BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF021O06

Length=377
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAV33983.1|  alpha tubulin                                           179   2e-55   Pinus taeda
gb|ACU24494.1|  unknown                                                 182   2e-55   Glycine max [soybeans]
ref|NP_001275472.1|  alpha-tubulin-like protein                         184   3e-55   Solanum tuberosum [potatoes]
gb|AAI59362.1|  Unknown (protein for MGC:185872)                        179   1e-54   Xenopus tropicalis [western clawed frog]
ref|XP_001786415.1|  predicted protein                                  179   1e-54   
gb|ACU18775.1|  unknown                                                 181   1e-54   Glycine max [soybeans]
gb|AAK51091.1|  alpha tubulin                                           177   1e-54   Coffea arabica [arabica coffee]
gb|ACN40426.1|  unknown                                                 184   2e-54   Picea sitchensis
ref|XP_005932718.1|  PREDICTED: tubulin alpha chain-like                178   2e-54   
emb|CBI29424.3|  unnamed protein product                                183   2e-54   Vitis vinifera
gb|ABE66388.1|  alpha-tubulin                                           180   2e-54   Striga asiatica [witchweed]
ref|XP_008581337.1|  PREDICTED: tubulin alpha chain-like                176   3e-54   Galeopterus variegatus [Malayan flying lemur]
gb|ERE81184.1|  tubulin alpha-1C chain                                  180   3e-54   Cricetulus griseus [Chinese hamsters]
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                     184   3e-54   
ref|XP_003793694.1|  PREDICTED: tubulin alpha chain-like                178   3e-54   Otolemur garnettii
ref|XP_005466520.1|  PREDICTED: tubulin alpha chain-like                178   3e-54   
ref|XP_002609253.1|  hypothetical protein BRAFLDRAFT_86837              177   4e-54   Branchiostoma floridae
ref|XP_006264718.1|  PREDICTED: tubulin alpha chain-like                178   5e-54   
gb|AAW30622.1|  unknown                                                 179   6e-54   Sus scrofa [pigs]
ref|XP_004019820.1|  PREDICTED: tubulin alpha chain-like                177   6e-54   
ref|XP_003392163.2|  PREDICTED: tubulin alpha chain, testis-speci...    178   6e-54   Amphimedon queenslandica
gb|AAW30623.1|  unknown                                                 179   6e-54   Sus scrofa [pigs]
gb|ABF13307.1|  alpha-tubulin                                           177   7e-54   Phaseolus vulgaris [French bean]
ref|XP_008294350.1|  PREDICTED: tubulin alpha chain                     179   7e-54   Stegastes partitus
gb|AFW67745.1|  alpha tubulin4                                          176   9e-54   
emb|CAJ26346.1|  alpha-tubulin                                          178   9e-54   Platynereis dumerilii
ref|WP_039310890.1|  hypothetical protein                               186   9e-54   
ref|XP_005466564.1|  PREDICTED: tubulin alpha chain-like                177   1e-53   
ref|XP_004599399.1|  PREDICTED: tubulin alpha-1B chain                  179   1e-53   Ochotona princeps [southern American pika]
ref|XP_010774362.1|  PREDICTED: tubulin alpha-1D chain-like             175   1e-53   Notothenia coriiceps [yellowbelly rockcod]
gb|AAN33000.1|  alpha-tubulin 4                                         182   1e-53   Gossypium hirsutum [American cotton]
ref|XP_005932717.1|  PREDICTED: tubulin alpha-1B chain-like             180   1e-53   
dbj|BAE01779.1|  unnamed protein product                                180   1e-53   Macaca fascicularis [crab eating macaque]
ref|XP_003979912.1|  PREDICTED: tubulin alpha-1D chain-like             176   1e-53   
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2          185   1e-53   
ref|XP_006056311.1|  PREDICTED: tubulin alpha-1B chain-like             179   1e-53   
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...    185   1e-53   Brassica rapa
gb|EPZ32931.1|  Tubulin domain-containing protein                       176   1e-53   Rozella allomycis CSF55
ref|XP_010726225.1|  PREDICTED: tubulin alpha chain-like                177   1e-53   Meleagris gallopavo [common turkey]
gb|EYU34086.1|  hypothetical protein MIMGU_mgv1a0196711mg               178   2e-53   Erythranthe guttata [common monkey flower]
ref|XP_005801996.1|  PREDICTED: tubulin alpha-1B chain-like             180   2e-53   
emb|CBI22190.3|  unnamed protein product                                184   2e-53   Vitis vinifera
ref|XP_006109205.1|  PREDICTED: tubulin alpha-1D chain-like             179   2e-53   Myotis lucifugus
ref|XP_004704287.1|  PREDICTED: tubulin alpha chain-like                175   2e-53   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004778983.1|  PREDICTED: tubulin alpha-1C chain                  179   2e-53   
gb|AAG49533.3|  alpha tubulin                                           180   2e-53   Glossina morsitans morsitans
ref|XP_006264720.1|  PREDICTED: tubulin alpha-1C chain                  176   2e-53   
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                   183   2e-53   Citrus sinensis [apfelsine]
ref|XP_008969760.1|  PREDICTED: tubulin alpha chain-like                177   2e-53   
ref|XP_006433709.1|  hypothetical protein CICLE_v100015521mg            176   2e-53   
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2     184   3e-53   
