BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF021O13

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    109   6e-24   Solanum tuberosum [potatoes]
ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        109   7e-24   Solanum lycopersicum
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        105   2e-22   Nicotiana sylvestris
gb|KDP22711.1|  hypothetical protein JCGZ_01813                         104   3e-22   Jatropha curcas
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    103   1e-21   Sesamum indicum [beniseed]
dbj|BAG16527.1|  putative aconitase                                     103   1e-21   Capsicum chinense [bonnet pepper]
ref|XP_002524184.1|  aconitase, putative                                102   2e-21   Ricinus communis
ref|XP_006376779.1|  aconitate hydratase family protein                 102   3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        100   9e-21   Nicotiana tomentosiformis
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        100   1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        100   1e-20   Populus euphratica
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        100   1e-20   Eucalyptus grandis [rose gum]
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  98.6    3e-20   Populus euphratica
emb|CDP05740.1|  unnamed protein product                              98.2    6e-20   Coffea canephora [robusta coffee]
emb|CDP10817.1|  unnamed protein product                              97.8    6e-20   Coffea canephora [robusta coffee]
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg           94.4    1e-18   Citrus clementina [clementine]
gb|KDO62733.1|  hypothetical protein CISIN_1g001863mg                 94.0    1e-18   Citrus sinensis [apfelsine]
gb|EPS60517.1|  hypothetical protein M569_14286                       93.6    1e-18   Genlisea aurea
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g           92.8    4e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  90.1    3e-17   Solanum tuberosum [potatoes]
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg              88.2    1e-16   Erythranthe guttata [common monkey flower]
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...  87.0    3e-16   Nicotiana tomentosiformis
ref|XP_009598331.1|  PREDICTED: aconitate hydratase 2, mitochondr...  87.0    3e-16   Nicotiana tomentosiformis
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                 84.7    2e-15   Citrus sinensis [apfelsine]
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                 84.7    2e-15   Citrus sinensis [apfelsine]
gb|KDO54659.1|  hypothetical protein CISIN_1g001917mg                 84.7    2e-15   Citrus sinensis [apfelsine]
gb|KDO54661.1|  hypothetical protein CISIN_1g001917mg                 84.7    2e-15   Citrus sinensis [apfelsine]
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg           84.7    2e-15   Citrus clementina [clementine]
gb|KDO54660.1|  hypothetical protein CISIN_1g001917mg                 84.7    2e-15   Citrus sinensis [apfelsine]
ref|XP_006447556.1|  hypothetical protein CICLE_v10014140mg           84.7    2e-15   
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic      84.7    2e-15   Vitis vinifera
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  84.3    2e-15   Nelumbo nucifera [Indian lotus]
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                      82.8    7e-15   Glycine soja [wild soybean]
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...  82.8    7e-15   Glycine max [soybeans]
ref|XP_009787326.1|  PREDICTED: aconitate hydratase 2, mitochondr...  81.3    2e-14   Nicotiana sylvestris
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  81.6    2e-14   Nicotiana sylvestris
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...  80.1    7e-14   Glycine max [soybeans]
ref|XP_007045642.1|  Aconitase 3                                      77.0    7e-13   
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic      76.3    1e-12   Solanum lycopersicum
gb|KDP39136.1|  hypothetical protein JCGZ_00893                       75.1    3e-12   Jatropha curcas
ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic      73.9    7e-12   Sesamum indicum [beniseed]
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g           73.9    7e-12   Phaseolus vulgaris [French bean]
gb|KJB60837.1|  hypothetical protein B456_009G327800                  73.9    7e-12   Gossypium raimondii
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  73.9    7e-12   Cucumis sativus [cucumbers]
gb|KJB60836.1|  hypothetical protein B456_009G327800                  73.9    7e-12   Gossypium raimondii
gb|KJB60835.1|  hypothetical protein B456_009G327800                  73.9    8e-12   Gossypium raimondii
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...  73.6    9e-12   Solanum tuberosum [potatoes]
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...  72.8    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic      72.4    2e-11   
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg              72.0    3e-11   Erythranthe guttata [common monkey flower]
gb|KJB50479.1|  hypothetical protein B456_008G173400                  72.0    3e-11   Gossypium raimondii
ref|XP_003596988.1|  Aconitate hydratase                              72.0    3e-11   Medicago truncatula
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic      71.6    4e-11   Pyrus x bretschneideri [bai li]
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  71.6    4e-11   Glycine max [soybeans]
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099           71.6    4e-11   
