BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF021O09

Length=501
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009596448.1|  PREDICTED: mitochondrial chaperone BCS1-like       147   1e-38   Nicotiana tomentosiformis
ref|XP_009794987.1|  PREDICTED: mitochondrial chaperone BCS1-like       146   5e-38   Nicotiana sylvestris
ref|XP_004230008.1|  PREDICTED: probable mitochondrial chaperone ...    145   9e-38   Solanum lycopersicum
ref|XP_006339806.1|  PREDICTED: mitochondrial chaperone BCS1-like       143   3e-37   
gb|EYU38871.1|  hypothetical protein MIMGU_mgv1a005433mg                134   5e-34   Erythranthe guttata [common monkey flower]
ref|XP_011094241.1|  PREDICTED: probable mitochondrial chaperone ...    134   1e-33   Sesamum indicum [beniseed]
ref|XP_006444778.1|  hypothetical protein CICLE_v10019936mg             132   2e-33   Citrus clementina [clementine]
ref|XP_010559141.1|  PREDICTED: probable mitochondrial chaperone ...    125   8e-31   Tarenaya hassleriana [spider flower]
ref|XP_011093096.1|  PREDICTED: probable mitochondrial chaperone ...    124   3e-30   Sesamum indicum [beniseed]
ref|XP_006397194.1|  hypothetical protein EUTSA_v10028615mg             121   3e-29   Eutrema salsugineum [saltwater cress]
ref|XP_010507993.1|  PREDICTED: 26S protease regulatory subunit 8...    121   3e-29   Camelina sativa [gold-of-pleasure]
emb|CDY57874.1|  BnaA09g55560D                                          122   5e-29   Brassica napus [oilseed rape]
ref|XP_010506675.1|  PREDICTED: probable mitochondrial chaperone ...    120   7e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010518339.1|  PREDICTED: probable mitochondrial chaperone ...    119   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009116854.1|  PREDICTED: probable mitochondrial chaperone ...    118   3e-28   Brassica rapa
emb|CDX80032.1|  BnaA05g01240D                                          120   4e-28   
ref|XP_002320886.1|  AAA-type ATPase family protein                     118   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_004306636.1|  PREDICTED: uncharacterized protein LOC101302781    118   5e-28   Fragaria vesca subsp. vesca
ref|XP_002882079.1|  hypothetical protein ARALYDRAFT_346472             117   5e-28   
ref|NP_182185.2|  P-loop containing nucleoside triphosphate hydro...    117   6e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011038785.1|  PREDICTED: probable mitochondrial chaperone ...    117   6e-28   Populus euphratica
ref|XP_010267472.1|  PREDICTED: mitochondrial chaperone BCS1-like       117   8e-28   Nelumbo nucifera [Indian lotus]
emb|CDY27312.1|  BnaC04g50930D                                          114   1e-27   Brassica napus [oilseed rape]
ref|XP_010544865.1|  PREDICTED: probable mitochondrial chaperone ...    116   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_006294099.1|  hypothetical protein CARUB_v10023091mg             116   2e-27   Capsella rubella
ref|XP_009142622.1|  PREDICTED: mitochondrial chaperone BCS1            116   2e-27   Brassica rapa
emb|CDX71701.1|  BnaC08g31730D                                          116   2e-27   
ref|XP_004133798.1|  PREDICTED: ATP-dependent zinc metalloproteas...    115   3e-27   Cucumis sativus [cucumbers]
ref|XP_004155177.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    115   3e-27   
ref|XP_010252452.1|  PREDICTED: probable mitochondrial chaperone ...    115   4e-27   Nelumbo nucifera [Indian lotus]
emb|CDY41542.1|  BnaC04g00800D                                          115   6e-27   Brassica napus [oilseed rape]
ref|XP_011023131.1|  PREDICTED: putative cell division cycle ATPase     115   6e-27   Populus euphratica
ref|XP_008437854.1|  PREDICTED: ATP-dependent zinc metalloproteas...    114   7e-27   Cucumis melo [Oriental melon]
ref|XP_009334380.1|  PREDICTED: 26S protease regulatory subunit 8...    114   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_009375440.1|  PREDICTED: mitochondrial chaperone BCS1-like       113   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_008362649.1|  PREDICTED: mitochondrial chaperone BCS1-like       113   3e-26   
ref|XP_010100693.1|  putative mitochondrial chaperone bcs1              112   8e-26   Morus notabilis
gb|KJB41595.1|  hypothetical protein B456_007G110900                    111   9e-26   Gossypium raimondii
gb|KFK37429.1|  hypothetical protein AALP_AA4G255900                    111   9e-26   Arabis alpina [alpine rockcress]
ref|XP_008233091.1|  PREDICTED: mitochondrial chaperone BCS1            111   1e-25   Prunus mume [ume]
ref|XP_004234999.1|  PREDICTED: mitochondrial chaperone BCS1-like       110   2e-25   Solanum lycopersicum
ref|XP_010322229.1|  PREDICTED: uncharacterized protein LOC101262523    110   3e-25   Solanum lycopersicum
gb|KJB09610.1|  hypothetical protein B456_001G152500                    110   3e-25   Gossypium raimondii
ref|XP_006367360.1|  PREDICTED: uncharacterized protein LOC102582634    110   4e-25   Solanum tuberosum [potatoes]
ref|XP_006350498.1|  PREDICTED: mitochondrial chaperone BCS1-like       109   6e-25   Solanum tuberosum [potatoes]
ref|XP_004510634.1|  PREDICTED: uncharacterized protein LOC101511087    108   9e-25   Cicer arietinum [garbanzo]
ref|XP_009761416.1|  PREDICTED: mitochondrial chaperone BCS1-like       108   1e-24   Nicotiana sylvestris
ref|XP_007217940.1|  hypothetical protein PRUPE_ppa005000mg             108   1e-24   Prunus persica
ref|XP_002533329.1|  ATP binding protein, putative                      108   1e-24   Ricinus communis
ref|XP_008376180.1|  PREDICTED: mitochondrial chaperone BCS1            108   2e-24   Malus domestica [apple tree]
gb|AAD20172.1|  hypothetical protein                                    107   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009588603.1|  PREDICTED: mitochondrial chaperone BCS1-like       107   3e-24   Nicotiana tomentosiformis
gb|AFP55581.1|  ATP binding protein                                     107   3e-24   Rosa rugosa [Japanese rose]
ref|XP_011075926.1|  PREDICTED: uncharacterized protein LOC105160305    107   3e-24   Sesamum indicum [beniseed]
emb|CBI38680.3|  unnamed protein product                                106   4e-24   Vitis vinifera
ref|XP_002515676.1|  ATP binding protein, putative                      107   4e-24   Ricinus communis
ref|XP_007051474.1|  P-loop containing nucleoside triphosphate hy...    107   4e-24   
ref|XP_002301424.2|  AAA-type ATPase family protein                     107   4e-24   
ref|XP_002262724.1|  PREDICTED: probable mitochondrial chaperone ...    106   7e-24   Vitis vinifera
gb|KJB24545.1|  hypothetical protein B456_004G150200                    106   9e-24   Gossypium raimondii
gb|KJB19872.1|  hypothetical protein B456_003G122600                    105   1e-23   Gossypium raimondii
ref|XP_011084544.1|  PREDICTED: mitochondrial chaperone BCS1-like       105   1e-23   Sesamum indicum [beniseed]
gb|KHN35399.1|  Putative mitochondrial chaperone bcs1                   104   2e-23   Glycine soja [wild soybean]
ref|XP_010662911.1|  PREDICTED: 26S protease regulatory subunit 6...    105   3e-23   Vitis vinifera
gb|EYU19673.1|  hypothetical protein MIMGU_mgv1a027053mg                104   3e-23   Erythranthe guttata [common monkey flower]
ref|XP_003553796.1|  PREDICTED: mitochondrial chaperone BCS1-like       104   3e-23   Glycine max [soybeans]
gb|EPS72484.1|  hypothetical protein M569_02272                         103   8e-23   Genlisea aurea
ref|XP_004307905.1|  PREDICTED: cell division control protein 48-...    103   1e-22   Fragaria vesca subsp. vesca
ref|XP_003520880.1|  PREDICTED: uncharacterized protein LOC100776680    102   2e-22   Glycine max [soybeans]
ref|XP_004502706.1|  PREDICTED: mitochondrial chaperone BCS1-like       102   2e-22   Cicer arietinum [garbanzo]
ref|XP_009775982.1|  PREDICTED: uncharacterized protein LOC104225813    101   8e-22   Nicotiana sylvestris
emb|CDY61723.1|  BnaA04g27130D                                        95.9    1e-21   Brassica napus [oilseed rape]
ref|XP_002321380.2|  hypothetical protein POPTR_0015s01020g             100   1e-21   
ref|XP_009599055.1|  PREDICTED: uncharacterized protein LOC104094765  99.8    3e-21   Nicotiana tomentosiformis
ref|XP_010109213.1|  putative mitochondrial chaperone bcs1            99.4    3e-21   Morus notabilis
ref|XP_011044701.1|  PREDICTED: uncharacterized protein LOC105139793  99.4    4e-21   Populus euphratica
gb|AET02010.2|  P-loop nucleoside triphosphate hydrolase superfam...  99.0    4e-21   Medicago truncatula
ref|XP_010693170.1|  PREDICTED: probable mitochondrial chaperone ...  98.6    5e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010035300.1|  PREDICTED: uncharacterized protein LOC104424536  98.6    7e-21   Eucalyptus grandis [rose gum]
ref|XP_011043686.1|  PREDICTED: ATP-dependent zinc metalloproteas...  98.6    7e-21   Populus euphratica
ref|XP_010933795.1|  PREDICTED: probable mitochondrial chaperone ...  98.6    8e-21   Elaeis guineensis
ref|XP_007135287.1|  hypothetical protein PHAVU_010G116600g           98.2    9e-21   Phaseolus vulgaris [French bean]
ref|XP_007221060.1|  hypothetical protein PRUPE_ppa016223mg           97.1    9e-21   
gb|AES72562.2|  P-loop nucleoside triphosphate hydrolase superfam...  98.2    1e-20   Medicago truncatula
ref|XP_002318453.2|  hypothetical protein POPTR_0012s02770g           98.2    1e-20   
ref|XP_010919325.1|  PREDICTED: uncharacterized protein LOC105043468  97.8    1e-20   Elaeis guineensis
ref|XP_010054126.1|  PREDICTED: probable mitochondrial chaperone ...  97.8    1e-20   Eucalyptus grandis [rose gum]
ref|XP_003602311.1|  Mitochondrial chaperone BCS1                     97.8    2e-20   
ref|XP_008790554.1|  PREDICTED: nuclear valosin-containing protei...  97.4    2e-20   Phoenix dactylifera
ref|XP_008234685.1|  PREDICTED: probable mitochondrial chaperone ...  96.7    3e-20   Prunus mume [ume]
ref|XP_008803962.1|  PREDICTED: uncharacterized protein LOC103717381  96.7    3e-20   
gb|KDP30317.1|  hypothetical protein JCGZ_18154                       96.7    3e-20   Jatropha curcas
ref|XP_008376774.1|  PREDICTED: probable mitochondrial chaperone ...  96.3    5e-20   Malus domestica [apple tree]
ref|XP_003529879.1|  PREDICTED: cell division cycle protein 48 ho...  95.5    7e-20   Glycine max [soybeans]
ref|XP_008381389.1|  PREDICTED: mitochondrial chaperone BCS1-like     95.5    8e-20   
ref|XP_007136478.1|  hypothetical protein PHAVU_009G048600g           95.1    1e-19   Phaseolus vulgaris [French bean]
gb|KHN23332.1|  Putative mitochondrial chaperone bcs1                 94.7    1e-19   Glycine soja [wild soybean]
ref|XP_007039156.1|  P-loop containing nucleoside triphosphate hy...  94.7    1e-19   
ref|XP_004145938.1|  PREDICTED: uncharacterized protein LOC101204309  94.7    2e-19   
gb|KGN49849.1|  hypothetical protein Csa_5G139270                     94.4    2e-19   Cucumis sativus [cucumbers]
ref|XP_003527995.2|  PREDICTED: mitochondrial chaperone BCS1-like     93.6    3e-19   Glycine max [soybeans]
ref|XP_009361315.1|  PREDICTED: probable mitochondrial chaperone ...  93.2    6e-19   Pyrus x bretschneideri [bai li]
ref|XP_009351948.1|  PREDICTED: probable mitochondrial chaperone ...  92.8    6e-19   Pyrus x bretschneideri [bai li]
ref|XP_009351947.1|  PREDICTED: probable mitochondrial chaperone ...  92.8    8e-19   Pyrus x bretschneideri [bai li]
ref|XP_006599768.1|  PREDICTED: uncharacterized protein LOC100792584  90.1    1e-18   Glycine max [soybeans]
ref|XP_003523343.1|  PREDICTED: mitochondrial chaperone BCS1-like...  92.0    1e-18   Glycine max [soybeans]
ref|XP_004160408.1|  PREDICTED: mitochondrial chaperone BCS1-like     91.7    2e-18   
ref|XP_007147339.1|  hypothetical protein PHAVU_006G115600g           90.5    5e-18   Phaseolus vulgaris [French bean]
ref|XP_003627534.1|  Cell division cycle protein-like protein         88.2    3e-17   
ref|XP_003626582.1|  Mitochondrial chaperone BCS1                     87.0    7e-17   Medicago truncatula
ref|XP_008437620.1|  PREDICTED: mitochondrial chaperone BCS1-like     85.9    2e-16   Cucumis melo [Oriental melon]
ref|XP_010671395.1|  PREDICTED: uncharacterized protein LOC104888200  83.2    2e-15   
ref|XP_008644692.1|  PREDICTED: ATP-dependent zinc metalloproteas...  80.9    1e-14   Zea mays [maize]
ref|XP_004982590.1|  PREDICTED: uncharacterized protein LOC101755261  80.5    2e-14   Setaria italica
ref|XP_008664748.1|  PREDICTED: transitional endoplasmic reticulu...  78.6    8e-14   Zea mays [maize]
dbj|BAJ87142.1|  predicted protein                                    78.2    1e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006491957.1|  PREDICTED: mitochondrial chaperone BCS1-like     77.4    2e-13   Citrus sinensis [apfelsine]
ref|XP_006441187.1|  hypothetical protein CICLE_v10023517mg           77.0    2e-13   Citrus clementina [clementine]
ref|XP_003574206.1|  PREDICTED: uncharacterized protein LOC100834121  77.0    2e-13   Brachypodium distachyon [annual false brome]
emb|CDP05017.1|  unnamed protein product                              76.3    3e-13   Coffea canephora [robusta coffee]
ref|XP_002464362.1|  hypothetical protein SORBIDRAFT_01g016970        75.1    1e-12   Sorghum bicolor [broomcorn]
gb|KDO59683.1|  hypothetical protein CISIN_1g044297mg                 73.6    3e-12   Citrus sinensis [apfelsine]
gb|EPS71797.1|  hypothetical protein M569_02959                       72.0    1e-11   Genlisea aurea
ref|XP_004986004.1|  PREDICTED: uncharacterized protein LOC101775542  72.0    1e-11   Setaria italica
gb|EEE51276.1|  hypothetical protein OsJ_32176                        70.9    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009382317.1|  PREDICTED: uncharacterized protein LOC103970312  70.9    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY79221.1|  hypothetical protein OsI_34338                        70.1    6e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001065078.2|  Os10g0519300                                     70.1    6e-11   
ref|XP_009411477.1|  PREDICTED: uncharacterized protein LOC103993224  69.7    8e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006649262.1|  PREDICTED: uncharacterized protein LOC102709999  68.6    2e-10   
gb|EAY88267.1|  hypothetical protein OsI_09720                        68.6    2e-10   Oryza sativa Indica Group [Indian rice]
ref|NP_001048744.1|  Os03g0114400                                     68.6    2e-10   
gb|EAZ25345.1|  hypothetical protein OsJ_09159                        68.6    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009391570.1|  PREDICTED: mitochondrial chaperone BCS1-like     65.1    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002465991.1|  hypothetical protein SORBIDRAFT_01g049680        64.3    5e-09   Sorghum bicolor [broomcorn]
gb|ABR16249.1|  unknown                                               64.3    6e-09   Picea sitchensis
ref|NP_001150338.1|  ATP binding protein                              63.9    7e-09   Zea mays [maize]
dbj|BAJ96830.1|  predicted protein                                    58.9    3e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP28443.1|  hypothetical protein JCGZ_14214                       57.8    7e-07   Jatropha curcas
ref|XP_006849190.1|  hypothetical protein AMTR_s00027p00211720        57.4    9e-07   
ref|XP_003562201.1|  PREDICTED: uncharacterized protein LOC100825790  56.2    2e-06   Brachypodium distachyon [annual false brome]
gb|EYU24583.1|  hypothetical protein MIMGU_mgv11b019013mg             47.4    6e-04   Erythranthe guttata [common monkey flower]



