminata 
subsp. malaccensis]
Length=399

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL YWMDENY++ CF HTGE+ S KVIRNK TGQSEGYGFVEF +HAAAE +
Sbjct  75   ENKTIWVGDLHYWMDENYLHNCFGHTGEVVSIKVIRNKQTGQSEGYGFVEFYTHAAAEKV  134



>ref|XP_010268845.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Nelumbo 
nucifera]
Length=413

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL YWMDE+Y++ CFAHTGE+ S KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  68   ENKTIWVGDLHYWMDESYLHNCFAHTGEVVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKV  127



>ref|XP_006468022.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Citrus sinensis]
 gb|KDO75472.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=406

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWMDE Y+NTCFAHTGE+ + KVIRNK TGQ EGYGF+EF S A AE +
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139



>ref|XP_006449039.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62279.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=406

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWMDE Y+NTCFAHTGE+ + KVIRNK TGQ EGYGF+EF S A AE +
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139



>ref|XP_011096084.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Sesamum 
indicum]
Length=422

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +3

Query  336  VKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            ++SLWIGDLQYWMDE Y+  CFA TGE+ S+KVIRNK TGQSEGYGF+EF SHAAAE
Sbjct  86   IRSLWIGDLQYWMDEQYLYNCFAATGEVVSAKVIRNKQTGQSEGYGFIEFASHAAAE  142



>ref|XP_011096085.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Sesamum 
indicum]
Length=420

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +3

Query  336  VKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            ++SLWIGDLQYWMDE Y+  CFA TGE+ S+KVIRNK TGQSEGYGF+EF SHAAAE
Sbjct  86   IRSLWIGDLQYWMDEQYLYNCFAATGEVVSAKVIRNKQTGQSEGYGFIEFASHAAAE  142



>ref|XP_010268853.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Nelumbo 
nucifera]
Length=408

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL YWMDE+Y++ CFAHTGE+ S KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  68   ENKTIWVGDLHYWMDESYLHNCFAHTGEVVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKV  127



>ref|XP_010275609.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Nelumbo nucifera]
Length=418

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  339  KSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            K++W+GDL YWMDE+Y+++CFAHTGE+ S KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  76   KTIWVGDLHYWMDESYLHSCFAHTGEVVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKV  133



>ref|XP_002979510.1| hypothetical protein SELMODRAFT_111082 [Selaginella moellendorffii]
 gb|EFJ19399.1| hypothetical protein SELMODRAFT_111082 [Selaginella moellendorffii]
Length=432

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+   FAHTGE+ S+KVIRNK TG  EGYGF+EF SH AAE +
Sbjct  26   EVRTLWIGDLQYWMDENYLRNLFAHTGEVLSAKVIRNKQTGYPEGYGFIEFNSHPAAERV  85



>ref|XP_010275610.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Nelumbo nucifera]
Length=413

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  339  KSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            K++W+GDL YWMDE+Y+++CFAHTGE+ S KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  76   KTIWVGDLHYWMDESYLHSCFAHTGEVVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKV  133



>ref|XP_010278711.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Nelumbo nucifera]
 ref|XP_010278712.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X4 
[Nelumbo nucifera]
Length=423

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWM+E+YI++CFAHTGE+ S KVIRNK TGQSEGYGF+EF +  AAE I
Sbjct  95   EVRTLWIGDLQYWMEESYIHSCFAHTGEVASVKVIRNKQTGQSEGYGFIEFVTRPAAERI  154



>ref|XP_008782206.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Phoenix dactylifera]
Length=385

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL YWMDE+YI++CF HTGE+ S KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  81   ENKTIWVGDLHYWMDESYIHSCFGHTGEVVSIKVIRNKKTGQSEGYGFVEFFSHAAAEKV  140



>ref|XP_009772574.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana sylvestris]
Length=411

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E++SLWIGDLQ+WMDE Y+  CFA TGE+ ++KVIRNK TGQSEGYGF+EF SHAAAE
Sbjct  74   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFIEFNSHAAAE  131



>ref|XP_002977811.1| hypothetical protein SELMODRAFT_232989 [Selaginella moellendorffii]
 gb|EFJ21149.1| hypothetical protein SELMODRAFT_232989 [Selaginella moellendorffii]
Length=455

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+   FAHTGE+ S+KVIRNK TG  EGYGF+EF SH AAE +
Sbjct  26   EVRTLWIGDLQYWMDENYLRNLFAHTGEVLSAKVIRNKQTGYPEGYGFIEFNSHPAAERV  85



>ref|XP_003529629.1| PREDICTED: polyadenylate-binding protein RBP45 [Glycine max]
Length=397

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TC AHTGE+ S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  59   EVRTLWIGDLQYWMDENYLYTCLAHTGEVASVKVIRNKQTSQSEGYGFIEFTSRAGAERV  118