gb|AIK29207.1|  putative alpha-tubulin                                  180   3e-53   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2     184   3e-53   
ref|XP_006895063.1|  PREDICTED: tubulin alpha-1B chain-like             179   3e-53   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    184   3e-53   
ref|XP_005906298.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    177   3e-53   Bos mutus
ref|XP_011366648.1|  PREDICTED: tubulin alpha-1C chain-like             181   3e-53   Pteropus vampyrus
ref|XP_008949708.1|  PREDICTED: tubulin alpha-1A chain-like             178   3e-53   
ref|XP_007426287.1|  PREDICTED: tubulin alpha-1C chain                  179   3e-53   Python bivittatus
gb|AIJ27191.1|  alpha-tubulin 1a                                        179   3e-53   Mytilus galloprovincialis
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2        184   3e-53   Brassica rapa
emb|CDY25017.1|  BnaC02g39910D                                          183   3e-53   Brassica napus [oilseed rape]
gb|EDL87015.1|  rCG50513, isoform CRA_a                                 181   4e-53   Rattus norvegicus [brown rat]
ref|XP_008172101.1|  PREDICTED: tubulin alpha-1B chain                  179   4e-53   Chrysemys picta bellii
ref|XP_004644630.1|  PREDICTED: tubulin alpha-3 chain-like              176   4e-53   
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    184   4e-53   
gb|ABO33166.1|  alpha tubulin a2                                        178   4e-53   Mesenchytraeus solifugus
ref|XP_005801995.1|  PREDICTED: tubulin alpha-1A chain-like             179   4e-53   
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2        184   4e-53   Tarenaya hassleriana [spider flower]
ref|XP_007663362.1|  PREDICTED: tubulin alpha chain-like                175   4e-53   
emb|CBI19330.3|  unnamed protein product                                182   4e-53   Vitis vinifera
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             184   5e-53   Populus trichocarpa [western balsam poplar]
emb|CDY66630.1|  BnaCnng51680D                                          183   5e-53   Brassica napus [oilseed rape]
tpg|DAA51110.1|  TPA: alpha-tubulin                                     178   5e-53   
gb|AGG37287.1|  alpha-tubulin 5                                         184   5e-53   Salix arbutifolia
ref|XP_008575749.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    180   5e-53   Galeopterus variegatus [Malayan flying lemur]
ref|XP_008317242.1|  PREDICTED: tubulin alpha-1C chain-like             180   5e-53   
gb|AGG37285.1|  alpha-tubulin 3                                         184   5e-53   Salix arbutifolia
gb|ABK92552.1|  unknown                                                 184   5e-53   Populus trichocarpa [western balsam poplar]
ref|XP_008475351.1|  PREDICTED: tubulin alpha-1 chain-like              180   5e-53   
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             184   6e-53   Citrus clementina [clementine]
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2        183   6e-53   
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    184   6e-53   
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             184   6e-53   Selaginella moellendorffii
emb|CDY29334.1|  BnaA05g16010D                                          183   6e-53   Brassica napus [oilseed rape]
ref|XP_005365400.1|  PREDICTED: tubulin alpha-3 chain-like              177   6e-53   
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         184   6e-53   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           184   6e-53   Betula pendula [white birch]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             184   6e-53   Prunus persica
ref|XP_010995722.1|  PREDICTED: tubulin alpha-1B chain                  181   6e-53   Camelus dromedarius [camel]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     183   6e-53   Eucalyptus grandis [rose gum]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                183   6e-53   Pyrus x bretschneideri [bai li]
gb|KGL81705.1|  Tubulin alpha-1C chain                                  178   6e-53   Tinamus guttatus
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   183   6e-53   Populus euphratica
ref|XP_007042689.1|  Tubulin alpha-2 chain                              183   6e-53   Theobroma cacao [chocolate]
gb|AAV92352.1|  alpha tubulin 1                                         183   7e-53   Pseudotsuga menziesii var. menziesii
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                183   7e-53   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                183   7e-53   Tarenaya hassleriana [spider flower]
dbj|BAP59012.1|  alpha tubulin                                          183   7e-53   Taxus cuspidata [ichii]
emb|CBI25125.3|  unnamed protein product                                182   7e-53   Vitis vinifera
gb|ABX57816.1|  alpha tubulin                                           183   7e-53   Picea wilsonii
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    183   7e-53   Tarenaya hassleriana [spider flower]
ref|XP_002522104.1|  tubulin alpha chain, putative                      183   7e-53   Ricinus communis
ref|XP_002510010.1|  tubulin alpha chain, putative                      183   7e-53   Ricinus communis
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          183   7e-53   Tarenaya hassleriana [spider flower]