>ref|XP_009596448.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana tomentosiformis]
Length=492

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 85/101 (84%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R  LYR+AL+F LRKW++W+DD++HVHQ+ KV +LN+N Q+NQ YR+V +YVNSL S+ED
Sbjct  21   RFILYRTALIFVLRKWANWVDDRIHVHQYLKVAELNENGQDNQFYRRVSLYVNSLPSVED  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            S+FTNL   +  KS DIVL LDDNQV+QD+FLGAR+SW+NK
Sbjct  81   SNFTNLF--SGKKSTDIVLSLDDNQVIQDEFLGARISWVNK  119



>ref|XP_009794987.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana sylvestris]
Length=492

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 85/101 (84%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R  LYR+AL+F LRKW++W+DD++HVHQ+ KV +LN+N Q+NQ YR+V +YVNSL S+ED
Sbjct  21   RFILYRTALIFVLRKWANWVDDRIHVHQYLKVAELNENGQDNQFYRRVSLYVNSLPSVED  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            S+FTNL   +  KS DI+L LDDNQV++D+FLGAR+SW+NK
Sbjct  81   SNFTNLF--SGKKSTDIILSLDDNQVIEDEFLGARISWVNK  119



>ref|XP_004230008.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Solanum lycopersicum]
Length=491

 Score =   145 bits (366),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 84/101 (83%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R  LYR+AL+  LRKW++W+DD++HVHQ+ KV +LN+N Q+N+ YR+VF+Y+NSL S+ED
Sbjct  21   RFILYRTALILVLRKWANWMDDRIHVHQYLKVAELNENGQDNEFYRRVFLYINSLPSIED  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            S+FTNL   +  KS DI+L LDDNQV+QD+FLGARV W+NK
Sbjct  81   SNFTNLF--SGKKSTDIILSLDDNQVIQDEFLGARVDWVNK  119



>ref|XP_006339806.1| PREDICTED: mitochondrial chaperone BCS1-like [Solanum tuberosum]
Length=449

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 82/101 (81%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R  LYR+AL+  LRKW +W+DD++HVHQ+ KV +LN+N Q N+ YR+VF+Y+NSL S+ED
Sbjct  21   RFILYRTALILVLRKWMNWVDDRIHVHQYLKVAELNENGQNNEFYRRVFLYINSLPSIED  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            S+FTNL   +  KS DI+L LDDNQV+QD+FLGARV W+NK
Sbjct  81   SNFTNLF--SGKKSTDIILSLDDNQVIQDEFLGARVDWVNK  119



>gb|EYU38871.1| hypothetical protein MIMGU_mgv1a005433mg [Erythranthe guttata]
Length=484

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 97/124 (78%), Gaps = 3/124 (2%)
 Frame = +3

Query  132  VAMFIVNMvvvfafcvsvfaavRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQN  311
            + +F++N++++    V +   VRLFL+R+AL++ +RKW +W++D++HVHQ F+VP+LN +
Sbjct  1    MPLFVINLLLICFLIVCLMFIVRLFLHRTALIYVVRKWGEWVEDRVHVHQHFRVPELNDS  60

Query  312  AQENQL-YRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVS  488
             Q+  L YR+V +YVNSL+SLEDSDFTNL   +  K NDI+L LDDNQ +Q+ FLGAR+S
Sbjct  61   TQQQNLFYRRVSLYVNSLASLEDSDFTNLF--SGRKPNDILLSLDDNQSIQEVFLGARIS  118

Query  489  WMNK  500
            W+N+
Sbjct  119  WVNQ  122



>ref|XP_011094241.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Sesamum indicum]
Length=478

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 83/102 (81%), Gaps = 4/102 (4%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNA-QENQLYRKVFVYVNS-LSSL  371
            RLFL+R+AL+  +RKW+DW+DD+LHVHQ FK+P+ N +  QENQ YR+V +Y+NS L +L
Sbjct  21   RLFLHRTALIHVVRKWADWVDDRLHVHQHFKIPEFNDSTLQENQFYRRVSLYLNSLLPAL  80

Query  372  EDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            EDSDFTNL+  A  K NDI+L  DD+QV++D FLGAR+SW+N
Sbjct  81   EDSDFTNLL--AGKKPNDILLSPDDHQVIRDTFLGARLSWLN  120



>ref|XP_006444778.1| hypothetical protein CICLE_v10019936mg [Citrus clementina]
 ref|XP_006491333.1| PREDICTED: ATP-dependent zinc metalloprotease YME1 homolog [Citrus 
sinensis]
 gb|ESR58018.1| hypothetical protein CICLE_v10019936mg [Citrus clementina]
 gb|KDO86558.1| hypothetical protein CISIN_1g011664mg [Citrus sinensis]
Length=480

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+++ L+F  +KW  +I+D LHVHQFFKVP+ N+  QENQLYRKV+ Y+NSL+S+ED
Sbjct  19   RVLLFKTGLIFVAKKWWRFIEDCLHVHQFFKVPEFNEGMQENQLYRKVYAYLNSLTSIED  78

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SDFTNL      KSNDIVL LD NQ++QD FLGA +SW N+
Sbjct  79   SDFTNLFTGK--KSNDIVLGLDPNQLIQDNFLGAPLSWANQ  117



>ref|XP_010559141.1| PREDICTED: probable mitochondrial chaperone bcs1 [Tarenaya hassleriana]
Length=483

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L++S L+F ++KW   I D  HV+Q +KVP+ N++ QENQLYRKV+ Y+NS SS+ED
Sbjct  22   RIVLFKSGLIFMVKKWRRRIVDLFHVYQLYKVPEFNESMQENQLYRKVYAYLNSFSSIED  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SDFTNL      KSN+IVL LD NQ++ D+FLGARV W+N+
Sbjct  82   SDFTNLFTGK--KSNEIVLRLDRNQIIDDEFLGARVCWINR  120



>ref|XP_011093096.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Sesamum indicum]
Length=468

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = +3

Query  132  VAMFIVNMvvvfafcvsvfaavRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQN  311
            + MF+VN+ ++    +     VRLFL+R+AL++ +R+  +W++D++HVHQ F+VP+ N +
Sbjct  1    MPMFLVNLFLICLSIICFLFLVRLFLHRTALIYVVRRCVEWVEDRVHVHQHFRVPEFNDS  60

Query  312  A-QENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVS  488
              QEN  YR++ +Y+NSL SLEDSDFTNL   + +  NDI+L LDD+Q V D FLGAR+S
Sbjct  61   THQENLFYRRLSLYLNSLPSLEDSDFTNLF--SGINPNDILLSLDDHQQVHDIFLGARLS  118

Query  489  WMNK  500
            W+N+
Sbjct  119  WLNQ  122



>ref|XP_006397194.1| hypothetical protein EUTSA_v10028615mg [Eutrema salsugineum]
 gb|ESQ38647.1| hypothetical protein EUTSA_v10028615mg [Eutrema salsugineum]
Length=488

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+++ L++ ++KW   I D  HV+QF+KVP+ N+N QENQLY KV+ Y+NSLSS+E+
Sbjct  22   RIVLFKTGLIYMVKKWKRTIFDLFHVYQFYKVPEFNENVQENQLYGKVYAYLNSLSSIEN  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            SDFTNL      K N+I+L LD NQVV D+FLGARV W+N
Sbjct  82   SDFTNLFTGK--KPNEILLRLDRNQVVGDEFLGARVCWIN  119



>ref|XP_010507993.1| PREDICTED: 26S protease regulatory subunit 8 homolog [Camelina 
sativa]
Length=487

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 77/100 (77%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+++ L++ ++ W   + D  HV+QF+KVP+ N+N QENQLY KV+ Y+NSLSS+E+
Sbjct  22   RVVLFKTGLIYMVKLWRRKLIDTFHVYQFYKVPEFNENVQENQLYSKVYAYLNSLSSIEN  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            SDFTNL      K+N+I+L LD NQVV D+FLGARVSW+N
Sbjct  82   SDFTNLFTGK--KTNEIILRLDRNQVVSDEFLGARVSWIN  119



>emb|CDY57874.1| BnaA09g55560D [Brassica napus]
Length=708

 Score =   122 bits (307),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 54/100 (54%), Positives = 77/100 (77%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+++ L++ +++W   I D  HV+QF++VP+ N N QENQLYR+V  Y+NSLSS+E+
Sbjct  22   RVVLFKTGLIYTVKQWRMKIVDWFHVYQFYRVPEFNDNLQENQLYRRVHAYLNSLSSIEN  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            SD+TNL   A  KSN+I+L LD NQV+ D+FLGARV W+N
Sbjct  82   SDYTNLF--AGRKSNEIILRLDRNQVIGDEFLGARVCWIN  119



>ref|XP_010506675.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=486

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+++ L++ ++ W   + D  HV+QF+KVP+ N N QENQLYRKV+ Y+NSLSS+E+
Sbjct  22   RVVLFKTGLIYMVKLWRRKMIDTFHVYQFYKVPEFNDNVQENQLYRKVYAYLNSLSSIEN  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            SDFTNL      K+N+I+L LD  QVV D+FLGARVSW+N
Sbjct  82   SDFTNLFTGK--KTNEIILRLDRKQVVGDEFLGARVSWIN  119



>ref|XP_010518339.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=483

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+++ L++ ++ W   + D  HV+QF+KVP+ N N QENQLY KV+ Y+NSLSS+E+
Sbjct  22   RVVLFKTGLIYMVKLWRRKMIDTFHVYQFYKVPEFNDNVQENQLYLKVYAYLNSLSSIEN  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            SDFTNL      K+N+I+L LD NQVV D+FLGARVSW+N
Sbjct  82   SDFTNLFTGK--KTNEIILRLDRNQVVGDEFLGARVSWIN  119



>ref|XP_009116854.1| PREDICTED: probable mitochondrial chaperone bcs1 [Brassica rapa]
Length=483

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 77/100 (77%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+++ L++ +++W   I D  HV+QF++VP+ N N QENQLYR+V  Y+NSLSS+E+
Sbjct  22   RVVLFKTGLIYTVKQWRMKIVDWFHVYQFYRVPEFNDNLQENQLYRRVHAYLNSLSSIEN  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            SD+TNL   A  KSN+I+L LD NQV+ D+FLGARV W+N
Sbjct  82   SDYTNLF--AGRKSNEIILRLDRNQVIGDEFLGARVCWIN  119



>emb|CDX80032.1| BnaA05g01240D [Brassica napus]
Length=715

 Score =   120 bits (301),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 58/100 (58%), Positives = 73/100 (73%), Gaps = 3/100 (3%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+++ L+  ++KW   I D  HV+Q +KVP+ N+  QEN LYRKV+ Y+NSLSS+ED
Sbjct  18   RIVLFKTGLIHMVKKWRRTIVDLFHVYQHYKVPEFNE-VQENHLYRKVYTYLNSLSSIED  76

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            SDFTNL      KSNDIVL LD NQVV D+FLGARV W N
Sbjct  77   SDFTNLFTGK--KSNDIVLRLDRNQVVGDEFLGARVCWTN  114



>ref|XP_002320886.1| AAA-type ATPase family protein [Populus trichocarpa]
 gb|EEE99201.1| AAA-type ATPase family protein [Populus trichocarpa]
Length=488

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = +3

Query  213  RSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTN  392
            ++ L++  +KW   I+D  HV+QFFKVP+ N++ QENQLY KV +Y++SL+S+EDSD+TN
Sbjct  27   KTGLIYITKKWWRSIEDCFHVYQFFKVPEFNESMQENQLYHKVSIYLSSLASMEDSDYTN  86

Query  393  LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            L   A  KSNDI+L LD NQV+ D FLGARVSW+N
Sbjct  87   LF--AGKKSNDIILHLDPNQVIDDYFLGARVSWIN  119