>ref|XP_009772575.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana sylvestris]
Length=410

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E++SLWIGDLQ+WMDE Y+  CFA TGE+ ++KVIRNK TGQSEGYGF+EF SHAAAE
Sbjct  74   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFIEFNSHAAAE  131



>ref|XP_010278708.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010278709.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nelumbo nucifera]
Length=430

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWM+E+YI++CFAHTGE+ S KVIRNK TGQSEGYGF+EF +  AAE I
Sbjct  95   EVRTLWIGDLQYWMEESYIHSCFAHTGEVASVKVIRNKQTGQSEGYGFIEFVTRPAAERI  154



>dbj|BAK03410.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88936.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI +CFA+TGE  S K+IR+K TGQ +GYGFVEF SHAAAE +
Sbjct  89   EVRTLWIGDLQYWMDENYIYSCFANTGEFQSVKLIRDKQTGQLQGYGFVEFASHAAAERV  148



>gb|KHN35750.1| Polyadenylate-binding protein RBP45 [Glycine soja]
Length=397

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TC AHTGE+ S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  59   EVRTLWIGDLQYWMDENYLYTCLAHTGEVASVKVIRNKQTSQSEGYGFIEFTSRAGAERV  118



>dbj|BAE71244.1| putative DNA binding protein [Trifolium pratense]
Length=402

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCF +TGE+TS KVIRNK T QSEGYGF+EF + A+AE +
Sbjct  55   EVRTLWIGDLQYWMDENYLYTCFGNTGEVTSVKVIRNKQTSQSEGYGFIEFNTRASAERV  114



>ref|XP_004486120.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cicer arietinum]
Length=399

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCF  TGE+TS KVIRNK T QSEGYGF+EF S A AE +
Sbjct  54   EVRTLWIGDLQYWMDENYLYTCFGQTGEVTSLKVIRNKQTSQSEGYGFIEFNSRATAERV  113



>ref|XP_010673626.1| PREDICTED: polyadenylate-binding protein RBP47B' [Beta vulgaris 
subsp. vulgaris]
Length=429

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQ W+DE+YI++CFA TGE+ S KVIRNK+TG  EGYGFVEF SHAAAE +
Sbjct  14   EVRTLWIGDLQIWVDESYIHSCFAQTGEVISVKVIRNKITGHPEGYGFVEFVSHAAAERV  73



>ref|XP_009418782.1| PREDICTED: polyadenylate-binding protein RBP45-like [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LW+GDLQYWMDENY+ +CF HTGE+ S K+IRNKL GQSEGYGF+EF S AAA+ +
Sbjct  108  EIRTLWVGDLQYWMDENYLYSCFVHTGEVLSVKIIRNKLNGQSEGYGFIEFVSRAAADRV  167



>ref|XP_004486966.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoform 
X1 [Cicer arietinum]
Length=429

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DE Y+  CF+HTGE+ S K+IRNK+TGQ EGYGFVEF SH AAE +
Sbjct  13   EVRTLWIGDLQYWVDETYLTHCFSHTGEVISIKIIRNKITGQPEGYGFVEFVSHTAAERV  72



>dbj|BAD05744.1| putative RNA Binding Protein 45 [Oryza sativa Japonica Group]
 dbj|BAD05783.1| putative RNA Binding Protein 45 [Oryza sativa Japonica Group]
Length=427

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENYI+ CFA TGEL S K+IR+K TGQ +GYGF+EF SHA AE +
Sbjct  93   EVRTLWIGDLQYWMDENYISACFAPTGELQSVKLIRDKQTGQLQGYGFIEFTSHAGAERV  152



>ref|XP_004486967.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoform 
X2 [Cicer arietinum]
Length=427

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW+DE Y+  CF+HTGE+ S K+IRNK+TGQ EGYGFVEF SH AAE +
Sbjct  13   EVRTLWIGDLQYWVDETYLTHCFSHTGEVISIKIIRNKITGQPEGYGFVEFVSHTAAERV  72



>ref|XP_010327242.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X3 [Solanum lycopersicum]
Length=354

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQ+WMDE Y+ +CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE
Sbjct  74   EVRTLWIGDLQFWMDEQYLYSCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAE  131



>ref|XP_006858185.1| hypothetical protein AMTR_s00062p00161920 [Amborella trichopoda]
 gb|ERN19652.1| hypothetical protein AMTR_s00062p00161920 [Amborella trichopoda]
Length=492

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDE YI++CFAHTGE+ S K+IRNK TGQ EGYGF+EF S A AE I
Sbjct  90   EVRTLWIGDLQYWMDEAYIHSCFAHTGEVLSVKIIRNKQTGQPEGYGFIEFASRATAERI  149



>ref|NP_001144988.1| uncharacterized protein LOC100278143 [Zea mays]
 gb|ACG44236.1| hypothetical protein [Zea mays]
Length=436