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...  71.6    4e-11   Cicer arietinum [garbanzo]
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg           71.2    5e-11   Capsella rubella
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg           70.9    8e-11   Eutrema salsugineum [saltwater cress]
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  70.9    8e-11   Nicotiana tomentosiformis
ref|XP_006592372.1|  PREDICTED: aconitate hydratase 2, mitochondr...  70.5    9e-11   Glycine max [soybeans]
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...  70.5    9e-11   Glycine max [soybeans]
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  70.5    1e-10   Nicotiana sylvestris
gb|KJB62847.1|  hypothetical protein B456_009G440000                  70.5    1e-10   Gossypium raimondii
ref|NP_567763.2|  aconitase 2                                         70.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAK91447.1|  AT4g26970/F10M23_310                                  70.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial  69.7    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic      69.7    2e-10   Cucumis melo [Oriental melon]
ref|XP_004159202.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  69.7    2e-10   
ref|XP_002532564.1|  aconitase, putative                              69.3    2e-10   
gb|KHG15607.1|  Aconitate hydratase 2, mitochondrial -like protein    67.8    5e-10   Gossypium arboreum [tree cotton]
ref|XP_010445106.1|  PREDICTED: aconitate hydratase 3, mitochondr...  66.2    1e-09   
gb|KJB62848.1|  hypothetical protein B456_009G440000                  67.0    1e-09   Gossypium raimondii
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein    67.0    1e-09   Gossypium arboreum [tree cotton]
emb|CDY14291.1|  BnaA08g14220D                                        66.2    2e-09   Brassica napus [oilseed rape]
emb|CDY66424.1|  BnaAnng22230D                                        66.2    2e-09   Brassica napus [oilseed rape]
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  65.9    3e-09   
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic      65.9    3e-09   Prunus mume [ume]
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg           65.1    5e-09   Prunus persica
gb|KJB30566.1|  hypothetical protein B456_005G149700                  64.7    6e-09   Gossypium raimondii
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial  64.7    6e-09   Brassica rapa
gb|KJB30569.1|  hypothetical protein B456_005G149700                  64.7    7e-09   Gossypium raimondii
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                  64.3    8e-09   Arabis alpina [alpine rockcress]
ref|XP_010100637.1|  Aconitate hydratase                              64.3    9e-09   
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...  64.3    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial  63.9    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...  63.5    1e-08   
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186           62.8    3e-08   
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...  62.4    4e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...  61.6    7e-08   Elaeis guineensis
emb|CDY50945.1|  BnaC03g74450D                                        60.8    1e-07   Brassica napus [oilseed rape]
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...  60.8    1e-07   Camelina sativa [gold-of-pleasure]
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                  60.1    2e-07   Gossypium arboreum [tree cotton]
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                  59.7    3e-07   Arabis alpina [alpine rockcress]
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg           59.3    4e-07   Capsella rubella
ref|XP_007020811.1|  Aconitase 3                                      58.9    5e-07   
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic      58.2    8e-07   Vitis vinifera
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial  58.2    9e-07   Brassica rapa
emb|CDX97969.1|  BnaA06g07200D                                        58.2    9e-07   
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...  58.2    9e-07   Phoenix dactylifera
emb|CDY18054.1|  BnaC07g04160D                                        57.8    1e-06   Brassica napus [oilseed rape]
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic      57.8    1e-06   Fragaria vesca subsp. vesca
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial  57.8    1e-06   Brassica rapa
ref|XP_003605929.1|  Aconitate hydratase                              55.8    4e-06   Medicago truncatula
ref|NP_178634.2|  aconitate hydratase 3                               55.8    5e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KHG02134.1|  hypothetical protein F383_25649                       55.8    5e-06   Gossypium arboreum [tree cotton]
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...  55.1    9e-06   
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg           53.9    2e-05   Eutrema salsugineum [saltwater cress]
emb|CDX93088.1|  BnaA03g38100D                                        53.9    2e-05   
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...  52.8    5e-05   Camelina sativa [gold-of-pleasure]
emb|CDY56501.1|  BnaAnng14360D                                        51.6    1e-04   Brassica napus [oilseed rape]
ref|XP_007132546.1|  hypothetical protein PHAVU_011G1037001g          51.6    1e-04   Phaseolus vulgaris [French bean]
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...  49.3    6e-04   Cicer arietinum [garbanzo]