>ref|XP_004306636.1| PREDICTED: uncharacterized protein LOC101302781 [Fragaria vesca 
subsp. vesca]
Length=491

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 76/101 (75%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ LY++ LVF ++KW   ++D  HV+Q+FKVP+ N++ QENQLY KV  Y+NSL+S+ED
Sbjct  21   RVLLYKTGLVFIVKKWWRAVEDCFHVYQYFKVPEFNESMQENQLYCKVTHYLNSLTSIED  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SDFTNLV     K N+IVL LD NQ ++D FLGA+V W ++
Sbjct  81   SDFTNLVTGK--KPNEIVLQLDPNQTIEDDFLGAKVMWRSE  119



>ref|XP_002882079.1| hypothetical protein ARALYDRAFT_346472 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58338.1| hypothetical protein ARALYDRAFT_346472 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+++ L++ ++ W   I D  HV+QF+KVP+ N N QEN LY+KV+ Y+NSLSS+E+
Sbjct  22   RIVLFKTGLIYMVKLWRRKIIDWFHVYQFYKVPEFNDNVQENHLYQKVYSYLNSLSSIEN  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            SDFTNL      KSN+I+L LD NQVV D+FLGARV W+N
Sbjct  82   SDFTNLFTGK--KSNEIILRLDRNQVVGDEFLGARVCWIN  119



>ref|NP_182185.2| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 gb|AEC10730.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=491

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+++ L++ ++ W   I D  HV+QF+KVP+ N N QEN LY+KV++Y+NSLSS+E+
Sbjct  22   RILLFKTGLIYMVKLWRRKIIDWFHVYQFYKVPEFNDNVQENHLYQKVYMYLNSLSSIEN  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            SDFTNL      KSN+I+L LD NQVV D+FLGARV W+N
Sbjct  82   SDFTNLF--TGKKSNEIILRLDRNQVVGDEFLGARVCWIN  119



>ref|XP_011038785.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Populus euphratica]
Length=488

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +3

Query  210  YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFT  389
            +++ L++  +KW   I+D  HV+QFFKVP+ N++ QENQLY KV +Y++SL+S+EDSD+T
Sbjct  26   FKTGLIYITKKWWRSIEDCFHVYQFFKVPEFNESMQENQLYHKVSIYLSSLASMEDSDYT  85

Query  390  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            NL   +  KSNDI+L LD NQV+ D FLGARVSW+N
Sbjct  86   NLF--SGKKSNDIILHLDPNQVIDDYFLGARVSWIN  119



>ref|XP_010267472.1| PREDICTED: mitochondrial chaperone BCS1-like [Nelumbo nucifera]
Length=485

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 75/101 (74%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            RL L  +AL+F L+K    I+D+ HV+QF+KVP+ NQ+ QENQLYRKV  Y++SL+S+ED
Sbjct  21   RLVLSGTALLFLLKKLCQSIEDRCHVYQFYKVPEFNQSYQENQLYRKVSTYLSSLASIED  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            S F NL   +  KSN+I L LD NQ VQD FLGARVSW ++
Sbjct  81   SHFANLF--SGKKSNEIALQLDSNQTVQDIFLGARVSWRSE  119



>emb|CDY27312.1| BnaC04g50930D [Brassica napus]
Length=245

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 73/101 (72%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+++ L++ ++KW   + D  HV Q +KVP+ N N QEN LY KV+ Y+NSLSS+ED
Sbjct  23   RIVLFKTGLIYMVKKWWRTVVDVFHVCQSYKVPEFNDNLQENHLYMKVYSYLNSLSSIED  82

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SDFTNL      KSN+I+L LD NQ+V D+FLGARV W NK
Sbjct  83   SDFTNLFTEK--KSNEIILHLDRNQIVGDEFLGARVCWYNK  121



>ref|XP_010544865.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Tarenaya 
hassleriana]
Length=486

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +3

Query  210  YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFT  389
            +++ L+F ++KW   I D  HV QF+KVP+ N+N QENQ YRKV  Y+NSL S+EDSDFT
Sbjct  26   FKTGLIFMVKKWRRRIVDLFHVSQFYKVPEFNENMQENQFYRKVCAYLNSLVSMEDSDFT  85

Query  390  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            NL      KSN+IVL  D NQ++ D+FLGARV W+N
Sbjct  86   NLFTGK--KSNEIVLRFDRNQIIDDEFLGARVCWIN  119



>ref|XP_006294099.1| hypothetical protein CARUB_v10023091mg [Capsella rubella]
 gb|EOA26997.1| hypothetical protein CARUB_v10023091mg [Capsella rubella]
Length=489

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+++  ++ ++ W   + D  HV+QF+KVP+ N N QEN LYRKV+ Y+NSLSS+E+
Sbjct  22   RIALFKTGFIYMVKLWRRNLIDMFHVYQFYKVPEFNDNLQENHLYRKVYAYLNSLSSIEN  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            SDFTNL      KSN+I+L LD NQVV D+FLGARV W+N
Sbjct  82   SDFTNLFTGK--KSNEIILRLDRNQVVGDEFLGARVCWIN  119



>ref|XP_009142622.1| PREDICTED: mitochondrial chaperone BCS1 [Brassica rapa]
Length=468

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 73/100 (73%), Gaps = 3/100 (3%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+++ L+  ++KW   I D  HV+Q +KVP+ N+  QEN LYRKV+ Y+NSLSS+ED
Sbjct  18   RIVLFKTGLIHMVKKWRRTIVDLFHVYQHYKVPEFNE-VQENHLYRKVYTYLNSLSSIED  76

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            SDFTNL      KSN+IVL LD NQVV D+FLGARV W N
Sbjct  77   SDFTNLFTGK--KSNEIVLRLDRNQVVGDEFLGARVCWTN  114



>emb|CDX71701.1| BnaC08g31730D [Brassica napus]
Length=483

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = +3

Query  213  RSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTN  392
            ++ L++ +++W   I D  HV+QF++VP+ N N QENQLYR+V+ Y+NSLSS+E+SD+TN
Sbjct  27   KTGLIYTVKQWRRKIFDWFHVYQFYRVPEFNDNLQENQLYRRVYAYLNSLSSIENSDYTN  86

Query  393  LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            L   A  KSN+I+L LD NQV+ D+FLGARV W+N
Sbjct  87   LF--AGRKSNEIILRLDRNQVIGDEFLGARVCWIN  119



>ref|XP_004133798.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like [Cucumis 
sativus]
 gb|KGN56399.1| hypothetical protein Csa_3G119330 [Cucumis sativus]
Length=481

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 73/101 (72%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+R+ L+F ++KW   ++D  HV+Q F++P+ N+ +Q N LYRKV  Y+ SLSSLED
Sbjct  22   RILLFRTGLIFLVKKWWANLEDCFHVYQSFRIPEFNETSQHNHLYRKVSAYLTSLSSLED  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SDFTNL+     K NDI+L LD NQ VQD FLGA+V W N+
Sbjct  82   SDFTNLI--TGNKPNDIILRLDSNQTVQDNFLGAKVFWTNE  120



>ref|XP_004155177.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FtsH-like [Cucumis sativus]
Length=481

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 73/101 (72%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+R+ L+F ++KW   ++D  HV+Q F++P+ N+ +Q N LYRKV  Y+ SLSSLED
Sbjct  22   RILLFRTGLIFLVKKWWANLEDCFHVYQSFRIPEFNETSQHNHLYRKVSAYLTSLSSLED  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SDFTNL+     K NDI+L LD NQ VQD FLGA+V W N+
Sbjct  82   SDFTNLI--TGNKPNDIILRLDSNQTVQDXFLGAKVFWTNE  120



>ref|XP_010252452.1| PREDICTED: probable mitochondrial chaperone bcs1 [Nelumbo nucifera]
Length=486

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 74/101 (73%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L  +AL F  +KW   IDD  HV+QF+K+P+ N+N QENQLYRKV  YV+SL+S+ED
Sbjct  21   RIILSGTALWFLFKKWCRTIDDWCHVYQFYKIPEFNRNFQENQLYRKVSTYVSSLASIED  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SD+ NL   +  K N+I L LD NQ+V D FLGARVSWM++
Sbjct  81   SDYANLF--SGKKLNEITLELDTNQLVYDTFLGARVSWMSE  119



>emb|CDY41542.1| BnaC04g00800D [Brassica napus]
Length=470

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+++ L+  ++KW   I D  HV+Q +KVP+ N   QEN LYRKV+ Y+NSLSS+ED
Sbjct  18   RIVLFKTGLIHMVKKWRRKIVDLFHVYQHYKVPEFN-GIQENHLYRKVYTYLNSLSSIED  76

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            SDFTNL      KSN+IVL LD NQVV D+FLGARV W N
Sbjct  77   SDFTNLFTGK--KSNEIVLRLDRNQVVGDEFLGARVCWTN  114



>ref|XP_011023131.1| PREDICTED: putative cell division cycle ATPase [Populus euphratica]
Length=488

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +3

Query  210  YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFT  389
            +++ L++  +KW   I+D  HV+QFFKVP+ N+N Q+N LYRKV +Y++S++S+EDSDFT
Sbjct  26   FKTGLIYITKKWWRSIEDCFHVYQFFKVPEFNENMQKNHLYRKVSIYLSSIASIEDSDFT  85

Query  390  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            NL      K +DIVL LD NQV+ D FLGARVSW+N+
Sbjct  86   NLF--TGKKPHDIVLHLDPNQVIDDYFLGARVSWINQ  120



>ref|XP_008437854.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, chloroplastic 
[Cucumis melo]
Length=481

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 73/101 (72%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L+R+ L+F ++KW   ++D  HV+Q F++P+ N+ +Q N LYRKV  Y+ SLSSLED
Sbjct  22   RILLFRTGLIFIVKKWWANLEDCFHVYQSFRIPEFNETSQHNHLYRKVSAYLTSLSSLED  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SD+TNL+     K NDI+L LD NQ VQD FLGA+V W N+
Sbjct  82   SDYTNLI--TGNKPNDIILRLDSNQTVQDNFLGAKVFWTNE  120



>ref|XP_009334380.1| PREDICTED: 26S protease regulatory subunit 8 homolog [Pyrus x 
bretschneideri]
Length=482

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ LYR+ LV+ ++KW  W +D  HV+Q FKVP+ N++ QENQLY +V  Y+NSL+S+E+
Sbjct  21   RVALYRTGLVYIVKKWWWWFEDCFHVYQSFKVPKFNESMQENQLYGRVTDYLNSLTSIEE  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            SDFTNLV     K N+IVL LD NQ ++D FLGA+V W
Sbjct  81   SDFTNLVTGK--KPNEIVLQLDPNQTIEDDFLGAKVIW  116



>ref|XP_009375440.1| PREDICTED: mitochondrial chaperone BCS1-like [Pyrus x bretschneideri]
Length=481

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ LYR+ LV+ ++KW    +D  HV+Q FKVP+ N++ QENQLY +V  Y+NSL+S+ED
Sbjct  21   RVALYRTGLVYIVKKWWRRFEDCFHVYQSFKVPEYNESMQENQLYGRVTDYLNSLTSVED  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            SDFTNLV     K N+IVL LD NQ+++D FLGA+V W
Sbjct  81   SDFTNLVTGK--KPNEIVLQLDPNQIIEDNFLGAKVIW  116



>ref|XP_008362649.1| PREDICTED: mitochondrial chaperone BCS1-like [Malus domestica]
Length=480

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ LYR+ LV+ ++KW    +D  HV+Q FKVP+ N++ QENQLY +V  Y+NSL+S+ED
Sbjct  21   RVALYRTGLVYIVKKWWRRFEDCFHVYQSFKVPEYNESMQENQLYGRVTDYLNSLTSVED  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            SDFTNLV     K N+IVL LD NQ+++D FLGA+V W
Sbjct  81   SDFTNLVTGK--KPNEIVLQLDPNQIIEDNFLGAKVIW  116



>ref|XP_010100693.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
 gb|EXB83855.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
Length=485

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 74/101 (73%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ LYR+ LV+ ++KW    +D  HV+Q FKVP+ N   QENQLYR+V  Y+NSL S+ED
Sbjct  22   RILLYRTGLVYIVKKWWRAFEDCFHVYQTFKVPEFNDAMQENQLYRRVGDYLNSLQSVED  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SDFTNLV  A+ +  +IVL LD NQ ++D FLGA++ W+N+
Sbjct  82   SDFTNLV--ASKRPGEIVLKLDRNQRIEDFFLGAKLVWLNE  120



>gb|KJB41595.1| hypothetical protein B456_007G110900 [Gossypium raimondii]
Length=481

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 74/101 (73%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L ++ L++ ++K    I+D  HV+QFFKVP+ N+  Q NQLY KV VY+NSL+ +ED
Sbjct  25   RVVLIKTGLIYIVKKKWRSIEDCFHVYQFFKVPEFNEGMQRNQLYHKVLVYLNSLTFIED  84

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SDFTNL      K N+IVL LD NQ+++D FLGA++SW+N+
Sbjct  85   SDFTNLFTGK--KPNEIVLHLDPNQIIEDDFLGAKISWINE  123



>gb|KFK37429.1| hypothetical protein AALP_AA4G255900 [Arabis alpina]
Length=451

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 67/88 (76%), Gaps = 2/88 (2%)
 Frame = +3

Query  234  LRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAV  413
            ++KW   I D  HV+QF+KVP+ N+N QEN LY KV+ Y+NSLSS+E+SDFTNL      
Sbjct  2    VKKWRRTISDFCHVYQFYKVPEFNENLQENHLYSKVYSYLNSLSSIENSDFTNLF--TGK  59

Query  414  KSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            KSN+I+L LD NQ++ D+FLGARV W+N
Sbjct  60   KSNEIILRLDRNQIISDEFLGARVCWIN  87



>ref|XP_008233091.1| PREDICTED: mitochondrial chaperone BCS1 [Prunus mume]
Length=482

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ LY++ LVF ++KW    +D  HV+Q FKVP+LN++ QEN LY KV  Y+NSL+S+E+
Sbjct  21   RVALYKTGLVFLVKKWWRRFEDCFHVYQSFKVPELNESMQENHLYGKVTDYLNSLTSIEE  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            SDFTNLV     K N+IVL LD NQ ++D FLGA+V W
Sbjct  81   SDFTNLVTGK--KPNEIVLKLDRNQTIEDDFLGAKVLW  116