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E KS+W+GDL YWMDENY+++CF +TGE+ + KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  104  ENKSVWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKV  163



>ref|XP_004507696.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X2 [Cicer arietinum]
Length=361

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCF+HTGE+ S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFSHTGEVGSIKVIRNKQTNQSEGYGFIEFTSRAGAERV  122



>ref|XP_004507695.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Cicer arietinum]
Length=400

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+ TCF+HTGE+ S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFSHTGEVGSIKVIRNKQTNQSEGYGFIEFTSRAGAERV  122



>dbj|BAJ85879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL YWMDENY++TCF +TGE+ + KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  151  ENKTIWVGDLHYWMDENYLHTCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKV  210



>ref|XP_004145357.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
sativus]
Length=436

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EVK+LWIGDLQ WMDE Y+N CFAHTGE++S KVI NK TGQSEGYGFVEF SH  AE +
Sbjct  98   EVKTLWIGDLQPWMDETYLNNCFAHTGEVSSVKVICNKQTGQSEGYGFVEFFSHTTAEKV  157



>ref|XP_010665562.1| PREDICTED: polyadenylate-binding protein RBP45-like [Beta vulgaris 
subsp. vulgaris]
Length=414

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWMDENYI TCFA +GEL + K+IRNK T QSE YGF+EF +HAAAE I
Sbjct  80   EIRTLWIGDLQYWMDENYIRTCFAQSGELVNVKIIRNKQTMQSECYGFIEFSTHAAAERI  139



>ref|XP_003580589.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Brachypodium distachyon]
Length=426

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDE YI+ CFA TGEL S K+IR+K TGQ +GYGFVEF SHAAAE +
Sbjct  86   EVRTLWIGDLQYWMDETYIHGCFASTGELQSVKLIRDKQTGQLQGYGFVEFTSHAAAERV  145



>gb|ACF87959.1| unknown [Zea mays]
 tpg|DAA61808.1| TPA: hypothetical protein ZEAMMB73_995180 [Zea mays]
Length=433

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E KS+W+GDL YWMDENY+++CF +TGE+ + KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  101  ENKSVWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKV  160



>ref|XP_004168889.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
sativus]
Length=437

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EVK+LWIGDLQ WMDE Y+N CFAHTGE++S KVI NK TGQSEGYGFVEF SH  AE +
Sbjct  98   EVKTLWIGDLQPWMDETYLNNCFAHTGEVSSVKVICNKQTGQSEGYGFVEFFSHTTAEKV  157



>ref|XP_010240455.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Brachypodium distachyon]
Length=423

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDE YI+ CFA TGEL S K+IR+K TGQ +GYGFVEF SHAAAE +
Sbjct  86   EVRTLWIGDLQYWMDETYIHGCFASTGELQSVKLIRDKQTGQLQGYGFVEFTSHAAAERV  145



>ref|XP_004248403.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Solanum lycopersicum]
Length=410

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQ+WMDE Y+ +CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE
Sbjct  74   EVRTLWIGDLQFWMDEQYLYSCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAE  131



>ref|XP_003578248.1| PREDICTED: polyadenylate-binding protein RBP47-like [Brachypodium 
distachyon]
Length=431

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL YWMDENY+++CF +TGE+ + KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  102  ENKTIWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKV  161



>ref|XP_009420609.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
Length=430

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LW+GDLQYWMDENY+ +CF HTGE+ S KVIRNK TGQSEGYGF+EF S  AA+ I
Sbjct  93   EIRTLWVGDLQYWMDENYLYSCFVHTGEVVSVKVIRNKQTGQSEGYGFIEFVSRVAADRI  152



>ref|XP_009118182.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Brassica 
rapa]
Length=388

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E+++LWIGDLQ+WMDEN++ +CFAHTGE+ S KVIRNK T Q EGYGF+EF SHAAAE
Sbjct  58   EIRTLWIGDLQFWMDENFLYSCFAHTGEVLSVKVIRNKQTSQVEGYGFIEFVSHAAAE  115



>ref|XP_010327241.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Solanum lycopersicum]
Length=411

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQ+WMDE Y+ +CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE
Sbjct  74   EVRTLWIGDLQFWMDEQYLYSCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAE  131



>ref|XP_006649483.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Oryza 
brachyantha]
Length=415

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DENY+  CFAHTGEL S K+IRNKLT   EGYGF+EF SH AAE +
Sbjct  14   EVRTLWIGDLQYWADENYLYNCFAHTGELQSVKIIRNKLTSLPEGYGFIEFISHEAAEKV  73



>ref|XP_010101438.1| Polyadenylate-binding protein RBP45B [Morus notabilis]
 gb|EXB88421.1| Polyadenylate-binding protein RBP45B [Morus notabilis]
Length=398