gb|AID52921.1|  tubulin alpha chain                                     183   7e-53   Carthamus tinctorius
ref|XP_006264719.1|  PREDICTED: tubulin alpha-1A chain                  181   7e-53   
ref|NP_171974.1|  tubulin alpha-4 chain                                 183   7e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             183   7e-53   Capsella rubella
ref|XP_007018369.1|  Tubulin alpha-2 chain                              183   7e-53   Theobroma cacao [chocolate]
gb|AAT77076.1|  alpha tubulin                                           174   7e-53   Oryza sativa Japonica Group [Japonica rice]
gb|ABO47737.1|  alpha-tubulin                                           183   8e-53   Gossypium hirsutum [American cotton]
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          183   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   183   8e-53   Fragaria vesca subsp. vesca
ref|XP_003770912.1|  PREDICTED: tubulin alpha-1C chain                  180   8e-53   
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              183   8e-53   
ref|XP_003804211.2|  PREDICTED: tubulin alpha-3E chain                  174   8e-53   Pan paniscus [bonobo]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    183   8e-53   Gossypium raimondii
gb|KHG20487.1|  Tubulin alpha chain                                     183   8e-53   Gossypium arboreum [tree cotton]
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             183   8e-53   Eutrema salsugineum [saltwater cress]
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     183   8e-53   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     183   8e-53   Pyrus x bretschneideri [bai li]
ref|XP_010093625.1|  Tubulin alpha chain                                183   9e-53   Morus notabilis
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                183   9e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_849388.1|  tubulin alpha-6 chain                                 182   9e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                183   1e-52   Elaeis guineensis
gb|AAI53472.1|  Unknown (protein for MGC:173992)                        177   1e-52   Danio rerio [leopard danio]
gb|ELK23510.1|  Tubulin alpha chain                                     173   1e-52   Myotis davidii
gb|AAX21196.1|  putative alpha-tubulin                                  176   1e-52   Solanum betaceum [tamarillo]
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    183   1e-52   Brassica rapa
gb|AAC97930.1|  alpha tubulin                                           175   1e-52   Notothenia coriiceps [yellowbelly rockcod]
gb|AHJ80818.1|  Tua1                                                    179   1e-52   Eragrostis tef [tef]
gb|ETE59910.1|  Tubulin alpha-1A chain                                  179   1e-52   Ophiophagus hannah
gb|ABO47736.1|  alpha-tubulin                                           183   1e-52   Gossypium hirsutum [American cotton]
gb|AGG37283.1|  alpha-tubulin 1                                         183   1e-52   Salix arbutifolia
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                183   1e-52   Cucumis sativus [cucumbers]
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                183   1e-52   Vitis vinifera
gb|KHG18997.1|  Tubulin alpha chain                                     183   1e-52   Gossypium arboreum [tree cotton]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     183   1e-52   Cucumis melo [Oriental melon]
ref|XP_006821303.1|  PREDICTED: tubulin alpha-1 chain-like              176   1e-52   Saccoglossus kowalevskii
gb|AAH33064.1|  TUBA1C protein                                          179   1e-52   Homo sapiens [man]
gb|KJB58757.1|  hypothetical protein B456_009G224800                    182   1e-52   Gossypium raimondii
gb|KHN01709.1|  Tubulin alpha chain                                     182   1e-52   Glycine soja [wild soybean]
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    182   1e-52   Glycine max [soybeans]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             182   1e-52   Citrus clementina [clementine]
ref|XP_004617224.1|  PREDICTED: tubulin alpha-1D chain-like             176   1e-52   
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    182   1e-52   Citrus sinensis [apfelsine]
gb|ACN40181.1|  unknown                                                 182   1e-52   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     182   1e-52   Vitis vinifera
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              182   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              182   1e-52   Fragaria vesca subsp. vesca
gb|AAO73546.1|  alpha-tubulin                                           182   1e-52   Ceratopteris richardii
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              182   1e-52   
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   182   1e-52   Malus domestica [apple tree]
gb|ABS57456.1|  alpha-tubulin                                           176   1e-52   Heliconius melpomene [common postman]
ref|XP_007047652.1|  Tubulin alpha-2 chain                              184   1e-52   
gb|AII97815.1|  BLTX443                                                 178   1e-52   Nephila pilipes
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             182   1e-52   Prunus persica
ref|XP_005139691.1|  PREDICTED: tubulin alpha-1B chain-like             181   2e-52   