>ref|XP_004234999.1| PREDICTED: mitochondrial chaperone BCS1-like [Solanum lycopersicum]
Length=474

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +3

Query  207  LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  386
            L +++++  ++KW  +++D  +V+QF++VPQ N N QENQLYRKV  Y+NSL  +EDSDF
Sbjct  18   LLKTSVLQIVKKWWRFLEDGCYVYQFYRVPQFNHNMQENQLYRKVSTYLNSLPCVEDSDF  77

Query  387  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            TNL+  +  KSN+I L LD NQ+V D+FLGARV W+NK
Sbjct  78   TNLI--SGDKSNEISLVLDANQMVVDKFLGARVFWINK  113



>ref|XP_010322229.1| PREDICTED: uncharacterized protein LOC101262523 [Solanum lycopersicum]
Length=512

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            F+ +++++   +KW   ++DK +V+QF+KVPQ N N QENQLYRK+  Y+NSL  +EDSD
Sbjct  17   FVSKTSILHIFKKWLRLLEDKFYVYQFYKVPQFNHNMQENQLYRKISTYLNSLPCVEDSD  76

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            FTNL + +  KSNDI L L+ +Q + D FLGAR+SW+N+
Sbjct  77   FTNLYSGS--KSNDINLVLNADQKIVDNFLGARISWINE  113



>gb|KJB09610.1| hypothetical protein B456_001G152500 [Gossypium raimondii]
Length=453

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 74/101 (73%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L ++ L+F ++K     +D  HV+Q FKVP+ N++ Q NQLY KVFVY+NSL+S+ED
Sbjct  22   RVVLIKTGLIFTVKKKWRLFEDCFHVYQLFKVPKFNESMQRNQLYHKVFVYLNSLTSVED  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SDFTNL      K N+I+L LD NQ+++D FLGA++ W+N+
Sbjct  82   SDFTNLFTGK--KPNEILLRLDPNQIIEDDFLGAKILWINE  120



>ref|XP_006367360.1| PREDICTED: uncharacterized protein LOC102582634 [Solanum tuberosum]
Length=509

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            F+ +++++  L+KW   ++DK +V+QF+KVPQ N N QENQLYRK+  Y+NSL  +EDSD
Sbjct  17   FVSKTSILHILKKWLRLLEDKFYVYQFYKVPQFNHNMQENQLYRKISTYLNSLPCVEDSD  76

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            FTNL + +  KSN+I L L+ +Q + D FLGAR+SW+N+
Sbjct  77   FTNLFSGS--KSNEINLVLNADQKIVDNFLGARISWINE  113



>ref|XP_006350498.1| PREDICTED: mitochondrial chaperone BCS1-like [Solanum tuberosum]
Length=476

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +3

Query  207  LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  386
            L +++L+  ++KW  +++D  +V+QF++VPQ N N QENQLYRKV  Y+NSL  +EDSDF
Sbjct  18   LLKTSLLQIVKKWWRFLEDGCYVYQFYRVPQFNHNMQENQLYRKVCTYLNSLPCVEDSDF  77

Query  387  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            TNL+  +  KSN+I L LD NQ+V D+FL ARV W+N+
Sbjct  78   TNLI--SGDKSNEISLVLDSNQIVVDKFLSARVFWINE  113



>ref|XP_004510634.1| PREDICTED: uncharacterized protein LOC101511087 [Cicer arietinum]
Length=483

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 72/101 (71%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R  L+++ L++A +K    + D  HV+Q+ KVP+ N+N Q N+LYRKV +Y++SL SLED
Sbjct  21   RWLLFKTGLIYATKKLQRKLQDCFHVYQYLKVPEFNENMQRNELYRKVSLYLHSLPSLED  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SDFTNL+       NDIVL +D NQ+++D+FLGA + W NK
Sbjct  81   SDFTNLITGH--NQNDIVLSIDSNQLIEDRFLGATLFWSNK  119



>ref|XP_009761416.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana sylvestris]
Length=476

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            F+ +++LV  L+KW    +D  +V+QF++VPQ N N QENQLYRKV  Y+NSL  +EDSD
Sbjct  17   FVLKTSLVQILKKWWRLFEDGCYVYQFYRVPQFNHNMQENQLYRKVCTYLNSLPCVEDSD  76

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            FTNL   +  KSN+I L LD NQ+V D FL ARV W+N+
Sbjct  77   FTNLF--SGDKSNEINLVLDSNQIVVDNFLCARVCWINE  113



>ref|XP_007217940.1| hypothetical protein PRUPE_ppa005000mg [Prunus persica]
 gb|EMJ19139.1| hypothetical protein PRUPE_ppa005000mg [Prunus persica]
Length=482

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%), Gaps = 2/98 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ LY++ LVF ++KW    +D  HV+Q FKVP+ N++ QEN LY +V  Y+NSL+S+E+
Sbjct  21   RVALYKTGLVFLVKKWWRRFEDCFHVYQSFKVPEFNESMQENHLYGRVTDYLNSLTSIEE  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            SDFTNLV     K N+IVL LD NQ ++D FLGA+V W
Sbjct  81   SDFTNLVTGK--KPNEIVLKLDRNQTIEDDFLGAKVLW  116



>ref|XP_002533329.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF29050.1| ATP binding protein, putative [Ricinus communis]
Length=480

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +3

Query  213  RSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTN  392
            ++ L+F  +K     ++  HV+QFFKVP+ N++ Q+NQL+RKV VY+NSLSS+EDSDFTN
Sbjct  27   KTGLIFLTKKLWRICEEWFHVYQFFKVPEFNESMQDNQLHRKVSVYLNSLSSIEDSDFTN  86

Query  393  LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            L      KSN+I+L LD NQV+ D FLG R+SW+N+
Sbjct  87   LF--TGKKSNEIILRLDPNQVIDDYFLGTRISWINE  120



>ref|XP_008376180.1| PREDICTED: mitochondrial chaperone BCS1 [Malus domestica]
Length=482

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 72/101 (71%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ LYR+ LV+ ++KW    +D  HV+Q FKVP+ N++ QENQLY +V  Y+NSL+S+E+
Sbjct  21   RVALYRTGLVYIVKKWWLRFEDCFHVYQSFKVPKFNESMQENQLYGRVTDYLNSLTSIEE  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SDFTNLV       N+IVL LD NQ ++D FLGA+V W  +
Sbjct  81   SDFTNLVTGK--NPNEIVLQLDPNQTIEDDFLGAKVIWQTE  119



>gb|AAD20172.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL77654.1| At2g46620/F13A10.15 [Arabidopsis thaliana]
 gb|AAN28905.1| At2g46620/F13A10.15 [Arabidopsis thaliana]
Length=459

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 66/87 (76%), Gaps = 6/87 (7%)
 Frame = +3

Query  237  RKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVK  416
            RK  DW     HV+QF+KVP+ N N QEN LY+KV++Y+NSLSS+E+SDFTNL      K
Sbjct  7    RKIIDW----FHVYQFYKVPEFNDNVQENHLYQKVYMYLNSLSSIENSDFTNLF--TGKK  60

Query  417  SNDIVLCLDDNQVVQDQFLGARVSWMN  497
            SN+I+L LD NQVV D+FLGARV W+N
Sbjct  61   SNEIILRLDRNQVVGDEFLGARVCWIN  87



>ref|XP_009588603.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana tomentosiformis]
Length=476

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 2/96 (2%)
 Frame = +3

Query  213  RSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTN  392
            +++LV  ++KW    +D  +V+QF++VPQ N N QENQLY+KV  Y+NSL   EDSDFTN
Sbjct  20   KTSLVQIMKKWWQLFEDGCYVYQFYRVPQFNHNMQENQLYKKVCTYLNSLPCAEDSDFTN  79

Query  393  LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            L   +  KSN+I L LD NQ+V D FLGARV W+N+
Sbjct  80   LF--SGDKSNEINLVLDSNQIVVDNFLGARVCWINE  113



>gb|AFP55581.1| ATP binding protein [Rosa rugosa]
Length=490

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 71/100 (71%), Gaps = 4/100 (4%)
 Frame = +3

Query  204  FLYRSALV-FALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDS  380
            FL R++L+   ++ W   ID K HV+QF+KVPQ N N QENQLYRK+ VY+NSL ++EDS
Sbjct  23   FLSRTSLLHMVVKSWQSLID-KFHVYQFYKVPQFNHNYQENQLYRKISVYLNSLPNIEDS  81

Query  381  DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            DFTNL + +  KSNDI    D+N  V D FL A+VSW N+
Sbjct  82   DFTNLFSGS--KSNDIFFQHDNNHSVHDTFLSAKVSWTNE  119



>ref|XP_011075926.1| PREDICTED: uncharacterized protein LOC105160305 [Sesamum indicum]
Length=489

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 84/118 (71%), Gaps = 3/118 (3%)
 Frame = +3

Query  138  MFIVNMvvvfafcvsvfaavRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQ  317
            MF+VN+ ++F   + + A +R FL  ++L+ +L+     ++ K +VHQF+KVP+ N N Q
Sbjct  1    MFLVNLTLLFVTIILLCAVLR-FLSNTSLIHSLKNTCRSLEQKCYVHQFYKVPKFNDNMQ  59

Query  318  ENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            ENQLYRKV+ Y+NSL  +EDSDF NL +S+  KS +I L LD+NQ + D+FLGAR+ W
Sbjct  60   ENQLYRKVYTYLNSLPCVEDSDFANLFSSS--KSAEINLILDENQTIVDKFLGARLRW  115



>emb|CBI38680.3| unnamed protein product [Vitis vinifera]
Length=387

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 3/89 (3%)
 Frame = +3

Query  231  ALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAA  410
            AL+KWS  + D    +Q FKVP+ N+N Q+N LYRKV VY+NSL +LEDSDFTNL   + 
Sbjct  35   ALKKWSR-VGDWFQAYQLFKVPEFNENMQDNYLYRKVSVYINSLVALEDSDFTNLF--SG  91

Query  411  VKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
             K+N+IVL LD NQ V D FLGARVSW N
Sbjct  92   KKANEIVLALDPNQTVHDTFLGARVSWTN  120



>ref|XP_002515676.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46728.1| ATP binding protein, putative [Ricinus communis]
Length=487

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            FL+R++ +  L  +    +D  HV+QF+KVPQ N++ Q NQL+RKVF Y++SL ++EDSD
Sbjct  22   FLFRTSFLQILVGYWRSFEDHFHVYQFYKVPQFNEHFQGNQLFRKVFTYLSSLPAMEDSD  81

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            FTNL   +  KSNDI+L LD+ QV+QD+FL ARV W N+
Sbjct  82   FTNLF--SGPKSNDIILHLDEKQVIQDKFLSARVWWSNE  118



>ref|XP_007051474.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOX95631.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=479

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 74/101 (73%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L ++ L++ ++K   +I D  HV+QFFKV + N++ Q NQLY KV VY+NSL+S+ED
Sbjct  22   RVVLIKTGLIYIVKKKWCFIQDCFHVYQFFKVSEFNESMQRNQLYHKVLVYLNSLTSIED  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SDFTNL      K N+IVL LD NQV++D FLGA++ W+N+
Sbjct  82   SDFTNLFTGK--KPNEIVLRLDRNQVIEDDFLGAKIFWINE  120



>ref|XP_002301424.2| AAA-type ATPase family protein [Populus trichocarpa]
 gb|EEE80697.2| AAA-type ATPase family protein [Populus trichocarpa]
Length=488

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +3

Query  210  YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFT  389
            +++ L++  +KW   I+D  HV+QFFKVP+ N+N Q+N LY +V +Y++S++S+EDSDF 
Sbjct  26   FKTGLIYITKKWWRSIEDCFHVYQFFKVPEFNENMQKNHLYCEVSIYLSSIASIEDSDFI  85

Query  390  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            NL      K +DIVL LD NQV+ D FLGARVSW+N+
Sbjct  86   NLF--TGKKPHDIVLHLDPNQVIDDYFLGARVSWINE  120



>ref|XP_002262724.1| PREDICTED: probable mitochondrial chaperone bcs1 [Vitis vinifera]
Length=462

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 3/89 (3%)
 Frame = +3

Query  231  ALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAA  410
            AL+KWS  + D    +Q FKVP+ N+N Q+N LYRKV VY+NSL +LEDSDFTNL   + 
Sbjct  20   ALKKWSR-VGDWFQAYQLFKVPEFNENMQDNYLYRKVSVYINSLVALEDSDFTNLF--SG  76

Query  411  VKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
             K+N+IVL LD NQ V D FLGARVSW N
Sbjct  77   KKANEIVLALDPNQTVHDTFLGARVSWTN  105



>gb|KJB24545.1| hypothetical protein B456_004G150200 [Gossypium raimondii]
Length=467

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 74/102 (73%), Gaps = 4/102 (4%)
 Frame = +3

Query  198  RLFLYRSALVFAL-RKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLE  374
            R+ L ++  +F   RKW   I D  HV+QFFKVP+ +++ Q NQLY KV +Y++SL+SLE
Sbjct  22   RVILIKTGFIFTFKRKWR-CIKDCFHVYQFFKVPEFSESMQRNQLYYKVLLYLHSLASLE  80

Query  375  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            DSDFTNL   A  K N+I+L LD NQ+++D FLGA++ W+N+
Sbjct  81   DSDFTNLF--AGRKPNEILLRLDTNQIIEDDFLGAKMYWINQ  120



>gb|KJB19872.1| hypothetical protein B456_003G122600 [Gossypium raimondii]
Length=473

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            FL++++L+  L +    ++D LHVHQ ++VPQ N   QENQLY KV  Y+NSL SLEDSD
Sbjct  21   FLFKTSLLLILLQKFQCLEDWLHVHQLYRVPQFNHLFQENQLYVKVSTYLNSLPSLEDSD  80

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            FTNL   +  KSNDI+L LD +Q ++D FLGARVSW
Sbjct  81   FTNLFTGS--KSNDILLHLDTDQTIRDVFLGARVSW  114



>ref|XP_011084544.1| PREDICTED: mitochondrial chaperone BCS1-like [Sesamum indicum]
Length=486