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQYWM+ENY+ +CF HTGE+ S KVIRNK TGQSEGYGF+EF S  AAE
Sbjct  63   EVRTLWIGDLQYWMEENYLYSCFVHTGEVVSVKVIRNKQTGQSEGYGFIEFVSRPAAE  120



>ref|XP_009118181.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Brassica 
rapa]
Length=394

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E+++LWIGDLQ+WMDEN++ +CFAHTGE+ S KVIRNK T Q EGYGF+EF SHAAAE
Sbjct  58   EIRTLWIGDLQFWMDENFLYSCFAHTGEVLSVKVIRNKQTSQVEGYGFIEFVSHAAAE  115



>ref|XP_010926371.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Elaeis 
guineensis]
Length=791

 Score =   102 bits (254),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL YWMDE+Y+++CF HTGE+ S KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  420  ENKTIWVGDLHYWMDESYLHSCFGHTGEVVSIKVIRNKKTGQSEGYGFVEFFSHAAAEKV  479



>gb|EYU27806.1| hypothetical protein MIMGU_mgv1a007668mg [Erythranthe guttata]
Length=399

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  336  VKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            VKSLWIGDLQYWMDE Y+ +CF   GE+ S+KVIRNK +GQSEGYGF+ F SHAAAE I
Sbjct  72   VKSLWIGDLQYWMDEQYLCSCFPAAGEVVSAKVIRNKQSGQSEGYGFIRFASHAAAERI  130



>ref|XP_008459212.1| PREDICTED: polyadenylate-binding protein RBP47 [Cucumis melo]
Length=439

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EVK+LWIGDLQ WMDE Y+N CFAHTGE++S KVI NK TGQSEGYGFVEF SH  AE +
Sbjct  98   EVKTLWIGDLQPWMDETYLNNCFAHTGEVSSVKVICNKQTGQSEGYGFVEFFSHTTAEKV  157



>gb|AEW68341.1| putative nuclear acid binding protein [Medicago sativa]
Length=409

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EVK+LWIGDLQYWMDENY+  CF+HTGE+ S KVIRNKL  QSEGYGF+EF S A AE +
Sbjct  70   EVKTLWIGDLQYWMDENYLYNCFSHTGEVGSVKVIRNKLNNQSEGYGFLEFISRAGAERV  129



>ref|XP_003610418.1| RNA-binding protein [Medicago truncatula]
Length=319

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EVK+LWIGDLQYWMDENY+  CF+HTGE+ S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  72   EVKTLWIGDLQYWMDENYLYNCFSHTGEVGSVKVIRNKQTNQSEGYGFLEFISRAGAERV  131



>ref|XP_006660711.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=344

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL YWMDENY+++CF +TGE+ + KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  15   ENKTIWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKV  74



>ref|XP_010910520.1| PREDICTED: polyadenylate-binding protein RBP45-like, partial 
[Elaeis guineensis]
Length=332

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LW+GDLQYWMDE+Y++ CFAHTGE+ S K+IR+K TGQ +GYGF+EF +HA+AE +
Sbjct  108  EVRTLWMGDLQYWMDESYVHGCFAHTGEVVSVKLIRDKQTGQLQGYGFIEFATHASAERV  167



>gb|KJB69302.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=294

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQY+MDENY+ +CFA TGE+ S KVIRNK TGQ EGYGF+EF S AAAE +
Sbjct  88   EVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAERV  147



>ref|XP_006352618.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Solanum tuberosum]
Length=411

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQ+WMDE Y+  CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE
Sbjct  75   EVRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAE  132



>ref|XP_006352617.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Solanum tuberosum]
Length=412

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDLQ+WMDE Y+  CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE
Sbjct  75   EVRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAE  132



>ref|XP_007015033.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY32652.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=455

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 55/75 (73%), Gaps = 15/75 (20%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGE---------------LTSSKVIRNKLTGQSEG  467
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGE               L S K+IRNK+TGQ EG
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGEAVFICKTYENADAGKLVSIKIIRNKITGQPEG  77

Query  468  YGFVEFRSHAAAENI  512
            YGFVEF SHAAAE I
Sbjct  78   YGFVEFVSHAAAERI  92



>emb|CDP04386.1| unnamed protein product [Coffea canephora]
Length=278

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +3

Query  336  VKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            ++SLWIGDLQYWMDE Y+ +CF+ TGE+ S+KVIRNK TGQSEGYGF+EF SHA AE
Sbjct  79   IRSLWIGDLQYWMDEQYLLSCFSQTGEVLSAKVIRNKQTGQSEGYGFIEFVSHAGAE  135



>gb|KJB69304.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=292

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQY+MDENY+ +CFA TGE+ S KVIRNK TGQ EGYGF+EF S AAAE +
Sbjct  88   EVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAERV  147