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   109 bits (273),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  376  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            ++S  RSLRCSVPRWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKGI 
Sbjct  53   YSSTLRSLRCSVPRWSHGVDWKSPISLTAQIRTAAPALNGFHRKLATMAAENPFKGIL  110



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   109 bits (272),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  376  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            ++S  RSLRCSVPRWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKGI 
Sbjct  51   YSSTLRSLRCSVPRWSHGVDWKSPISLTAQIRTAAPALNGFHRKLATMAAENPFKGIL  108



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  376  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            F+S FRS+RCSVPRWSHG+DWKSP SLTAQIR+AAP LN FHRK++TMA +NPFK I 
Sbjct  52   FSSTFRSVRCSVPRWSHGIDWKSPISLTAQIRTAAPALNSFHRKLSTMAEKNPFKEIL  109



>gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+F +A RS RCSVPRWSHGVDW+SP SL +QIRSAAPV+  F RKIATMA+E+PFKG
Sbjct  50   RSLSFTAAVRSFRCSVPRWSHGVDWRSPVSLRSQIRSAAPVIEQFQRKIATMAAEHPFKG  109

Query  544  I  546
            I
Sbjct  110  I  110



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+F+SA RS+RCS PRWSHGVDW+SP SL AQIR+A+PVL  F RKIATMASE+PF G
Sbjct  63   RSLSFSSALRSIRCSAPRWSHGVDWRSPVSLRAQIRTASPVLERFERKIATMASEHPFSG  122

Query  544  IF  549
            I 
Sbjct  123  IL  124



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  376  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            ++S  RSL CSV RWSHGVDWKSP SLTAQIR+AAP LN FHRK+ATMA+ENPFKGI 
Sbjct  51   YSSTLRSLGCSVTRWSHGVDWKSPISLTAQIRTAAPALNSFHRKLATMAAENPFKGIL  108



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+F++A RSLRCSVPRWSHGVDW+SP SL +QIR+A+PV+  F RKI+TMA+E+PFKG
Sbjct  48   RSLSFSAAVRSLRCSVPRWSHGVDWRSPVSLRSQIRTASPVIERFQRKISTMAAEHPFKG  107

Query  544  I  546
            I
Sbjct  108  I  108



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   102 bits (253),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+F+SA RSLRCS PRWSHGVDW+SPA+L  QIR+ APV+  F RKIATMA E+PFKG
Sbjct  47   RSLSFSSAVRSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIATMAHEHPFKG  106

Query  544  IF  549
            IF
Sbjct  107  IF  108



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   100 bits (249),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  376  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            F+S  RS+RCSVPRWSHGVDWKSP SLTAQIR+AAP  N FH+K++TMA +NPFK I 
Sbjct  53   FSSTLRSVRCSVPRWSHGVDWKSPISLTAQIRTAAPAFNSFHKKLSTMAEKNPFKEIL  110



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+F+SAFRSLR S PRWSHG DW+SP SL AQIR+AAPV+  F RKIATMASEN FKG
Sbjct  44   RSLSFSSAFRSLRSSPPRWSHGYDWRSPLSLRAQIRTAAPVIERFQRKIATMASENAFKG  103

Query  544  IF  549
            I 
Sbjct  104  IL  105



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+F+SAFRSLRCS PRWSHGVDW+SPA+L  QIR+ +P +  F RKIATM  E+PFKG
Sbjct  53   RSLSFSSAFRSLRCSYPRWSHGVDWRSPATLRHQIRAVSPFVERFQRKIATMVPEHPFKG  112

Query  544  IF  549
            IF
Sbjct  113  IF  114



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+F+SAFRSLR SVPRWSHGVDW+SPASL  QIR+ APV+    RK ATMASENPFK 
Sbjct  48   RSLSFSSAFRSLRSSVPRWSHGVDWRSPASLRPQIRAVAPVIERLQRKFATMASENPFKE  107

Query  544  IF  549
            I 
Sbjct  108  IL  109



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R  +F SA RSLRCS PRWSHGVDW+SPA+L  QIR+ APV+  F RKIATMA E+PFKG
Sbjct  47   RSSSFTSAVRSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIATMAHEHPFKG  106

Query  544  IF  549
            IF
Sbjct  107  IF  108



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R    +SA RSLRCSVPRWSHGVDW+SP SL AQIR+AAPV+  F RKIATMA E+P+KG
Sbjct  63   RSFKPSSAVRSLRCSVPRWSHGVDWRSPVSLRAQIRTAAPVIERFERKIATMAPEHPYKG  122

Query  544  IF  549
            I 
Sbjct  123  IL  124



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+++SA RS+R SVPRWSHGVDWKSP+SL +QIR+ +P  N F+RK+ATMASENPFKG
Sbjct  62   RLLSYSSALRSVRSSVPRWSHGVDWKSPSSLCSQIRTTSPACNGFYRKMATMASENPFKG  121



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+F+SA R++RCS PRWSHGV+W+SP SL AQ R AAPVL  F RKIA+MA EN FKG
Sbjct  54   RSLSFSSALRTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIASMAPENAFKG  113

Query  544  IF  549
            I 
Sbjct  114  IL  115



>gb|KDO62733.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=875

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+F+SA R++RCS PRWSHGV+W+SP SL AQ R AAPVL  F RKIA+MA EN FKG
Sbjct  54   RSLSFSSALRTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIASMAPENAFKG  113

Query  544  IF  549
            I 
Sbjct  114  IL  115



>gb|EPS60517.1| hypothetical protein M569_14286, partial [Genlisea aurea]
Length=862

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+F+SA RSLR S PRWSHGVDW+ P SL +QI + +PVL  FHRKIATMASE+PF G
Sbjct  17   RSLSFSSAIRSLRISAPRWSHGVDWRYPVSLRSQIGTVSPVLERFHRKIATMASEHPFSG  76

Query  544  IF  549
            + 
Sbjct  77   LL  78



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+F+SA RSLRCS  RWSHGVDW+SPA+L  QIR+ AP +  F RKIATMA E+PFKG
Sbjct  51   RSLSFSSAVRSLRCSYRRWSHGVDWRSPATLRHQIRAVAPFVERFQRKIATMAPEHPFKG  110