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            FL +++L+ +L++   +++ K +V+QF++VP+ N+N QENQLYRKV+ Y+NSL  +EDS+
Sbjct  22   FLAKTSLIHSLKRGWQFLEGKSYVYQFYRVPKFNENMQENQLYRKVYTYLNSLPCVEDSE  81

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            F NL + +  KS +I L LD+NQ + D FLGARV W
Sbjct  82   FANLFSGS--KSTEINLILDENQTIADHFLGARVCW  115



>gb|KHN35399.1| Putative mitochondrial chaperone bcs1 [Glycine soja]
Length=388

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 5/103 (5%)
 Frame = +3

Query  201  LFLYRSALVF-ALRKWSDWI--DDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSL  371
            LF++ S LV  A+R    WI  +D  HV+QFFKVP+LN+  Q N LYRKV +Y++SL S+
Sbjct  3    LFIFLSTLVLIAVRAKKLWIAIEDWFHVYQFFKVPELNETTQHNHLYRKVSLYLHSLPSI  62

Query  372  EDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            EDS F NL+     K NDIVLCL  NQ +QD FLGA + W N+
Sbjct  63   EDSVFANLITGK--KQNDIVLCLGPNQTIQDHFLGATLFWFNQ  103



>ref|XP_010662911.1| PREDICTED: 26S protease regulatory subunit 6B-like [Vitis vinifera]
Length=475

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
             L +++++  +RKW   + D  +V Q ++VPQ NQ  QEN+LYRK+  Y+NSL+S+EDSD
Sbjct  22   LLLKTSVILIVRKWVRSLGDMCYVWQCYRVPQYNQLLQENELYRKLSAYINSLASVEDSD  81

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            F NLV  +  +SND+VL LD NQ V D +LGARV+W N
Sbjct  82   FANLVTGS--RSNDVVLSLDPNQTVFDSYLGARVAWTN  117



>gb|EYU19673.1| hypothetical protein MIMGU_mgv1a027053mg [Erythranthe guttata]
Length=470

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 83/121 (69%), Gaps = 3/121 (2%)
 Frame = +3

Query  138  MFIVNMvvvfafcvsvfaavRLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQ  317
            MF+ N+ ++    V +    R+ L +++L+ +L+K   ++++K +V+QF++VP+ N N Q
Sbjct  1    MFLANLALLIFSVVFLVVVFRI-LSKTSLIHSLKKSWRFVEEKCYVYQFYRVPKFNDNMQ  59

Query  318  ENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            ENQLYRKV+ Y+NSL  +EDSDF NL   +  KS +I L LD+NQ + DQFLGAR+   +
Sbjct  60   ENQLYRKVYAYLNSLPCVEDSDFANLF--SGTKSTEINLILDENQTIADQFLGARIRKND  117

Query  498  K  500
            K
Sbjct  118  K  118



>ref|XP_003553796.1| PREDICTED: mitochondrial chaperone BCS1-like [Glycine max]
Length=452

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 5/103 (5%)
 Frame = +3

Query  201  LFLYRSALVF-ALRKWSDWI--DDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSL  371
            LF++ S LV  A+R    WI  +D  HV+QFFKVP+LN+  Q N LYRKV +Y++SL S+
Sbjct  3    LFIFLSTLVLIAVRAKKLWIAIEDWFHVYQFFKVPELNETTQHNHLYRKVSLYLHSLPSI  62

Query  372  EDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            EDS F NL+     K NDIVLCL  NQ +QD FLGA + W N+
Sbjct  63   EDSVFANLITGK--KQNDIVLCLGPNQTIQDHFLGATLFWFNQ  103



>gb|EPS72484.1| hypothetical protein M569_02272 [Genlisea aurea]
Length=482

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 74/101 (73%), Gaps = 3/101 (3%)
 Frame = +3

Query  201  LFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQ-ENQLYRKVFVYVNSLSSLED  377
            LFL+R+AL+F ++KWS+ + + +HV+Q  +VP+L+   Q EN  YR+V +YVNSL SLED
Sbjct  22   LFLHRTALIFVVKKWSEGVLNAVHVYQHLRVPELDGLTQRENHFYRRVSLYVNSLPSLED  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            SD+ NL+  +  ++NDI+L  +  Q + D FL AR+SW+N+
Sbjct  82   SDYANLI--SGKRANDIILSPEGGQPIGDVFLSARLSWVNR  120



>ref|XP_004307905.1| PREDICTED: cell division control protein 48-like [Fragaria vesca 
subsp. vesca]
Length=493

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 71/100 (71%), Gaps = 4/100 (4%)
 Frame = +3

Query  204  FLYRSALVFALRK-WSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDS  380
            FL +++L+  L K W   ID + HV+QF+KVPQ N N QENQLYRK+ +Y+NSL ++EDS
Sbjct  23   FLSKTSLLHMLLKSWQSLID-RFHVYQFYKVPQFNHNFQENQLYRKISLYLNSLPNIEDS  81

Query  381  DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            DFTNL + +  KSNDI    D+N  V D FL A+VSW N+
Sbjct  82   DFTNLFSGS--KSNDIFFQHDNNHSVGDTFLSAKVSWTNE  119



>ref|XP_003520880.1| PREDICTED: uncharacterized protein LOC100776680 [Glycine max]
Length=462

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +3

Query  237  RKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVK  416
            R+  DW     HV+QFFKVP+LN   Q N LYRKV +Y++SL S+EDSDF NL+     K
Sbjct  29   RRIEDW----FHVYQFFKVPELNDTTQHNHLYRKVSLYLHSLPSIEDSDFANLITGK--K  82

Query  417  SNDIVLCLDDNQVVQDQFLGARVSWMNK  500
             NDIVLCL  NQ ++D FLGA + W N+
Sbjct  83   QNDIVLCLGPNQTIEDHFLGATLFWFNQ  110



>ref|XP_004502706.1| PREDICTED: mitochondrial chaperone BCS1-like [Cicer arietinum]
Length=488

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            F  +++ ++ L++W    +D+LH+HQ FK+P  + N +ENQLYRK+  Y++SL S++DSD
Sbjct  27   FFRKTSALYILKQWWLSFEDRLHLHQSFKIPLYDHNFRENQLYRKILTYIDSLPSVQDSD  86

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            FTNL   +    +DI L LD NQ+V D FLGA+VSW N
Sbjct  87   FTNLF--SGPNPSDIFLHLDANQIVHDTFLGAKVSWTN  122



>ref|XP_009775982.1| PREDICTED: uncharacterized protein LOC104225813 [Nicotiana sylvestris]
Length=512

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 73/101 (72%), Gaps = 4/101 (4%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            F  +++L+  L+KW   ++DK +V++++KVP+ N N QENQLYR +  Y+NSL  LEDS+
Sbjct  17   FASKTSLLHILKKWLRLLEDKCYVYRYYKVPRFNHNMQENQLYRHISTYLNSLPCLEDSN  76

Query  384  FTNLVNSAAVKSNDIVLCLDD-NQ-VVQDQFLGARVSWMNK  500
            FTNL   +  KSN+I L LDD NQ +V D FLGARV W+N+
Sbjct  77   FTNLF--SGNKSNEINLVLDDSNQNIVVDNFLGARVCWINE  115



>emb|CDY61723.1| BnaA04g27130D [Brassica napus]
Length=128

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 9/96 (9%)
 Frame = +3

Query  234  LRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAV  413
            ++KW   + D  HV+Q +KVP+ N N QEN LY KV+ Y+NSLSS+EDSDFTNL      
Sbjct  2    VKKWWKTVVDVFHVYQSYKVPEFNNNLQENHLYMKVYAYLNSLSSMEDSDFTNLF--TGK  59

Query  414  KSNDIVLCLDDNQVVQDQF-------LGARVSWMNK  500
            KSN+I+L L  NQ+V D+F       LGARV W NK
Sbjct  60   KSNEIILRLYQNQIVGDEFLAVPGRVLGARVCWYNK  95



>ref|XP_002321380.2| hypothetical protein POPTR_0015s01020g [Populus trichocarpa]
 gb|EEF05507.2| hypothetical protein POPTR_0015s01020g [Populus trichocarpa]
Length=496

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            FL +++ +  L +     +DK  V+Q FKVPQ N   QENQLY KV  Y+ SL ++EDSD
Sbjct  26   FLSKTSFLHILARCWRSFEDKFCVYQIFKVPQFNDLFQENQLYHKVSTYLTSLPAIEDSD  85

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            FTNL + +  K+NDI+L LD NQV+ D FLGARV W N+
Sbjct  86   FTNLFSGS--KANDIILHLDKNQVIHDSFLGARVQWSNE  122



>ref|XP_009599055.1| PREDICTED: uncharacterized protein LOC104094765 [Nicotiana tomentosiformis]
Length=499

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 71/102 (70%), Gaps = 5/102 (5%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            F  +++L+  L+KW   +++K  V+Q++KVPQ N N QENQLYR++  Y+NSL  LEDS+
Sbjct  17   FASKTSLLDILKKWLRLLEEKCCVYQYYKVPQFNHNMQENQLYRQISTYLNSLPCLEDSN  76

Query  384  FTNLVNSAAVKSNDIVLCLDD---NQVVQDQFLGARVSWMNK  500
            F NL   +  KSN+I L LDD   N +V D FLGARV W+N+
Sbjct  77   FINLF--SGYKSNEINLLLDDSNQNIIVVDNFLGARVCWINE  116



>ref|XP_010109213.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
 gb|EXC21393.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
Length=486

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = +3

Query  204  FLYRSALVFAL-RKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDS  380
            FLY++ +V  L R W  +++ +LHV+Q +KVPQ N++ QENQLYRK+  Y+NSL S+EDS
Sbjct  18   FLYKTNVVLILVRSWQSFVE-RLHVYQLYKVPQYNEHFQENQLYRKISTYLNSLPSVEDS  76

Query  381  DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            D+TNL + +  KSNDI   LD +Q ++D FL A V W N+
Sbjct  77   DYTNLFSGS--KSNDIFSHLDTSQSIRDTFLNAGVWWTNQ  114



>ref|XP_011044701.1| PREDICTED: uncharacterized protein LOC105139793 [Populus euphratica]
Length=496

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            FL +++ +  L +     +DK  V+Q FKVPQ N   QENQLY KV  Y+ SL + EDSD
Sbjct  26   FLSKTSFLHILARCWRSFEDKFCVYQIFKVPQFNDLFQENQLYHKVSTYLTSLPATEDSD  85

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            FTNL + +  K+NDI+L LD NQV+ D FLGARV W N+
Sbjct  86   FTNLFSGS--KANDIILHLDKNQVIHDSFLGARVQWSNE  122



>gb|AET02010.2| P-loop nucleoside triphosphate hydrolase superfamily protein, 
putative [Medicago truncatula]
Length=457

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R  L+++ L+   +K    + D  +++Q+ KVP+LNQ  Q N  YRKV +Y++SL SLED
Sbjct  21   RYILFKTGLIHTTKKLHKKLQDFFYLYQYLKVPELNQTMQPNMFYRKVSLYLHSLPSLED  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            SDFTNL+       NDIVL LD +Q+++D+FLGA V W
Sbjct  81   SDFTNLI--TGNNQNDIVLTLDSDQIIEDRFLGATVYW  116



>ref|XP_010693170.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Beta vulgaris 
subsp. vulgaris]
Length=476

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            RLFL R      L+ W + I DK H HQF KVP+ N N QENQL+R+V +Y+NSL SLE+
Sbjct  23   RLFLKRKIRTSKLKNWWNLISDKFHDHQFLKVPEFNDNNQENQLFRRVSLYLNSLESLEN  82

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            SDF NL   +  K  DI+L L+ NQ + D FL A + W
Sbjct  83   SDFINLF--SGTKPTDILLSLNPNQTIVDHFLDAPLIW  118



>ref|XP_010035300.1| PREDICTED: uncharacterized protein LOC104424536 [Eucalyptus grandis]
Length=489

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
             LYR++L+  L      ++D+ H +Q +++PQ +++ QENQLYRKV  Y++SL+SL+ SD
Sbjct  24   LLYRTSLLHKLAALLRSVEDRCHAYQHYRIPQYSEHLQENQLYRKVSTYLSSLASLDGSD  83

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            FTNL + A  +SND+VL LD ++ V D+FL A +SW N+
Sbjct  84   FTNLFSGA--RSNDVVLRLDPDRPVADRFLSAPLSWANE  120



>ref|XP_011043686.1| PREDICTED: ATP-dependent zinc metalloprotease YME1 homolog [Populus 
euphratica]
Length=496

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = +3

Query  204  FLYRSALVFAL-RKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDS  380
            FL +++ +  L R W  + +DK +V+Q FKVPQ N    ENQLY KV  Y+ SL ++EDS
Sbjct  26   FLAKTSFLHILVRCWRSF-EDKFYVYQIFKVPQFNDLLLENQLYHKVSTYLTSLPAIEDS  84

Query  381  DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            DFTNL + +  K+NDI+L LD NQV+ D FLGARV W N+
Sbjct  85   DFTNLFSGS--KANDIILHLDKNQVIHDSFLGARVHWSNE  122



>ref|XP_010933795.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
Length=497

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 66/101 (65%), Gaps = 1/101 (1%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R  L   AL++ L +W  W+D+++ V+Q+F++P+ N+++QEN LYRK   YV SL SLED
Sbjct  22   RTILSARALLYHLGRWWRWVDERVQVYQYFEIPRYNESSQENPLYRKAAAYVASLPSLED  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            +    L +S+  K ND +L L   Q   D FLGARVSW ++
Sbjct  82   AAAATL-SSSGRKPNDFLLHLGPGQSAHDSFLGARVSWSSR  121



>ref|XP_007135287.1| hypothetical protein PHAVU_010G116600g [Phaseolus vulgaris]
 gb|ESW07281.1| hypothetical protein PHAVU_010G116600g [Phaseolus vulgaris]
Length=477

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 68/101 (67%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R  L+++ L+ ++RK    + D  HV+QF KVP+ N+  Q N L+RKV +Y++SL S+ED
Sbjct  21   RRLLFKTGLIHSIRKLLRRVQDWFHVYQFLKVPEFNEAMQRNHLHRKVSLYLHSLPSIED  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            +DFTNLV  +    NDIVL L+ NQ +QD FLGA + W  +
Sbjct  81   ADFTNLV--SGYDQNDIVLRLEPNQTIQDNFLGATLFWFEQ  119