>ref|XP_006287675.1| hypothetical protein CARUB_v10000890mg, partial [Capsella rubella]
 gb|EOA20573.1| hypothetical protein CARUB_v10000890mg, partial [Capsella rubella]
Length=467

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            EV++LWIGDL YW DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SH AAE
Sbjct  66   EVRTLWIGDLLYWADENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHGAAE  123



>ref|XP_009614215.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
tomentosiformis]
Length=415

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E+++LWIGDLQ+WMDE Y+  CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE
Sbjct  78   EIRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAE  135



>ref|XP_009406502.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=437

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIG LQ+WMDENY+ +CFAHTGE+ S K+IRNK +GQSEGYGF+EF SHA A+ I
Sbjct  101  EIRTLWIGGLQFWMDENYLYSCFAHTGEVVSVKIIRNKQSGQSEGYGFLEFVSHAGADRI  160



>ref|XP_009776437.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana sylvestris]
Length=414

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E+++LWIGDLQ+WMDE Y+  CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE
Sbjct  78   EIRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAE  135



>ref|XP_009776429.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana sylvestris]
Length=415

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E+++LWIGDLQ+WMDE Y+  CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE
Sbjct  78   EIRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAE  135



>ref|XP_003610417.1| RNA-binding protein [Medicago truncatula]
 gb|AES92614.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=411

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EVK+LWIGDLQYWMDENY+  CF+HTGE+ S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  72   EVKTLWIGDLQYWMDENYLYNCFSHTGEVGSVKVIRNKQTNQSEGYGFLEFISRAGAERV  131



>emb|CAL25353.1| ACBF-like dna binding protein [Platanus x acerifolia]
Length=216

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL YWMD NY+N CFAHTGE+ S KVIRNK TGQSEGYGFVEF S  AAE +
Sbjct  27   ENKTIWVGDLHYWMDGNYLNNCFAHTGEVISIKVIRNKQTGQSEGYGFVEFFSREAAEKV  86



>ref|NP_001063403.1| Os09g0462700 [Oryza sativa Japonica Group]
 dbj|BAF25317.1| Os09g0462700, partial [Oryza sativa Japonica Group]
Length=441

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL YWMDENY+++CF +TGE+ + KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  113  ENKTIWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKV  172



>dbj|BAG87507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=345

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  339  KSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            K++W+GDL YWMDENY+++CF +TGE+ + KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  19   KTIWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKV  76



>ref|XP_009406503.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=430

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIG LQ+WMDENY+ +CFAHTGE+ S K+IRNK +GQSEGYGF+EF SHA A+ I
Sbjct  94   EIRTLWIGGLQFWMDENYLYSCFAHTGEVVSVKIIRNKQSGQSEGYGFLEFVSHAGADRI  153



>ref|XP_006406534.1| hypothetical protein EUTSA_v10020763mg [Eutrema salsugineum]
 gb|ESQ47987.1| hypothetical protein EUTSA_v10020763mg [Eutrema salsugineum]
Length=311

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            +VK+LW+GDL +WMDE Y+++CF+HTGE++S KVIRNKLT QSEGYGFVEF S AAAE +
Sbjct  108  DVKTLWVGDLLHWMDETYLHSCFSHTGEVSSVKVIRNKLTCQSEGYGFVEFLSRAAAEEV  167



>emb|CBI32444.3| unnamed protein product [Vitis vinifera]
Length=342

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+K+LW+GDL  WMD+NY+ TCF HTGE++S K+IRNK TGQSEGYGFVEF S A AE I
Sbjct  7    EIKTLWVGDLHQWMDDNYLRTCFGHTGEVSSIKIIRNKQTGQSEGYGFVEFFSRATAEKI  66



>ref|XP_002468416.1| hypothetical protein SORBIDRAFT_01g045570 [Sorghum bicolor]
 gb|EER95414.1| hypothetical protein SORBIDRAFT_01g045570 [Sorghum bicolor]
Length=415

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DENY+ +CFAHTGE+ S K+IRNK+T   EGYGF+EF SH AAE I
Sbjct  13   EVRTLWIGDLQYWTDENYLYSCFAHTGEVQSVKIIRNKVTSLPEGYGFIEFVSHEAAEKI  72



>ref|XP_006401513.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
 gb|ESQ42966.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
Length=401

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E++SLWIGDLQ WMDENYI + FA TGE  S+KVIRNK TGQ EGYGF+EF +HAAAE +
Sbjct  71   EIRSLWIGDLQPWMDENYIMSIFAQTGEAQSAKVIRNKQTGQCEGYGFIEFANHAAAERV  130



>emb|CDY34835.1| BnaA09g47610D [Brassica napus]
Length=393

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E+++LWIGDLQ+WMDEN++  CFAHTGE+ S KVIRNK T Q EGYGF+EF SHAAAE
Sbjct  57   EIRTLWIGDLQFWMDENFLYGCFAHTGEVLSVKVIRNKQTSQVEGYGFIEFVSHAAAE  114