Query  544  IF  549
            IF
Sbjct  111  IF  112



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 7/62 (11%)
 Frame = +1

Query  370  LTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPFKG  543
            L F+S FRS     PRWS+GVDWKSP SL AQIR+AA  PVLN+FHRK+ TMASENPFKG
Sbjct  38   LGFSSTFRS-----PRWSYGVDWKSPISLKAQIRTAAVTPVLNNFHRKLTTMASENPFKG  92

Query  544  IF  549
            I 
Sbjct  93   IL  94



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  364  RPLTFASAFRSLR-CSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  540
            R L+F+SA RS+R  S  RWSHG DW+SP SL AQIRS++PVL  F RKIATMASE+PF 
Sbjct  61   RSLSFSSALRSIRYSSSQRWSHGADWRSPVSLRAQIRSSSPVLERFERKIATMASEHPFN  120

Query  541  GIF  549
            GI 
Sbjct  121  GIL  123



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R  +F+SA  SLR SVPRWSHGVDW+SP SL AQ+R+A+P +    R IATMASE+PF+G
Sbjct  116  RSFSFSSALPSLRYSVPRWSHGVDWRSPISLRAQVRTASPDIEPLDRNIATMASEHPFRG  175

Query  544  IF  549
            IF
Sbjct  176  IF  177



>ref|XP_009598331.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R  +F+SA  SLR SVPRWSHGVDW+SP SL AQ+R+A+P +    R IATMASE+PF+G
Sbjct  116  RSFSFSSALPSLRYSVPRWSHGVDWRSPISLRAQVRTASPDIEPLDRNIATMASEHPFRG  175

Query  544  IF  549
            IF
Sbjct  176  IF  177



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  544  IF  549
            I 
Sbjct  108  IL  109



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  544  IF  549
            I 
Sbjct  108  IL  109



>gb|KDO54659.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=896

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  544  IF  549
            I 
Sbjct  108  IL  109



>gb|KDO54661.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=876

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  544  IF  549
            I 
Sbjct  108  IL  109



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  52   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  111

Query  544  IF  549
            I 
Sbjct  112  IL  113



>gb|KDO54660.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=902

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  544  IF  549
            I 
Sbjct  108  IL  109



>ref|XP_006447556.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 gb|ESR60796.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=888

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  ATMA+E+PFK 
Sbjct  52   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  111

Query  544  IF  549
            I 
Sbjct  112  IL  113



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L F SAFRS      RWSHGVDW+SP SL AQIR+AAPV+  F RK+AT+ASE+PFKG
Sbjct  66   RSLGFLSAFRS-----RRWSHGVDWRSPVSLRAQIRAAAPVIERFERKMATIASEHPFKG  120

Query  544  IF  549
            I 
Sbjct  121  IL  122



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  400  RCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            R S PRWSHG DWKSP SL AQIR+AAPV+  F RKIATMASEN FKGI 
Sbjct  61   RSSAPRWSHGFDWKSPLSLRAQIRTAAPVIERFQRKIATMASENAFKGIL  110



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            P + ++A RS   +VPRWSHGVDW+SP  L  QIR+AAP++  FHR+IAT A++NPFKG
Sbjct  37   PGSSSAATRSFGSAVPRWSHGVDWRSPLGLRPQIRAAAPLIERFHRRIATSATDNPFKG  95



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            P + ++A RS   +VPRWSHGVDW+SP  L  QIR+AAP++  FHR+IAT A++NPFKG
Sbjct  37   PGSSSAATRSFGSAVPRWSHGVDWRSPLGLRPQIRAAAPLIERFHRRIATSATDNPFKG  95



>ref|XP_009787326.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=818

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  376  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            F+SA  SL  S PRWSHGVDW+SP SL AQIR+A+P +    R IATMASE+PF+GIF
Sbjct  73   FSSALPSLSYSTPRWSHGVDWRSPISLRAQIRTASPDIERLDRNIATMASEHPFRGIF  130



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  376  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            F+SA  SL  S PRWSHGVDW+SP SL AQIR+A+P +    R IATMASE+PF+GIF
Sbjct  73   FSSALPSLSYSTPRWSHGVDWRSPISLRAQIRTASPDIERLDRNIATMASEHPFRGIF  130



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  367  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            P + A+A RS   +VPRWS GVDW+SP  L   IR+AAP++  FHR+IAT A+ENPFKG
Sbjct  37   PGSSAAATRSFGSAVPRWSRGVDWRSPLGLRPHIRAAAPLIERFHRRIATSATENPFKG  95



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R LT ++A RS   SVPRWSH +DW+SP SL AQIR+  PV+    RK ATMASE+PFK 
Sbjct  48   RSLT-SAAVRSFHGSVPRWSHRLDWRSPLSLRAQIRAVTPVIERLERKFATMASEHPFKA  106

Query  544  IF  549
            + 
Sbjct  107  VL  108



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 43/56 (77%), Gaps = 7/56 (13%)
 Frame = +1