>ref|XP_007221060.1| hypothetical protein PRUPE_ppa016223mg, partial [Prunus persica]
 gb|EMJ22259.1| hypothetical protein PRUPE_ppa016223mg, partial [Prunus persica]
Length=396

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 71/101 (70%), Gaps = 5/101 (5%)
 Frame = +3

Query  204  FLYRSALV-FALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDS  380
            FL +++L+   ++ W   ID + HV+QF+K+PQ N++ QENQLYRK+ +Y+NSL S+EDS
Sbjct  1    FLSKTSLLQIFIKSWQSLID-RFHVYQFYKIPQFNEHFQENQLYRKISLYLNSLPSIEDS  59

Query  381  DFTNLVNSAAVKSNDIVLCLDDNQ-VVQDQFLGARVSWMNK  500
            DFTNL + +  KSNDI    D N  VV D F  A+VSW N+
Sbjct  60   DFTNLFSGS--KSNDIFFQHDANHSVVHDTFFSAKVSWTNQ  98



>gb|AES72562.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=493

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 3/100 (3%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R F   SAL F L+ W   ++++LH+HQ FK+P  + N +ENQLYRK+  Y++SL S++D
Sbjct  26   RFFRKTSALHF-LKHWWLSLENRLHLHQSFKIPLYDHNFRENQLYRKILTYLDSLPSVQD  84

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            +DFTNL   +    +DI L LD NQ+V D FLGA++SW N
Sbjct  85   ADFTNLF--SGPNPSDIFLHLDANQIVHDTFLGAKLSWTN  122



>ref|XP_002318453.2| hypothetical protein POPTR_0012s02770g [Populus trichocarpa]
 gb|EEE96673.2| hypothetical protein POPTR_0012s02770g [Populus trichocarpa]
Length=488

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            FL +++ +  L +     +DK +V+Q FKVPQ N    ENQLY KV  Y+ SL ++EDSD
Sbjct  18   FLAKTSFLHILARCWRSFEDKFYVYQIFKVPQFNDLFLENQLYHKVSTYLTSLPAIEDSD  77

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            FTNL + +  K+NDI+L LD NQV+ D FLGARV W N+
Sbjct  78   FTNLFSGS--KANDIILHLDKNQVIHDSFLGARVHWSNE  114



>ref|XP_010919325.1| PREDICTED: uncharacterized protein LOC105043468 [Elaeis guineensis]
Length=489

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R  L   AL++ + +W  W+D+++  +Q+F++P+ N+++QEN LYRK   YV SL SLED
Sbjct  23   RTILSARALLYHMGRWWRWVDERVQAYQYFEIPRYNESSQENPLYRKAAAYVASLPSLED  82

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            +D   L +S   K ND +L L   Q   D FLGAR+SW N+
Sbjct  83   ADAATLCSSGR-KPNDFLLHLCPGQSAPDSFLGARLSWSNR  122



>ref|XP_010054126.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
 gb|KCW78500.1| hypothetical protein EUGRSUZ_D02641 [Eucalyptus grandis]
Length=472

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 63/100 (63%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            RL   ++     L+ W     D  +V+Q  KVP+ N   QEN LYR+V VY+NSL SLE+
Sbjct  22   RLLFRKTGPFHLLKGWWRSTQDWFYVYQVLKVPEFNDAVQENPLYRRVSVYLNSLPSLEE  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            SDFTNL   A  K NDI+L LD NQ + D FLGAR+SW N
Sbjct  82   SDFTNLF--AGKKPNDILLHLDPNQTIDDVFLGARLSWTN  119



>ref|XP_003602311.1| Mitochondrial chaperone BCS1 [Medicago truncatula]
Length=507

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 3/100 (3%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R F   SAL F L+ W   ++++LH+HQ FK+P  + N +ENQLYRK+  Y++SL S++D
Sbjct  18   RFFRKTSALHF-LKHWWLSLENRLHLHQSFKIPLYDHNFRENQLYRKILTYLDSLPSVQD  76

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            +DFTNL   +    +DI L LD NQ+V D FLGA++SW N
Sbjct  77   ADFTNLF--SGPNPSDIFLHLDANQIVHDTFLGAKLSWTN  114



>ref|XP_008790554.1| PREDICTED: nuclear valosin-containing protein-like [Phoenix dactylifera]
Length=511

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/101 (46%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R  L   AL++ L +W  W+D+++  +Q+F++P+ N+N+QEN LYRKV  YV SL SLED
Sbjct  22   RTILSARALLYHLGRWWRWVDERVQAYQYFEIPRYNENSQENPLYRKVANYVASLPSLED  81

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            +    L +S   K ND +L L   Q   D FLGARV+W N+
Sbjct  82   AAAATLFSSGR-KPNDFLLHLGPGQSASDSFLGARVTWSNR  121



>ref|XP_008234685.1| PREDICTED: probable mitochondrial chaperone bcs1 [Prunus mume]
Length=488

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 71/101 (70%), Gaps = 5/101 (5%)
 Frame = +3

Query  204  FLYRSALV-FALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDS  380
            FL +++L+   ++ W   ID + HV+QF+K+PQ N++ QENQLYRK+ +Y+NSL S+EDS
Sbjct  23   FLSKTSLLQIFIKSWQSLID-RFHVYQFYKIPQFNEHFQENQLYRKISLYLNSLPSIEDS  81

Query  381  DFTNLVNSAAVKSNDIVLCLDDNQ-VVQDQFLGARVSWMNK  500
            DFTNL + +  KSNDI    D N  VV D F  A+VSW N+
Sbjct  82   DFTNLFSGS--KSNDIFFQHDANHSVVHDTFFRAKVSWTNQ  120



>ref|XP_008803962.1| PREDICTED: uncharacterized protein LOC103717381 [Phoenix dactylifera]
Length=499

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/101 (44%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R  L   AL++ L +W  W+D+++  +Q+F++P+ N+  QEN LYRK   Y+ SL S+ED
Sbjct  28   RTILSARALLYHLGRWWRWVDERMQAYQYFEIPRYNEGTQENPLYRKAAAYMASLPSIED  87

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            +D   L +S+  K ND +L L   Q V D FLGAR+SW N+
Sbjct  88   ADAATL-SSSGRKPNDFLLHLGPGQSVPDSFLGARLSWSNR  127



>gb|KDP30317.1| hypothetical protein JCGZ_18154 [Jatropha curcas]
Length=482

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            FL +++ +  L K+    +D  HV+QFF VPQ N++ QEN LY KV  Y+ SL ++EDSD
Sbjct  22   FLSKTSFLQILVKYLQSFEDYFHVYQFFTVPQYNEHFQENLLYNKVSSYLTSLPAIEDSD  81

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            FTNL + +  KSN+I+L LD  QV+QD FL ARV W+N+
Sbjct  82   FTNLFSGS--KSNEIILRLDAKQVIQDNFLSARVWWINQ  118



>ref|XP_008376774.1| PREDICTED: probable mitochondrial chaperone bcs1 [Malus domestica]
Length=490

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 67/100 (67%), Gaps = 3/100 (3%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            F+ +++LV    K    + D+  V+QF+K+PQ N++ QEN+LYRK+ VY++SL S+EDSD
Sbjct  23   FVSKTSLVHKFTKLGQSLADRFRVYQFYKIPQFNEHFQENRLYRKISVYLDSLPSIEDSD  82

Query  384  FTNLVNSAAVKSNDIVLCLD-DNQVVQDQFLGARVSWMNK  500
            FTNL     VKSNDI    D  N  V D FL A++SW N+
Sbjct  83   FTNLF--TGVKSNDIFFQHDAANSAVHDTFLSAKLSWTNE  120



>ref|XP_003529879.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max]
Length=476

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 71/102 (70%), Gaps = 3/102 (3%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQ-NAQENQLYRKVFVYVNSLSSLE  374
            R FL+++ L+  +R     + D  HV+QF KVP+ N+ N Q N L+RKV +Y++SL S+E
Sbjct  21   RWFLFKTGLIHTIRIRFPRVVDWFHVYQFLKVPEFNETNMQPNNLHRKVSLYLHSLPSIE  80

Query  375  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            D+D+TNL+   A   +DIVL LD NQ ++D+FLGAR+ W N+
Sbjct  81   DADYTNLI--TANDQSDIVLRLDPNQTIEDRFLGARLYWFNQ  120



>ref|XP_008381389.1| PREDICTED: mitochondrial chaperone BCS1-like [Malus domestica]
Length=479

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            F+ +++LV  L K  + + D+  V+QF+K+PQ N++ QENQLY K+ VY++SL S+EDSD
Sbjct  23   FMSKTSLVHKLTKLWESLADRFRVYQFYKIPQFNEHFQENQLYGKISVYLDSLPSIEDSD  82

Query  384  FTNLVNSAAVKSNDIVLCLD-DNQVVQDQFLGARVSW  491
            FTNL   A  KSNDIV   D +N  V D FL A++SW
Sbjct  83   FTNLFTGA--KSNDIVFRHDANNSAVHDTFLSAKLSW  117



>ref|XP_007136478.1| hypothetical protein PHAVU_009G048600g [Phaseolus vulgaris]
 gb|ESW08472.1| hypothetical protein PHAVU_009G048600g [Phaseolus vulgaris]
Length=482

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 66/97 (68%), Gaps = 2/97 (2%)
 Frame = +3

Query  201  LFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDS  380
             F  +++ +  L +W    +++LH+HQ FK+P+ N +AQENQLYR++  Y++SL S++DS
Sbjct  22   FFFRKTSALHILNQWFLSFENRLHIHQSFKIPRYNLHAQENQLYRQILTYLDSLPSVQDS  81

Query  381  DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            D+TNL   +    +DI L LD N  V D FLGA++SW
Sbjct  82   DYTNLF--SGTNPSDIFLHLDPNHTVHDTFLGAKLSW  116



>gb|KHN23332.1| Putative mitochondrial chaperone bcs1 [Glycine soja]
Length=463

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +3

Query  213  RSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTN  392
            +++ +  L +W    +++LH+HQ FK+P+ N ++QEN LYRK+  Y++SL S+EDSD+TN
Sbjct  20   KTSALHILNQWFLSFENRLHLHQSFKIPRYNLHSQENSLYRKILTYLDSLPSVEDSDYTN  79

Query  393  LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            L   +    +DI L LD N  V D FLGAR+SW N
Sbjct  80   LF--SGPNPSDIFLHLDPNHTVHDTFLGARLSWTN  112



>ref|XP_007039156.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein, putative [Theobroma cacao]
 gb|EOY23657.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein, putative [Theobroma cacao]
Length=479

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 58/85 (68%), Gaps = 6/85 (7%)
 Frame = +3

Query  237  RKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVK  416
            R   DW     HV+Q ++VP+ N   Q+N+LY KV  Y+NSL SLEDSDFTNL   +  K
Sbjct  35   RSLGDW----FHVYQSYRVPEFNDLFQDNELYHKVSTYLNSLPSLEDSDFTNLFTGS--K  88

Query  417  SNDIVLCLDDNQVVQDQFLGARVSW  491
            SNDIVL LD NQ + D FLGARV+W
Sbjct  89   SNDIVLHLDTNQTIGDTFLGARVTW  113



>ref|XP_004145938.1| PREDICTED: uncharacterized protein LOC101204309 [Cucumis sativus]
Length=519

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            F+ +++LV+ + K    I D  HV+QF+++PQ ++N Q NQLY +V  Y++SL SLEDS+
Sbjct  67   FITKTSLVYMIVKGFQAITDYFHVYQFYRIPQFDENLQHNQLYLRVHTYLHSLPSLEDSN  126

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            F N+   A  K  DI L LD NQ V D FLGA++ W
Sbjct  127  FANIFCGA--KPGDIFLRLDTNQTVHDSFLGAKLRW  160



>gb|KGN49849.1| hypothetical protein Csa_5G139270 [Cucumis sativus]
Length=524

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            F+ +++LV+ + K    I D  HV+QF+++PQ ++N Q NQLY +V  Y++SL SLEDS+
Sbjct  72   FITKTSLVYMIVKGFQAITDYFHVYQFYRIPQFDENLQHNQLYLRVHTYLHSLPSLEDSN  131

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            F N+   A  K  DI L LD NQ V D FLGA++ W
Sbjct  132  FANIFCGA--KPGDIFLRLDTNQTVHDSFLGAKLRW  165



>ref|XP_003527995.2| PREDICTED: mitochondrial chaperone BCS1-like [Glycine max]
Length=475

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +3

Query  213  RSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTN  392
            +++ +  L +W    +++LH+HQ FK+P+ N ++QEN LYRK+  Y++SL S+EDSD+TN
Sbjct  26   KTSALHILNQWFLSFENRLHLHQSFKIPRYNLHSQENSLYRKILTYLDSLPSVEDSDYTN  85

Query  393  LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            L   +    +DI L LD N  V D FLGA++SW N
Sbjct  86   LF--SGPNPSDIFLHLDPNHTVHDTFLGAKLSWTN  118



>ref|XP_009361315.1| PREDICTED: probable mitochondrial chaperone bcs1 [Pyrus x bretschneideri]
Length=490

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 67/100 (67%), Gaps = 3/100 (3%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            F+ +++LV    K    + D+  V+QF+K+PQ N++ QEN+LYRK+ VY++SL S+EDSD
Sbjct  23   FVSKTSLVHKFTKLWQSLADRFRVYQFYKIPQFNEHFQENRLYRKISVYLDSLPSIEDSD  82

Query  384  FTNLVNSAAVKSNDIVLCLD-DNQVVQDQFLGARVSWMNK  500
            FTNL   A  KSNDI    D  N  V D FL A++SW N+
Sbjct  83   FTNLFTGA--KSNDIFFQHDAANSAVHDTFLSAKLSWTNQ  120



>ref|XP_009351948.1| PREDICTED: probable mitochondrial chaperone bcs1 isoform X2 [Pyrus 
x bretschneideri]
Length=479

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            F+ +++LV    K    + D+  V+QF+K+PQ N++ QENQLY K+ VY++SL S+EDSD
Sbjct  23   FMSKTSLVHKFTKLWQSLADRFRVYQFYKIPQFNEHFQENQLYGKISVYLDSLPSIEDSD  82

Query  384  FTNLVNSAAVKSNDIVLCLD-DNQVVQDQFLGARVSW  491
            FTNL   A  KSNDIV   D +N  V D FL A++SW
Sbjct  83   FTNLFTGA--KSNDIVFRHDANNSAVHDTFLSAKLSW  117