>gb|ACR34003.1| unknown [Zea mays]
 tpg|DAA43640.1| TPA: RNA-binding post-transcriptional regulator csx1 [Zea mays]
Length=415

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DENY+ +CFAHTGE+ S K+IRNK+T   EGYGF+EF SH AAE I
Sbjct  13   EVRTLWIGDLQYWTDENYLYSCFAHTGEVQSVKIIRNKVTSLPEGYGFIEFVSHEAAEKI  72



>ref|NP_001152183.1| LOC100285821 [Zea mays]
 gb|ACG46276.1| RNA-binding post-transcriptional regulator csx1 [Zea mays]
Length=415

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DENY+ +CFAHTGE+ S K+IRNK+T   EGYGF+EF SH AAE I
Sbjct  13   EVRTLWIGDLQYWTDENYLYSCFAHTGEVQSVKIIRNKVTSLPEGYGFIEFVSHEAAEKI  72



>ref|XP_006401514.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
 gb|ESQ42967.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
Length=403

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E++SLWIGDLQ WMDENYI + FA TGE  S+KVIRNK TGQ EGYGF+EF +HAAAE +
Sbjct  71   EIRSLWIGDLQPWMDENYIMSIFAQTGEAQSAKVIRNKQTGQCEGYGFIEFANHAAAERV  130



>gb|KJB69305.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=286

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQY+MDENY+ +CFA TGE+ S KVIRNK TGQ EGYGF+EF S AAAE +
Sbjct  88   EVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAERV  147



>ref|XP_003529385.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E++++W+GDL +WMDENY++ CFAHTGE+ S+KVIRNK TGQSEGYGFVEF S A AE +
Sbjct  99   EIRTVWLGDLHHWMDENYLHNCFAHTGEVVSAKVIRNKQTGQSEGYGFVEFYSRATAEKV  158



>dbj|BAJ93453.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=416

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DENY+  CFAHTGE+ S K+IRNKL+G  EGYGF+EF SH AAE +
Sbjct  15   EVRTLWIGDLQYWADENYLYGCFAHTGEVQSVKLIRNKLSGLPEGYGFIEFISHEAAEKV  74



>ref|XP_010647773.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Vitis vinifera]
Length=414

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+K+LW+GDL  WMD+NY+ TCF HTGE++S K+IRNK TGQSEGYGFVEF S A AE I
Sbjct  79   EIKTLWVGDLHQWMDDNYLRTCFGHTGEVSSIKIIRNKQTGQSEGYGFVEFFSRATAEKI  138



>gb|EMS68789.1| Uncharacterized RNA-binding protein C23E6.01c [Triticum urartu]
Length=385

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DENY+  CFAHTGE+ S K+IRNKL+G  EGYGF+EF SH AAE +
Sbjct  13   EVRTLWIGDLQYWADENYLYGCFAHTGEVQSVKLIRNKLSGLPEGYGFIEFISHEAAEKV  72



>gb|EEC74608.1| hypothetical protein OsI_10216 [Oryza sativa Indica Group]
Length=416

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DENY+  CFAHTGEL S K+IRNKLT   EGYGF+EF SH  AE +
Sbjct  14   EVRTLWIGDLQYWADENYLYNCFAHTGELQSVKIIRNKLTSLPEGYGFIEFISHEVAEKV  73



>gb|KCW63816.1| hypothetical protein EUGRSUZ_G01492 [Eucalyptus grandis]
Length=432

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            + K++WIGDL +WMDE Y++ CF+HTGE++S KVIRNK TGQSEGYGFVEF SHA AE +
Sbjct  97   DAKTIWIGDLHHWMDETYLHNCFSHTGEVSSVKVIRNKQTGQSEGYGFVEFSSHATAEKV  156



>gb|ABF94248.1| RNA recognition motif family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG89475.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DENY+  CFAHTGEL S K+IRNKLT   EGYGF+EF SH  AE +
Sbjct  14   EVRTLWIGDLQYWADENYLYNCFAHTGELQSVKIIRNKLTSLPEGYGFIEFISHEVAEKV  73



>emb|CDY19874.1| BnaC09g31400D [Brassica napus]
Length=419

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E++SLWIG LQ WMDENYI T FA TGE+ S+KVIRNKLTG  EGYGFVEF +HAAAE +
Sbjct  69   EIRSLWIGALQPWMDENYIMTVFAQTGEVQSAKVIRNKLTGMCEGYGFVEFANHAAAERV  128



>gb|AAM67293.1| nuclear acid binding protein, putative [Arabidopsis thaliana]
Length=392

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            +VK+LW+GDL +WMDE Y+++CF+HTGE++S KVIRNKLT QSEGYGFVEF S AAAE +
Sbjct  63   DVKTLWVGDLLHWMDETYLHSCFSHTGEVSSVKVIRNKLTSQSEGYGFVEFLSRAAAEEV  122