Query  388  FRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPFKGIF  549
            FRSLR     W +GVDWKSP SLT+QIR+AA  PVLN+F RK+ TMAS NPFKGI 
Sbjct  44   FRSLR-----WRYGVDWKSPISLTSQIRTAAVTPVLNNFRRKLTTMASGNPFKGIL  94



>gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 6/62 (10%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+F+   RSLRCS P WSHGVDW SP SL AQ R ++PV+    R+++TM SE+PFKG
Sbjct  57   RYLSFS---RSLRCSAPLWSHGVDWHSPISLRAQARVSSPVV---ERRLSTMTSEHPFKG  110

Query  544  IF  549
            I 
Sbjct  111  IL  112



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/57 (70%), Positives = 43/57 (75%), Gaps = 4/57 (7%)
 Frame = +1

Query  388  FRSLR-CSVPRWSHGVDWKSPASLTAQIRSAAPVLND--FHRKIATMASENPFKGIF  549
             RSL   S  RWSHGVDWKSP SL AQIR A+ V +D   HRKIATMA+ENPFKGIF
Sbjct  55   LRSLSYLSAARWSHGVDWKSPPSLAAQIRIAS-VSSDTLLHRKIATMAAENPFKGIF  110



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  406  SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            +VPRWSHGVDW+SP  L  QIR+ AP++  FHR+IAT A +NPFKG
Sbjct  49   AVPRWSHGVDWRSPLGLRHQIRAVAPLIERFHRRIATSALDNPFKG  94



>gb|KJB60837.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=865

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  379  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + 
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVL  103



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 42/59 (71%), Gaps = 4/59 (7%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  540
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK
Sbjct  45   RSLSASSAFRS----TARWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFK  99



>gb|KJB60836.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=860

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  379  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + 
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVL  103



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  379  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +TMA+E+PFK + 
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVL  103



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 4/59 (7%)
 Frame = +1

Query  376  FASAFRSLRCSVPRWS-HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            FA+ +RS+RCSVPRWS +GV+ + P SL AQIR+A+ V+    R +ATMASE+PFKGIF
Sbjct  38   FATTYRSIRCSVPRWSNYGVNRRFPISLKAQIRTASQVV---ERNVATMASEHPFKGIF  93



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +1

Query  364  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  537
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R++APV+  F RK ATMASE+ +
Sbjct  48   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQSRNSAPVMEKFERKYATMASEHAY  107

Query  538  KGIF  549
            K I 
Sbjct  108  KDIL  111



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 2/59 (3%)
 Frame = +1

Query  370  LTFASAFRSLRCSVPRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            L F SA  + R S PRWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK 
Sbjct  48   LRFLSASSAAR-SFPRWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKIASMASENPFKA  105



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +1

Query  406  SVPRWSHGVDWKSPASLTAQIR-SAAPVLNDFHRKIATMASENPFKGIF  549
            S  RWSHGVDWKSPASL +QIR S+A      HRKIATMASEN FKGIF
Sbjct  60   SAARWSHGVDWKSPASLASQIRISSAFSDTLLHRKIATMASENAFKGIF  108



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R LT ++A RS  CSVPRWSH +DW+SP +L ++IR+  P++    RK ATMA+E+PFK 
Sbjct  49   RSLT-SAAVRSFHCSVPRWSHRLDWRSPLNLRSEIRAFNPIIEQLQRKFATMAAEHPFKA  107

Query  544  IF  549
            + 
Sbjct  108  VL  109



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  370  LTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
             T ++   + R +V RWSHGV W+SP SL  QIR+ AP +  +HRKIAT A ENPFKG
Sbjct  33   FTSSAVANAARSTVNRWSHGVLWRSPFSLRPQIRAVAPFIEQYHRKIATSAGENPFKG  90



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  540
            R L+ +SA RS     PRWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK
Sbjct  49   RFLSSSSAARSF----PRWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKIASMASENPFK  104

Query  541  G  543
             
Sbjct  105  A  105



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R  +F++A   LRCSVPRWSH +   SP S    I + APV+  FHR+IATMA+ENPFKG
Sbjct  31   RTSSFSAAPSLLRCSVPRWSHRLHSTSPLSPRPPITAVAPVVERFHRQIATMANENPFKG  90



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +1

Query  364  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  537
            R  +F+SA RS R CS   RWSHGV W SPASL AQ R++APV+  F R  ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGVSWGSPASLRAQSRNSAPVMEKFERTYATMASEHAY  104

Query  538  KGIF  549
            K I 
Sbjct  105  KDIL  108



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  409  VPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            V RWSHGV W+SP SL  QIR+ AP +  FHRKIAT A ENPFKG
Sbjct  52   VNRWSHGVHWRSPFSLRPQIRAVAPFIERFHRKIATSAGENPFKG  96



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +1

Query  364  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  537
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQSRISAPVMEKFERKYATMASEHAY  104