>ref|XP_009351947.1| PREDICTED: probable mitochondrial chaperone bcs1 isoform X1 [Pyrus 
x bretschneideri]
Length=490

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
            F+ +++LV    K    + D+  V+QF+K+PQ N++ QENQLY K+ VY++SL S+EDSD
Sbjct  23   FMSKTSLVHKFTKLWQSLADRFRVYQFYKIPQFNEHFQENQLYGKISVYLDSLPSIEDSD  82

Query  384  FTNLVNSAAVKSNDIVLCLD-DNQVVQDQFLGARVSW  491
            FTNL   A  KSNDIV   D +N  V D FL A++SW
Sbjct  83   FTNLFTGA--KSNDIVFRHDANNSAVHDTFLSAKLSW  117



>ref|XP_006599768.1| PREDICTED: uncharacterized protein LOC100792584, partial [Glycine 
max]
Length=281

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 68/103 (66%), Gaps = 4/103 (4%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQ--NAQENQLYRKVFVYVNSLSSL  371
            R  L+++ L+  +RK    + D  HV+QF KVP+ N+  N + N L+RKV +Y++SL S+
Sbjct  15   RWLLFKTGLMHTIRKRFRRVVDWCHVYQFLKVPEFNETNNMRRNNLHRKVSLYLHSLPSI  74

Query  372  EDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            ED+DFTNL+        DIVL LD NQ ++D+FLGA + W N+
Sbjct  75   EDADFTNLITGN--DQTDIVLRLDPNQTIEDRFLGATLYWFNQ  115



>ref|XP_003523343.1| PREDICTED: mitochondrial chaperone BCS1-like isoform 1 [Glycine 
max]
Length=480

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = +3

Query  201  LFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDS  380
             F  +++ +  L +W    +++LH+HQ FK+P+ N ++ +N LYRK+  Y++SL S+EDS
Sbjct  22   FFFRKTSALHILNQWFLSFENRLHLHQSFKIPRYNLHSLDNSLYRKILTYLDSLPSVEDS  81

Query  381  DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            D+TNL   +    +DI L LD N  V D FLGAR+SW N
Sbjct  82   DYTNLF--SGPNPSDIFLHLDPNHTVHDTFLGARLSWTN  118



>ref|XP_004160408.1| PREDICTED: mitochondrial chaperone BCS1-like [Cucumis sativus]
Length=501

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = +3

Query  213  RSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTN  392
            +++LV+ + K    I D  HV+QF+++PQ ++N Q NQLY +V  Y++SL SLEDS+F N
Sbjct  52   KTSLVYMIVKGFQAITDYFHVYQFYRIPQFDENLQHNQLYLRVHTYLHSLPSLEDSNFAN  111

Query  393  LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            +   A  K  DI L LD NQ V D FLGA++ W
Sbjct  112  IFCGA--KPGDIFLRLDTNQTVHDSFLGAKLRW  142



>ref|XP_007147339.1| hypothetical protein PHAVU_006G115600g [Phaseolus vulgaris]
 gb|ESW19333.1| hypothetical protein PHAVU_006G115600g [Phaseolus vulgaris]
Length=478

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 57/88 (65%), Gaps = 6/88 (7%)
 Frame = +3

Query  237  RKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVK  416
            R+  DW     HV+QF  VP+LNQ   +NQLY  + +Y++SL S++DS F NLV      
Sbjct  40   RRMEDW----FHVYQFLTVPELNQTKHQNQLYTNLSLYLHSLPSIQDSHFANLVTGK--N  93

Query  417  SNDIVLCLDDNQVVQDQFLGARVSWMNK  500
             NDIVLCL  NQ++QD FLGA + W N+
Sbjct  94   QNDIVLCLAPNQIIQDNFLGATIYWFNQ  121



>ref|XP_003627534.1| Cell division cycle protein-like protein [Medicago truncatula]
Length=459

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +3

Query  273  VHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQ  452
            ++Q+ KVP+LNQ  Q N  YRKV +Y++SL SLEDSDFTNL+       NDIVL LD +Q
Sbjct  48   LYQYLKVPELNQTMQPNMFYRKVSLYLHSLPSLEDSDFTNLI--TGNNQNDIVLTLDSDQ  105

Query  453  VVQDQFLGARVSW  491
            +++D+FLGA V W
Sbjct  106  IIEDRFLGATVYW  118



>ref|XP_003626582.1| Mitochondrial chaperone BCS1 [Medicago truncatula]
 gb|AES82800.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=468

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 60/98 (61%), Gaps = 1/98 (1%)
 Frame = +3

Query  207  LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  386
            ++ + L+    K    I+D  HV+Q F VP+LN N Q N LYRK+ +Y +SL SL++S  
Sbjct  26   IFETGLIHESTKLWRIIEDWFHVYQVFHVPELNDNMQHNTLYRKLSLYFHSLPSLQNSQL  85

Query  387  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
             NLV S     ND+VL L  NQ + D FLGA VSW N+
Sbjct  86   NNLVTS-NTNQNDVVLTLAPNQTIHDHFLGATVSWFNQ  122



>ref|XP_008437620.1| PREDICTED: mitochondrial chaperone BCS1-like [Cucumis melo]
Length=447

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = +3

Query  255  IDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVL  434
            I D  HV+QF+++PQ ++N Q NQLY +V  Y++S  SLEDSDF N+   A  K  DI L
Sbjct  9    ITDCFHVYQFYRIPQFDENLQHNQLYLRVHTYLHSFPSLEDSDFANIFCGA--KPGDIFL  66

Query  435  CLDDNQVVQDQFLGARVSW  491
             LD +Q V D FLGA++ W
Sbjct  67   RLDTSQTVHDSFLGAKLRW  85



>ref|XP_010671395.1| PREDICTED: uncharacterized protein LOC104888200 [Beta vulgaris 
subsp. vulgaris]
Length=480

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = +3

Query  204  FLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSD  383
             LY +++   +  W  ++ D  H++  +K+PQ N + QENQL+RKVF Y+ SL SLEDSD
Sbjct  24   LLYHTSVFHIIISWLIFLLDHFHIYHLYKIPQYNDHFQENQLFRKVFTYIRSLPSLEDSD  83

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWM  494
            F  L   +  K  DI++ L+ +  V D FL A+V+W+
Sbjct  84   FAALF--SGDKPGDILVSLNSDGYVTDTFLRAKVTWI  118



>ref|XP_008644692.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Zea mays]
 gb|AFW68354.1| hypothetical protein ZEAMMB73_211551 [Zea mays]
Length=513

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +3

Query  210  YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFT  389
            Y+SA     R W  W D+    +Q+++VP+L  +  EN L+RK   YV SL SLED+D  
Sbjct  31   YKSAAHAVRRAWR-WADEWAQAYQYYEVPRLAVDGAENPLFRKAAAYVASLPSLEDADAA  89

Query  390  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
             +++SAA KSND  L L      +D FLGAR++W N
Sbjct  90   CVLSSAA-KSNDFALQLGPGHTARDAFLGARLAWTN  124



>ref|XP_004982590.1| PREDICTED: uncharacterized protein LOC101755261 [Setaria italica]
Length=523

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 60/100 (60%), Gaps = 1/100 (1%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            RL L   +   ALR+   W D+    +Q+++VP+L  +  EN L+RK   YV SL SLED
Sbjct  28   RLVLSYKSAAHALRRAWRWADEWAQAYQYYEVPRLAGDDAENPLFRKAAAYVASLPSLED  87

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            +D   +++SAA KSN+  L L      +D FLGAR++W N
Sbjct  88   ADAACVLSSAA-KSNEFALQLGPGHAARDAFLGARLAWTN  126



>ref|XP_008664748.1| PREDICTED: transitional endoplasmic reticulum ATPase-like [Zea 
mays]
 tpg|DAA49287.1| TPA: hypothetical protein ZEAMMB73_293837 [Zea mays]
Length=504

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 41/98 (42%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            RL L   +   ALR+   W D++   +Q ++VP+L  +  EN L+RK   YV SL SLED
Sbjct  23   RLVLSYKSAAHALRRAWRWADERAQAYQHYEVPRLAADGAENPLFRKAAAYVASLPSLED  82

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            +D   +++SAA KSN   L L      +D FLGAR++W
Sbjct  83   ADAACVLSSAA-KSNGFALRLGPGHAARDAFLGARLAW  119



>dbj|BAJ87142.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97442.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 41/96 (43%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +3

Query  210  YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFT  389
            Y+SA   A R W  W D+    +Q+++VP+      EN L+RK   YV SL SLED+D  
Sbjct  31   YKSAAHAARRLWR-WADEWAQAYQYYEVPRFAGEGAENPLFRKAAAYVASLPSLEDADAA  89

Query  390  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
             +++SA+ KSND  L L       D FLGAR++W N
Sbjct  90   CVLSSAS-KSNDFSLQLGPGHTAHDAFLGARLAWTN  124



>ref|XP_006491957.1| PREDICTED: mitochondrial chaperone BCS1-like [Citrus sinensis]
Length=482

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 58/89 (65%), Gaps = 8/89 (9%)
 Frame = +3

Query  237  RKWSDWIDDKLHVHQFFKVPQ--LNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAA  410
            R + DW     HV+Q +K+PQ   N N QEN LY KV  Y+NSL+SLEDS FTNL   + 
Sbjct  36   RSFEDW----FHVYQSYKIPQYNENNNLQENLLYGKVSTYLNSLASLEDSQFTNLFTGS-  90

Query  411  VKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
             K NDI+L LD NQ V D FLGARV W N
Sbjct  91   -KCNDIILNLDANQTVVDTFLGARVYWTN  118



>ref|XP_006441187.1| hypothetical protein CICLE_v10023517mg [Citrus clementina]
 gb|ESR54427.1| hypothetical protein CICLE_v10023517mg [Citrus clementina]
Length=480

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 58/89 (65%), Gaps = 8/89 (9%)
 Frame = +3

Query  237  RKWSDWIDDKLHVHQFFKVPQ--LNQNAQENQLYRKVFVYVNSLSSLEDSDFTNLVNSAA  410
            R + DW     HV+Q +K+PQ   N N QEN LY KV  Y+NSL+SLEDS FTNL   + 
Sbjct  36   RSFEDW----FHVYQSYKIPQYNENNNLQENLLYGKVSTYLNSLASLEDSQFTNLFTGS-  90

Query  411  VKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
             K NDI+L LD NQ V D FLGARV W N
Sbjct  91   -KCNDIILNLDANQTVVDTFLGARVYWTN  118



>ref|XP_003574206.1| PREDICTED: uncharacterized protein LOC100834121 [Brachypodium 
distachyon]
Length=520

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 59/97 (61%), Gaps = 3/97 (3%)
 Frame = +3

Query  210  YRSALVFALRKWSDWIDDKLHVHQFFKVPQ-LNQNAQENQLYRKVFVYVNSLSSLEDSDF  386
            Y+SA   A R W  W D+    +Q+++VP+ L     EN L+RK   YV+SL SLED+D 
Sbjct  28   YKSAAHAARRLWR-WADEWAQAYQYYEVPRFLGGGGDENPLFRKAAAYVSSLPSLEDADA  86

Query  387  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
              +++SA+ KSND  L L      +D FLGAR++W N
Sbjct  87   ACVLSSAS-KSNDFALQLGPGHTARDAFLGARLAWTN  122



>emb|CDP05017.1| unnamed protein product [Coffea canephora]
Length=420

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 2/62 (3%)
 Frame = +3

Query  315  QENQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWM  494
            QENQLYRKV  Y++SL ++EDSDFTNL + A  K N+I L LD NQ+V D FLGAR+ W+
Sbjct  2    QENQLYRKVHTYLSSLPAVEDSDFTNLFSGA--KPNEINLVLDPNQIVLDNFLGARLFWI  59

Query  495  NK  500
            N+
Sbjct  60   NQ  61



>ref|XP_002464362.1| hypothetical protein SORBIDRAFT_01g016970 [Sorghum bicolor]
 gb|EER91360.1| hypothetical protein SORBIDRAFT_01g016970 [Sorghum bicolor]
Length=531

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 60/105 (57%), Gaps = 6/105 (6%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQL-----NQNAQENQLYRKVFVYVNSL  362
            RL L   +   A+R+   W D+    +Q+++VP+L     +    EN L+RK   YV SL
Sbjct  27   RLVLSYKSAAHAVRRAWRWADEWAQAYQYYEVPRLVAAAGDGGGAENPLFRKAAAYVASL  86

Query  363  SSLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
             SLED+D   +++SAA KSND  L L      +D FLGAR++W N
Sbjct  87   PSLEDADAACVLSSAA-KSNDFALQLGPGHTARDAFLGARLAWTN  130



>gb|KDO59683.1| hypothetical protein CISIN_1g044297mg, partial [Citrus sinensis]
Length=440

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 52/78 (67%), Gaps = 4/78 (5%)
 Frame = +3

Query  270  HVHQFFKVPQLNQNAQENQL--YRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLCLD  443
            HV+Q +K+PQ N+N    +   Y KV  Y+NSL+SLEDS FTNL   +  K NDI+L LD
Sbjct  3    HVYQSYKIPQYNENNNLQENLLYGKVSTYLNSLASLEDSQFTNLFTGS--KCNDIILNLD  60

Query  444  DNQVVQDQFLGARVSWMN  497
             NQ V D FLGARV W N
Sbjct  61   ANQTVVDTFLGARVYWTN  78



>gb|EPS71797.1| hypothetical protein M569_02959, partial [Genlisea aurea]
Length=455

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 57/92 (62%), Gaps = 4/92 (4%)
 Frame = +3

Query  207  LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDF  386
            L R  L   LR+W  + +D  +VHQ +++P+ N   QEN L+RK + Y+NSL S+EDSDF
Sbjct  27   LIRHTLKTRLRRW--YAEDSFYVHQSYRIPKYNDAMQENLLFRKAYSYLNSLPSVEDSDF  84

Query  387  TNLVNSAAVKSNDIVLCLDDNQ-VVQDQFLGA  479
              L  S+    + I L +D+NQ  V D FLG+
Sbjct  85   AKLY-SSFTPWDIITLVVDENQTTVVDTFLGS  115



>ref|XP_004986004.1| PREDICTED: uncharacterized protein LOC101775542 [Setaria italica]
Length=515