>ref|XP_010276065.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Nelumbo 
nucifera]
Length=417

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWM+ENY+++CFAHTGE+ S KVI NK TGQSEGYGF+EF + A AE I
Sbjct  88   EIRTLWIGDLQYWMEENYLHSCFAHTGEVASIKVIHNKQTGQSEGYGFIEFLTRAIAERI  147



>dbj|BAE71189.1| putative DNA binding protein [Trifolium pratense]
Length=253

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+  CF+HTGE+ + KVIRNK T QSEGYGF+EF S A AE I
Sbjct  66   EVRTLWIGDLQYWMDENYLYQCFSHTGEVGNVKVIRNKQTNQSEGYGFLEFTSRAGAERI  125



>ref|XP_010066047.1| PREDICTED: polyadenylate-binding protein RBP47 [Eucalyptus grandis]
Length=445

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            + K++WIGDL +WMDE Y++ CF+HTGE++S KVIRNK TGQSEGYGFVEF SHA AE +
Sbjct  110  DAKTIWIGDLHHWMDETYLHNCFSHTGEVSSVKVIRNKQTGQSEGYGFVEFSSHATAEKV  169



>ref|XP_010276064.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Nelumbo 
nucifera]
Length=425

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWM+ENY+++CFAHTGE+ S KVI NK TGQSEGYGF+EF + A AE I
Sbjct  88   EIRTLWIGDLQYWMEENYLHSCFAHTGEVASIKVIHNKQTGQSEGYGFIEFLTRAIAERI  147



>ref|NP_001049124.1| Os03g0174100 [Oryza sativa Japonica Group]
 dbj|BAF11038.1| Os03g0174100, partial [Oryza sativa Japonica Group]
Length=438

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYW DENY+  CFAHTGEL S K+IRNKLT   EGYGF+EF SH  AE +
Sbjct  36   EVRTLWIGDLQYWADENYLYNCFAHTGELQSVKIIRNKLTSLPEGYGFIEFISHEVAEKV  95



>ref|NP_188544.1| RNA-binding protein 47B [Arabidopsis thaliana]
 sp|Q0WW84.1|RB47B_ARATH RecName: Full=Polyadenylate-binding protein RBP47B; Short=Poly(A)-binding 
protein RBP47B; AltName: Full=RNA-binding protein 
47B; Short=AtRBP47B [Arabidopsis thaliana]
 dbj|BAE98614.1| putative nuclear acid binding protein [Arabidopsis thaliana]
 gb|ABH04596.1| At3g19130 [Arabidopsis thaliana]
 gb|AEE76196.1| RNA-binding protein 47B [Arabidopsis thaliana]
Length=435

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            +VK+LW+GDL +WMDE Y+++CF+HTGE++S KVIRNKLT QSEGYGFVEF S AAAE +
Sbjct  106  DVKTLWVGDLLHWMDETYLHSCFSHTGEVSSVKVIRNKLTSQSEGYGFVEFLSRAAAEEV  165



>gb|KJB69303.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=419

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQY+MDENY+ +CFA TGE+ S KVIRNK TGQ EGYGF+EF S AAAE +
Sbjct  88   EVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAERV  147



>dbj|BAB02953.1| DNA/RNA binding protein-like [Arabidopsis thaliana]
Length=489

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            +VK+LW+GDL +WMDE Y+++CF+HTGE++S KVIRNKLT QSEGYGFVEF S AAAE +
Sbjct  106  DVKTLWVGDLLHWMDETYLHSCFSHTGEVSSVKVIRNKLTSQSEGYGFVEFLSRAAAEEV  165



>ref|NP_001132004.1| uncharacterized protein LOC100193409 [Zea mays]
 gb|ACF80669.1| unknown [Zea mays]
Length=422

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL +WMDENY++ CF +TGE+ + KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  90   ENKTIWVGDLHFWMDENYLHNCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAERV  149



>ref|XP_009135617.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Brassica 
rapa]
 emb|CDX82310.1| BnaA03g35110D [Brassica napus]
Length=412

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            +VK+LWIGDL +WMDE Y++TCF+HTGE++S KVIRNKLT QSEGYGFVEF + AAAE +
Sbjct  93   DVKTLWIGDLLHWMDETYLHTCFSHTGEVSSVKVIRNKLTCQSEGYGFVEFLTRAAAEEV  152



>gb|KFK27100.1| hypothetical protein AALP_AA8G334500 [Arabis alpina]
Length=407

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E++SLWIGDLQ WMDENY+N+ FA +GE+ S KVIRNK +GQ+EGYGF+EF +HAAAE
Sbjct  72   EIRSLWIGDLQPWMDENYLNSIFAQSGEVQSVKVIRNKQSGQTEGYGFIEFANHAAAE  129