Query  538  KGIF  549
            K I 
Sbjct  105  KDIL  108



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +1

Query  364  RPLTFASAFRSLRC--SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  537
            R  +F+SA RS R   +  RWS+G +W+SPASL AQ R++APV+  F RK ATMASE+ +
Sbjct  48   RSKSFSSALRSFRVGSASTRWSYGGNWRSPASLRAQTRNSAPVMERFERKYATMASEHAY  107

Query  538  KGIF  549
            K I 
Sbjct  108  KDIL  111



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 44/64 (69%), Gaps = 11/64 (17%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPF  537
            R L F+SA RSLR     W    +WKSP  L AQIR+ A  PVLN FHRK++TMA+ENPF
Sbjct  44   RSLNFSSAVRSLR-----W----NWKSPIILKAQIRTTATTPVLNSFHRKLSTMAAENPF  94

Query  538  KGIF  549
            KGI 
Sbjct  95   KGIL  98



>ref|XP_006592372.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Glycine max]
Length=890

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            +F++  RSL CSVPRWSH +   SP +   +I + AP++  FHR+IATMA+ENPFKG
Sbjct  39   SFSATARSLLCSVPRWSHRLHSASPLTPRPRISAVAPLVERFHREIATMANENPFKG  95



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            +F++  RSL CSVPRWSH +   SP +   +I + AP++  FHR+IATMA+ENPFKG
Sbjct  39   SFSATARSLLCSVPRWSHRLHSASPLTPRPRISAVAPLVERFHREIATMANENPFKG  95



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 11/64 (17%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATMASENPF  537
            R L+F+SA RSLR     W    +WKSP SL AQIR+ A  PVLN  HRK++TMA+ENPF
Sbjct  48   RSLSFSSAVRSLR-----W----NWKSPISLKAQIRTTATTPVLNSSHRKLSTMAAENPF  98

Query  538  KGIF  549
            KGI 
Sbjct  99   KGIL  102



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+F+ + RSLRCS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG
Sbjct  49   RSLSFSYSLRSLRCSAPR----LHWRSPESLRVLARTSVPVVERFHRRIATTASEHPFKG  104

Query  544  I  546
            +
Sbjct  105  V  105



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +1

Query  364  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  537
            R  +F+SA RS R CS   RWSHG  W SPASL AQ R++ PV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWGSPASLRAQARNSTPVMEKFERKYATMASEHSY  104

Query  538  KGIF  549
            K I 
Sbjct  105  KDIL  108



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +1

Query  364  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  537
            R  +F+SA RS R CS   RWSHG  W SPASL AQ R++ PV+  F RK ATMASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWGSPASLRAQARNSTPVMEKFERKYATMASEHSY  104

Query  538  KGIF  549
            K I 
Sbjct  105  KDIL  108



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +1

Query  364  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  537
            R  +F+SA RS R CS   RWSHG  W+SP SL AQ R++APV+  F RK ATM SE+ +
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRSPVSLRAQSRNSAPVMEKFERKYATMTSEHAY  106

Query  538  KGIF  549
            K I 
Sbjct  107  KDIL  110



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 42/59 (71%), Gaps = 4/59 (7%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  540
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK
Sbjct  45   RSLSASSAFRS----TTRWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFK  99



>ref|XP_004159202.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
Length=989

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 42/59 (71%), Gaps = 4/59 (7%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  540
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK ++MA+ENPFK
Sbjct  45   RSLSASSAFRS----TARWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFK  99



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENP  534
            R  +F+SA RSL C+V RWSH VDW+SP SL AQ  +A+PV+    RK++T+ASE+P
Sbjct  51   RSFSFSSALRSLPCAVSRWSHRVDWRSPISLRAQAPAASPVI---ERKLSTIASEHP  104



>gb|KHG15607.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=668

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R LT ++A RS  CSVPRWS  +DW+SP +L ++IR+  P++    RK ATMA+E+PFK 
Sbjct  49   RSLT-STAVRSFHCSVPRWSPRLDWRSPLNLRSEIRAFNPIIEQLQRKFATMAAEHPFKA  107

Query  544  IF  549
            + 
Sbjct  108  VL  109



>ref|XP_010445106.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=383

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +1

Query  364  RPLTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  537
            R  +F+SA RS R CS   RWSHG  W+ PASL AQ R++APV+  F RK AT+ASE+ +
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRYPASLRAQSRNSAPVMEKFERKYATIASEHAY  106

Query  538  KGIF  549
            K I 
Sbjct  107  KDIL  110



>gb|KJB62848.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=864

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 4/62 (6%)
 Frame = +1

Query  364  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            R L+F+ + RSLRCS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG
Sbjct  49   RSLSFSYSLRSLRCSAPR----LHWRSPESLRVLARTSVPVVERFHRRIATTASEHPFKG  104

Query  544  IF  549
            + 
Sbjct  105  VM  106



>gb|KHG18502.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=933

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = +1

Query  379  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            ++A RS  CS PRWSH +DW+SP SL AQ+R+  PV+    RK +TMA+E+PFK + 
Sbjct  47   SAAVRSFHCS-PRWSHRLDWRSPFSLRAQVRAVNPVIERLERKFSTMAAEHPFKAVL  102