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = +3

Query  210  YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFT  389
            Y+SAL +ALR+     D+    +Q+ +VP+   +  EN L+RK   YV +L SLED+D T
Sbjct  33   YKSAL-YALRRLWRCADEWAQAYQYHEVPRFACDGAENPLFRKAAAYVAALPSLEDADAT  91

Query  390  NLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            ++++SA+  +  + L L      +D FLGAR++W N
Sbjct  92   SVLSSASRTNGGLSLQLGPGHTARDAFLGARLAWTN  127



>gb|EEE51276.1| hypothetical protein OsJ_32176 [Oryza sativa Japonica Group]
Length=486

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQ---ENQLYRKVFVYVNSLSS  368
            R+ L   ++  A+R+   W D+    +Q+++VP+         EN L+RK   YV +L S
Sbjct  29   RVVLSYKSVAHAVRRMWRWADEWAQAYQYYEVPRFGGGGGEGVENPLFRKAAAYVAALPS  88

Query  369  LEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            LED+D    V S+A K+ND  L L       D FLGAR++W N
Sbjct  89   LEDAD-AACVLSSACKTNDFSLQLGPGHTAHDAFLGARLAWTN  130



>ref|XP_009382317.1| PREDICTED: uncharacterized protein LOC103970312 [Musa acuminata 
subsp. malaccensis]
Length=517

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 40/100 (40%), Positives = 58/100 (58%), Gaps = 1/100 (1%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L   +LV+   +W  W+D++   +Q F++P+ +++ QEN LYR+   YV +L SLED
Sbjct  21   RIVLSLKSLVYCWGRWWRWVDERTQAYQSFEIPRYSESGQENPLYRRAAAYVAALPSLED  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            +    L +S   K ND  L L   Q   D FLG RVSW N
Sbjct  81   AAAATLFSSGR-KPNDFFLLLGPGQSAADSFLGDRVSWTN  119



>gb|EAY79221.1| hypothetical protein OsI_34338 [Oryza sativa Indica Group]
Length=535

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 38/103 (37%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQ---ENQLYRKVFVYVNSLSS  368
            R+ L   ++  A+R+   W D+    +Q+++VP+         EN L+RK   YV +L S
Sbjct  31   RVVLSYKSVAHAVRRMWRWADEWAQAYQYYEVPRFGGGGGEGVENPLFRKAAAYVAALPS  90

Query  369  LEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            LED+D    V S+A K+ND  L L       D FLGAR++W N
Sbjct  91   LEDAD-AACVLSSACKTNDFSLQLGPGHTAHDAFLGARLAWTN  132



>ref|NP_001065078.2| Os10g0519300 [Oryza sativa Japonica Group]
 gb|AAG13445.1|AC051634_26 hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP54650.1| ATPase, AAA family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26992.2| Os10g0519300 [Oryza sativa Japonica Group]
Length=532

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 38/103 (37%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQ---ENQLYRKVFVYVNSLSS  368
            R+ L   ++  A+R+   W D+    +Q+++VP+         EN L+RK   YV +L S
Sbjct  29   RVVLSYKSVAHAVRRMWRWADEWAQAYQYYEVPRFGGGGGEGVENPLFRKAAAYVAALPS  88

Query  369  LEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            LED+D    V S+A K+ND  L L       D FLGAR++W N
Sbjct  89   LEDAD-AACVLSSACKTNDFSLQLGPGHTAHDAFLGARLAWTN  130



>ref|XP_009411477.1| PREDICTED: uncharacterized protein LOC103993224 [Musa acuminata 
subsp. malaccensis]
Length=498

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 56/100 (56%), Gaps = 1/100 (1%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLED  377
            R+ L    LV  L +W  W++++   +Q F++P+ +   QEN LYR+   YV +L SLED
Sbjct  21   RIVLSFKTLVHCLGRWWRWVEERTQAYQNFEIPRYSDCGQENPLYRRAAAYVAALPSLED  80

Query  378  SDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMN  497
            +   NL +S   K ND  L L       D FLGARVSW N
Sbjct  81   AAAANLFSSGR-KPNDFFLLLGPGHSATDSFLGARVSWTN  119



>ref|XP_006649262.1| PREDICTED: uncharacterized protein LOC102709999 [Oryza brachyantha]
Length=514

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 60/103 (58%), Gaps = 2/103 (2%)
 Frame = +3

Query  198  RLFLYRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKV--FVYVNSLSSL  371
            RL L   + ++A+R+   W D+    +Q+ +VP+   +  EN L+RK   +V V +L SL
Sbjct  18   RLALSHKSALYAVRRLWRWADEWAQAYQYHEVPRFACDGAENPLFRKAAQYVAVAALPSL  77

Query  372  EDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            ED+D  ++++S++  +    L L      +D FLGAR++W N+
Sbjct  78   EDADAASVLSSSSRTNGGFSLQLGPGHTARDAFLGARLAWTNR  120



>gb|EAY88267.1| hypothetical protein OsI_09720 [Oryza sativa Indica Group]
Length=521

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 58/99 (59%), Gaps = 3/99 (3%)
 Frame = +3

Query  210  YRSALVFALRKWSDWIDDKLHVHQFFKVPQL--NQNAQENQLYRKVFVYVNSLSSLEDSD  383
            Y+SAL +A+R+   W D+    +Q+ +VP+   +    EN L+RK   YV  L SLED+D
Sbjct  31   YKSAL-YAVRRLWRWADEWAQAYQYHEVPRFACDGGGAENPLFRKAAQYVAVLPSLEDAD  89

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
              ++++SA+  +    L L      +D FLGAR++W N+
Sbjct  90   AASVLSSASRTNGGFSLQLGPGHTARDAFLGARLAWTNR  128



>ref|NP_001048744.1| Os03g0114400 [Oryza sativa Japonica Group]
 gb|AAO17023.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF93631.1| ATPase, AAA family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10658.1| Os03g0114400 [Oryza sativa Japonica Group]
 dbj|BAG98508.1| unnamed protein product [Oryza sativa Japonica Group]
Length=523

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 58/99 (59%), Gaps = 3/99 (3%)
 Frame = +3

Query  210  YRSALVFALRKWSDWIDDKLHVHQFFKVPQL--NQNAQENQLYRKVFVYVNSLSSLEDSD  383
            Y+SAL +A+R+   W D+    +Q+ +VP+   +    EN L+RK   YV  L SLED+D
Sbjct  33   YKSAL-YAVRRLWRWADEWAQAYQYHEVPRFACDGGGAENPLFRKAAQYVAVLPSLEDAD  91

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
              ++++SA+  +    L L      +D FLGAR++W N+
Sbjct  92   AASVLSSASRTNGGFSLQLGPGHTARDAFLGARLAWTNR  130



>gb|EAZ25345.1| hypothetical protein OsJ_09159 [Oryza sativa Japonica Group]
Length=523

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 58/99 (59%), Gaps = 3/99 (3%)
 Frame = +3

Query  210  YRSALVFALRKWSDWIDDKLHVHQFFKVPQL--NQNAQENQLYRKVFVYVNSLSSLEDSD  383
            Y+SAL +A+R+   W D+    +Q+ +VP+   +    EN L+RK   YV  L SLED+D
Sbjct  33   YKSAL-YAVRRLWRWADEWAQAYQYHEVPRFACDGGGAENPLFRKAAQYVAVLPSLEDAD  91

Query  384  FTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
              ++++SA+  +    L L      +D FLGAR++W N+
Sbjct  92   AASVLSSASRTNGGFSLQLGPGHTARDAFLGARLAWTNR  130



>ref|XP_009391570.1| PREDICTED: mitochondrial chaperone BCS1-like [Musa acuminata 
subsp. malaccensis]
Length=459

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 8/102 (8%)
 Frame = +3

Query  201  LFLYRSALVFA-----LRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLS  365
            LFL R+ L F      L +W  W+D+  H +Q F++P+  ++  EN L R    YV SLS
Sbjct  17   LFLLRAGLSFKCLLYLLGRWWSWLDEHTHAYQHFEIPRYTESGLENPLIRHATAYVASLS  76

Query  366  SLEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            S E       + S+  + N+  +       V D FLG R+SW
Sbjct  77   SHE---CAVAIVSSGYEPNEFSVHPAPGHPVPDSFLGCRLSW  115



>ref|XP_002465991.1| hypothetical protein SORBIDRAFT_01g049680 [Sorghum bicolor]
 gb|EER92989.1| hypothetical protein SORBIDRAFT_01g049680 [Sorghum bicolor]
Length=525

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 4/97 (4%)
 Frame = +3

Query  210  YRSALVFALRKWSDWIDDKLHVHQFFKVPQLNQ---NAQENQLYRKVFVYVNSLSSLEDS  380
            Y+SAL +ALR+     D+    +Q+ +VP+      +  EN L+RK   YV +L SLED+
Sbjct  28   YKSAL-YALRRLWRCADEWAQAYQYHEVPRFAGAGCDGAENPLFRKAAAYVAALPSLEDA  86

Query  381  DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            D   +V+SA+  +  + L L      +D FLGAR+SW
Sbjct  87   DAACVVSSASRTNGGLSLQLGPGHTARDAFLGARLSW  123



>gb|ABR16249.1| unknown [Picea sitchensis]
Length=550

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 35/100 (35%), Positives = 59/100 (59%), Gaps = 4/100 (4%)
 Frame = +3

Query  207  LYRSALVFALRKWSDWIDDKLHVHQFFKVPQLN--QNAQENQLYRKVFVYVNSLSSLEDS  380
            L  + L+  +R+W +   ++   ++FF++P+       QEN LY KV  YV++L    D+
Sbjct  20   LVPTQLLEMVRRWLESWQERWKAYKFFRIPEQYGCDGFQENGLYNKVSTYVSTLGGAVDT  79

Query  381  DFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
             + NL   +A  SNDI + L+  Q V+D FLGAR+ W+++
Sbjct  80   HYANLC--SAKNSNDIFVSLEAGQSVEDVFLGARLWWIHE  117



>ref|NP_001150338.1| ATP binding protein [Zea mays]
 gb|ACG38730.1| ATP binding protein [Zea mays]
 gb|ACN27703.1| unknown [Zea mays]
 tpg|DAA42904.1| TPA: ATP binding protein [Zea mays]
Length=523

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 57/99 (58%), Gaps = 6/99 (6%)
 Frame = +3

Query  210  YRSALVFALRKWSDWIDDKLHVHQFFKVP-----QLNQNAQENQLYRKVFVYVNSLSSLE  374
            Y+SAL +ALR+     D+    +Q+ +VP     Q   +  EN L+RKV  YV +L SLE
Sbjct  24   YKSAL-YALRRLWRCADEWAQAYQYHEVPRFAGAQCGCDGAENPLFRKVAAYVAALPSLE  82

Query  375  DSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            D+D   +V+SA+  +  + L L      +D +LGAR++W
Sbjct  83   DADAACVVSSASRTNGGLSLQLGPGHTARDTYLGARLAW  121



>dbj|BAJ96830.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=129

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 2/83 (2%)
 Frame = +3

Query  213  RSALVFALRKWSDWIDDKLHVHQFFKVPQLNQNAQENQLYRKVFVYVNSLSSLEDSDFTN  392
            R+    A R W  W D+    +Q+++VP+      EN L+RK   YV SL SLED+D   
Sbjct  4    RTTPSLARRLWR-WADEWAQAYQYYEVPRFAGEGAENPLFRKAAAYVASLPSLEDADAAC  62

Query  393  LVNSAAVKSNDIVLCLDDNQVVQ  461
            +++SA+ KSND  L L       
Sbjct  63   VLSSAS-KSNDFSLQLGPGHTAH  84



>gb|KDP28443.1| hypothetical protein JCGZ_14214 [Jatropha curcas]
Length=412

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 2/44 (5%)
 Frame = +3

Query  369  LEDSDFTNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            +EDSDFTNL+     KSN+I+L LD NQ++ D FLGAR+SW+N+
Sbjct  1    MEDSDFTNLL--IGKKSNEIILRLDPNQIIDDDFLGARISWINE  42



>ref|XP_006849190.1| hypothetical protein AMTR_s00027p00211720 [Amborella trichopoda]
 gb|ERN10771.1| hypothetical protein AMTR_s00027p00211720 [Amborella trichopoda]
Length=466

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = +3

Query  261  DKLHVHQFFKVPQLNQNAQE-NQLYRKVFVYVNSLSSLEDSDFTNLVNSAAVKSNDIVLC  437
            ++ H  + +++P+ N  + E N LY KV +YV +LS  ED+DF+NL    A  S +  L 
Sbjct  28   NRRHSCRIYRIPEHNGISNEKNSLYSKVSIYVTALSQAEDADFSNLY---AKNSGEFFLQ  84

Query  438  LDDNQVVQDQFLGARVSWMNK  500
             D N  ++D FLG  V W ++
Sbjct  85   PDSNHAIKDSFLGTTVWWKHE  105



>ref|XP_003562201.1| PREDICTED: uncharacterized protein LOC100825790 [Brachypodium 
distachyon]
Length=500

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 38/104 (37%), Positives = 53/104 (51%), Gaps = 11/104 (11%)
 Frame = +3

Query  210  YRSALVFALRKWSDWIDDKLHVHQFFKVPQ-------LNQNAQENQLYRKVFVYVNSLSS  368
            YRSA+ F  R W    D+    +Q+ +VP+         +  +EN L+RK  VYV+SL S
Sbjct  20   YRSAMYFLRRLWR-LCDEWTQAYQYHEVPRRLGLTGAEEEEEEENPLFRKALVYVSSLPS  78

Query  369  LEDSDFTN---LVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSW  491
            LED+D      L  S + K   + L L       D FLGAR++W
Sbjct  79   LEDADAATVLLLSPSPSRKKTGLSLRLGHGHAACDAFLGARLAW  122



>gb|EYU24583.1| hypothetical protein MIMGU_mgv11b019013mg [Erythranthe guttata]
Length=149

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 2/38 (5%)
 Frame = +3

Query  387  TNLVNSAAVKSNDIVLCLDDNQVVQDQFLGARVSWMNK  500
            TNL   +  K NDI+L LDDNQ +Q+ FLGAR+SW+N+
Sbjct  19   TNLF--SGRKPNDILLSLDDNQSIQEVFLGARISWVNQ  54



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564814758300