>gb|KJB69301.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=427

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQY+MDENY+ +CFA TGE+ S KVIRNK TGQ EGYGF+EF S AAAE +
Sbjct  88   EVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAERV  147



>ref|XP_010546929.1| PREDICTED: polyadenylate-binding protein RBP45B [Tarenaya hassleriana]
Length=416

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LWIGDLQYWMDEN++  CFAHTGE++S KVIRNK T Q EGYGF+EF S AAAE +
Sbjct  75   EIRTLWIGDLQYWMDENFLFNCFAHTGEVSSVKVIRNKQTQQIEGYGFLEFVSRAAAERV  134



>gb|KFK27101.1| hypothetical protein AALP_AA8G334500 [Arabis alpina]
Length=405

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAE  506
            E++SLWIGDLQ WMDENY+N+ FA +GE+ S KVIRNK +GQ+EGYGF+EF +HAAAE
Sbjct  72   EIRSLWIGDLQPWMDENYLNSIFAQSGEVQSVKVIRNKQSGQTEGYGFIEFANHAAAE  129



>gb|KDP20762.1| hypothetical protein JCGZ_21233 [Jatropha curcas]
Length=431

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            +V++LWIGDLQYWMDE+Y+++CFA TGE+ + KVIRNK TGQ EGYGF+EF SH +AE +
Sbjct  92   DVRTLWIGDLQYWMDESYLHSCFAQTGEVVNVKVIRNKQTGQVEGYGFIEFNSHGSAERV  151



>ref|XP_008667171.1| PREDICTED: uncharacterized protein LOC100193409 isoform X1 [Zea 
mays]
 tpg|DAA40260.1| TPA: hypothetical protein ZEAMMB73_589753 [Zea mays]
Length=424

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL +WMDENY++ CF +TGE+ + KVIRNK TGQSEGYGFVEF SHAAAE +
Sbjct  90   ENKTIWVGDLHFWMDENYLHNCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHAAAERV  149



>gb|EAZ27536.1| hypothetical protein OsJ_11491 [Oryza sativa Japonica Group]
Length=257

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQ+WM+ENY+  CF+  GEL S+K+IRNK TGQ EGYGF+EF SHA AE +
Sbjct  65   EVRTLWIGDLQFWMEENYLYNCFSQAGELISAKIIRNKQTGQPEGYGFIEFGSHAIAEQV  124



>ref|XP_004957051.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Setaria 
italica]
Length=437

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL YWMDENY+++CF +TGE+ + KVIRNK TGQSEGYGFVEF SH AAE +
Sbjct  107  ENKTVWVGDLHYWMDENYLHSCFGYTGEVVAIKVIRNKQTGQSEGYGFVEFYSHGAAEKV  166



>ref|XP_003573391.1| PREDICTED: polyadenylate-binding protein RBP45-like [Brachypodium 
distachyon]
Length=435

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            EV++LWIGDLQYWMDENY+  CFAHTGE+ S K+IR+K TGQ +GYGFVEF + A AE +
Sbjct  96   EVRTLWIGDLQYWMDENYVYGCFAHTGEVQSVKLIRDKQTGQLQGYGFVEFTTRAGAERV  155



>ref|XP_008796097.1| PREDICTED: polyadenylate-binding protein RBP45 [Phoenix dactylifera]
Length=420

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E+++LW+GDLQYWMDENY+  CFA TGE+ S K+IRNK TGQSEGYGF+EF + AAAE +
Sbjct  82   EIRTLWVGDLQYWMDENYLFGCFASTGEVLSVKMIRNKQTGQSEGYGFIEFATRAAAERV  141



>ref|XP_003518846.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E++++W+GDL +WMDENY++ CFAHTGE+ S+KVIRNK TGQSEGYGFVEF S   AE +
Sbjct  98   EIRTVWLGDLHHWMDENYLHNCFAHTGEVVSAKVIRNKQTGQSEGYGFVEFYSRGTAEKV  157



>emb|CDX95462.1| BnaC01g33540D [Brassica napus]
Length=434

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            +VK+LW+GDL +WMDE Y++TCF+HTGE++S KVIRNKLT QSEGYGFVEF + AAAE +
Sbjct  107  DVKTLWVGDLLHWMDETYLHTCFSHTGEVSSVKVIRNKLTCQSEGYGFVEFLTRAAAEEV  166



>ref|XP_008813039.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X3 
[Phoenix dactylifera]
Length=350

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  333  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  512
            E K++W+GDL YWM+ENY+++CF HTGE+ S KVIRNK TGQSEGYGFVEF + AAAE +
Sbjct  74   ENKTIWVGDLHYWMEENYLHSCFGHTGEVVSIKVIRNKQTGQSEGYGFVEFYTRAAAEKV  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115