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +1

Query  364  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  537
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ +
Sbjct  45   RSRSFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHAY  104

Query  538  KGIF  549
            K + 
Sbjct  105  KDLL  108



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +1

Query  364  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPF  537
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ +
Sbjct  45   RSRSFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHAY  104

Query  538  KGIF  549
            K + 
Sbjct  105  KDLL  108



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  412  PRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  540
            PRWSHG V W+S  +L +QIR+ APV+  F RKIA+MASENPFK
Sbjct  59   PRWSHGGVHWRSSYTLRSQIRAVAPVIEQFQRKIASMASENPFK  102



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  415  RWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            RWSHG V W+SP +L +QIR+ APV+  F RKIA+MASENPFK 
Sbjct  64   RWSHGGVHWRSPYTLRSQIRAIAPVIEQFQRKIASMASENPFKA  107



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  415  RWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            RWSHG V W+SP +L +QIR+ APV+  F RK+A+MASENPFK 
Sbjct  64   RWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKMASMASENPFKA  107



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            T +   RS   S  RW H +DW+SP SL AQIR+  PV+  F ++ ATMA+E+PFK + 
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPFSLRAQIRALNPVIERFQKQFATMAAEHPFKEVL  105



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 42/61 (69%), Gaps = 2/61 (3%)
 Frame = +1

Query  373  TFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  546
            +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A+MASE+ ++ I
Sbjct  48   SFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHTYQDI  107

Query  547  F  549
             
Sbjct  108  L  108



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            T +   RS   S  RW H +DW+SP SL AQIR+  PV+  F ++ ATMA+E+PFK + 
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPFSLRAQIRALNPVIERFQKQFATMAAEHPFKEVL  105



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 4/66 (6%)
 Frame = +1

Query  364  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMA--SEN  531
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+  F RK AT+A  SE+
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQARISAPVMERFERKYATIASDSEH  106

Query  532  PFKGIF  549
             +K I 
Sbjct  107  AYKDIL  112



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 3/49 (6%)
 Frame = +1

Query  382  SAFRSLRC---SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATM  519
            +A+RSL     SVPRWSHGV W SP +L +QIR+ APV+  F RKIA+M
Sbjct  50   AAYRSLSSAVRSVPRWSHGVHWNSPYTLRSQIRAVAPVIQQFQRKIASM  98



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 5/60 (8%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  52   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  107



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 5/60 (8%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  49   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  104



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 5/60 (8%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+P+KGIF
Sbjct  49   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  104



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 5/60 (8%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            T + AFRSL    PRWSH    K SP  LT QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  51   TISPAFRSL----PRWSHCFHSKPSPFRLTTQIRAVSPVLDRLERTFSSMASEHPFKGIF  106



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  424  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            HGVDW+SP SL +QI ++ P++  F RKIATMASE+P+K IF
Sbjct  87   HGVDWRSPVSLRSQIAASPPLVERFQRKIATMASEHPYKEIF  128



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +1

Query  391  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            R L  S   W HG +W+SP SL AQIRS+A V+  F RK+AT+A+ENPFK I 
Sbjct  69   RPLVRSFGTWRHG-NWRSPVSLRAQIRSSAVVIERFQRKMATLATENPFKNIL  120



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 44/64 (69%), Gaps = 6/64 (9%)
 Frame = +1

Query  364  RPLTFAS-AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPF  537
            RP   +S AFRSL    PRWSH +  + SP  L++QIR+ +P L+   RK ++MASE+PF
Sbjct  49   RPFATSSPAFRSL----PRWSHCLHSRLSPFRLSSQIRAVSPGLDRLERKFSSMASEHPF  104

Query  538  KGIF  549
            KGIF
Sbjct  105  KGIF  108



>ref|XP_010443085.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443086.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443087.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443088.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443089.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443090.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443091.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443092.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=981

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +1

Query  370  LTFASAFRSLR-CSV-PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            + F  AFR  R CS   RWSHG +W+ PASL AQ R AAP L  F RK A++ASE+ +K 
Sbjct  38   VKFLLAFRLFRVCSAATRWSHGANWRLPASLQAQTRIAAPRLKKFERKFASIASEHAYKD  97

Query  544  IF  549
            I 
Sbjct  98   IL  99



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            T +   RS   S  RW H +DW+SP SL AQIR+  PV   F ++ ATMA+E+PFK + 
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPLSLRAQIRAFNPVTERFQKQFATMAAEHPFKEVL  105



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 5/60 (8%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            +FA+ FRSL    PRWSH +  + S   L++QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  44   SFATCFRSL----PRWSHCLHSRPSSFRLSSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  99



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +1

Query  385  AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            +F S+  +  RWSH    K SP SLT+QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  46   SFGSISPAFRRWSHCFHSKPSPISLTSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  101



>ref|XP_007020811.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12336.1| Aconitase 3 [Theobroma cacao]
Length=951

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  412  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMAS  525
            PRWSHGVDW SP SL AQ+R A PV+  F R+IAT+ S
Sbjct  67   PRWSHGVDWNSPGSLRAQVRIAVPVMERFRRRIATIGS  104



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 9/63 (14%)
 Frame = +1

Query  364  RPLTFAS-AFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFK  540
            R L F+S AFRSLR         V+++ P SL AQI +A PV+  F R+IATMA EN FK
Sbjct  46   RSLRFSSSAFRSLR--------SVNFRPPMSLRAQIGAAVPVVEQFQRRIATMAPENAFK  97

Query  541  GIF  549
            GI 
Sbjct  98   GIL  100



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 5/60 (8%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  49   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  104



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 5/60 (8%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  49   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  104



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +1

Query  391  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            R L  S   W HG   +SP SL AQIRS+A V+  F RK+ATMA+ENPFK I 
Sbjct  70   RPLVRSFGTWRHGSS-RSPVSLRAQIRSSAAVIERFQRKMATMATENPFKNIL  121



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 5/60 (8%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            T++ AFRSL     RWSH +  + SP  L++QIR+A+PVL+   +  ++MASE+PFKGI 
Sbjct  44   TYSPAFRSL----ARWSHCLHSRPSPFRLSSQIRTASPVLDRLEKNFSSMASEHPFKGIL  99



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +1

Query  367  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASE-NPFK  540
            P +F +       +  RWSHGV W++P +L +QIR+ APV+    R+IATMA E +PFK
Sbjct  42   PRSFTAQRLLSSSAATRWSHGVHWRAPYTLRSQIRAIAPVVERVQRRIATMAPESHPFK  100



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 5/60 (8%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  53   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  108



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +1

Query  367  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            PL+  ++ RS   S+PR++      S  SL  QI + AP++  FHRKIATMASENPFKG
Sbjct  33   PLSSRTS-RSFFYSLPRFNRRFHSSSHLSLRPQITAVAPLVERFHRKIATMASENPFKG  90



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 8/60 (13%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            T + AFR       RWSH    K SP   T+QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  51   TISPAFR-------RWSHSFHSKPSPFRFTSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  103



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 4/48 (8%)
 Frame = +1

Query  403  CSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGI  546
            CS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG+
Sbjct  62   CSAPR----LHWRSPESLRILARTSVPVVERFHRRIATTASEHPFKGV  105



>ref|XP_010482909.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Camelina 
sativa]
Length=997

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 34/58 (59%), Gaps = 2/58 (3%)
 Frame = +1

Query  382  SAFRSLRC--SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            SAFR  R   S  RWS   +W+ P S  AQ R AAP L  F RK A++ASE+ +K I 
Sbjct  42   SAFRLFRVCSSATRWSQHANWRLPESFRAQTRIAAPRLEKFQRKFASIASEHAYKDIL  99



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWKSPASL--TAQIRSAAPVLNDFHRKIATMASENPFKGI  546
            +FA++  + R S+PRWSH +  + P S   ++QIR+ +PVL+   R  ++MASE+PFKGI
Sbjct  50   SFATSSPTFR-SLPRWSHCLHSR-PYSFRFSSQIRAVSPVLDRLERNFSSMASEHPFKGI  107

Query  547  F  549
            F
Sbjct  108  F  108



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 5/60 (8%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            T + AFRSL    PRWSH +  + S   L++QIR+ +P L+   R  ++MASE+PFKGIF
Sbjct  52   TSSPAFRSL----PRWSHCLHSRPSLFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  107



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +1

Query  391  RSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATMASENPFKGIF  549
            RS   S+PR SH +  KS    L +QIR+ +PVL+   R  ++MASE+PFKGIF
Sbjct  40   RSFLTSLPRLSHCLHSKSFQIRLGSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  93



>emb|CDY56501.1| BnaAnng14360D [Brassica napus]
Length=973

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = +1

Query  373  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATMASE-NPFKGI  546
            T + AFRSL    PRWSH +  + S   L++ IR+A+PVL+   R  ++MASE +PFKGI
Sbjct  42   TSSPAFRSL----PRWSHCLHSRPSLFRLSSHIRTASPVLDRLERNFSSMASEHHPFKGI  97

Query  547  F  549
            F
Sbjct  98   F  98



>ref|XP_007132546.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
 gb|ESW04540.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
Length=846

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +1

Query  412  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            P+WSH +   SP +L   IR+ AP +  FHR+IA  A ENPFKG
Sbjct  50   PQWSHRLRRVSPLTLRRPIRAVAPPVERFHREIAATAKENPFKG  93



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  391  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATMASENPFKG  543
            RS   S+PR++    + S  SL   I +  P +  FHR IATM++ENPFKG
Sbjct  40   RSFFSSIPRFNRRFHYTSYRSLRPHISAVTPGIERFHRTIATMSNENPFKG  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720