gb|EDL87016.1|  rCG50513, isoform CRA_b                                 179   2e-52   Rattus norvegicus [brown rat]
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2     182   2e-52   
ref|XP_008412910.1|  PREDICTED: tubulin alpha-1B chain-like             181   2e-52   Poecilia reticulata
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                182   2e-52   Populus euphratica
gb|ABO47740.1|  alpha-tubulin                                           182   2e-52   Gossypium hirsutum [American cotton]
ref|XP_003976815.1|  PREDICTED: tubulin alpha-1 chain-like              175   2e-52   
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             182   2e-52   Selaginella moellendorffii
ref|XP_006581475.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    182   2e-52   
gb|ABQ59634.1|  alpha-tubulin 5                                         182   2e-52   Populus tremuloides
gb|AEM36066.1|  alpha tubulin                                           172   2e-52   Mytilus edulis [blue mussel]
gb|AAW30624.1|  unknown                                                 175   2e-52   Sus scrofa [pigs]
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    182   2e-52   
ref|XP_010500556.1|  PREDICTED: tubulin alpha-2 chain isoform X2        182   2e-52   
ref|XP_008372962.1|  PREDICTED: tubulin alpha chain isoform X2          182   2e-52   
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         182   2e-52   Jatropha curcas
gb|AAH21564.1|  TUBA1B protein                                          179   2e-52   Homo sapiens [man]
gb|AIX10966.1|  tubulin                                                 182   2e-52   Ornithogalum longebracteatum [sea-onion]
ref|XP_004560331.1|  PREDICTED: tubulin alpha-1A chain-like             177   2e-52   
ref|XP_005324966.1|  PREDICTED: tubulin alpha-1B chain                  178   2e-52   
gb|AFV46219.1|  hypothetical protein                                    182   2e-52   Scutellaria baicalensis [Baikal skullcap]
gb|AEF59080.1|  alpha tubulin-like protein                              178   2e-52   Phragmatopoma lapidosa
ref|XP_003979092.1|  PREDICTED: tubulin alpha-1B chain-like             176   2e-52   
ref|XP_002110664.1|  alpha tubulin                                      177   2e-52   Trichoplax adhaerens
ref|XP_007068754.1|  PREDICTED: tubulin alpha-1D chain-like             176   2e-52   
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                182   2e-52   Elaeis guineensis
gb|AGE09583.1|  TUA1-like protein                                       181   3e-52   Eucalyptus cladocalyx
ref|XP_005406777.1|  PREDICTED: tubulin alpha-1A chain-like             177   3e-52   
gb|ABK92520.1|  unknown                                                 182   3e-52   Populus trichocarpa [western balsam poplar]
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    182   3e-52   Gossypium hirsutum [American cotton]
ref|XP_007248487.1|  PREDICTED: tubulin alpha-1B chain-like             180   3e-52   
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   182   3e-52   Vitis vinifera
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     182   3e-52   Sesamum indicum [beniseed]
ref|XP_004874971.1|  PREDICTED: tubulin alpha-3 chain-like              178   3e-52   
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 182   3e-52   Populus trichocarpa [western balsam poplar]
ref|XP_004817225.1|  PREDICTED: tubulin alpha-3 chain-like              180   3e-52   
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    182   3e-52   Arabis alpina [alpine rockcress]
gb|KFO33466.1|  Tubulin alpha-1C chain                                  179   3e-52   Fukomys damarensis [Damara mole rat]
ref|XP_010104543.1|  Tubulin alpha chain                                182   3e-52   
ref|NP_001289660.1|  tubulin alpha chain-like                           182   3e-52   Eucalyptus grandis [rose gum]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              182   3e-52   Cucumis sativus [cucumbers]
dbj|BAB19779.1|  alpha tubulin                                          182   3e-52   Nicotiana tabacum [American tobacco]
emb|CAD13176.1|  alpha-tubulin                                          182   3e-52   Nicotiana tabacum [American tobacco]
ref|XP_005452428.1|  PREDICTED: tubulin alpha-1A chain-like             177   3e-52   
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    182   3e-52   Gossypium hirsutum [American cotton]
gb|ABO47739.1|  alpha-tubulin                                           182   3e-52   Gossypium hirsutum [American cotton]
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                182   3e-52   Prunus dulcis [sweet almond]
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     182   3e-52   Nicotiana sylvestris
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                181   3e-52   Erythranthe guttata [common monkey flower]
ref|XP_007073037.1|  PREDICTED: tubulin alpha-1C chain                  179   3e-52   
ref|XP_011475942.1|  PREDICTED: tubulin alpha chain-like                178   4e-52   
ref|XP_002763662.3|  PREDICTED: tubulin alpha chain-like                174   4e-52   
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     181   4e-52   Nicotiana tomentosiformis
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                181   4e-52   Solanum tuberosum [potatoes]
gb|ABB02631.1|  unknown                                                 181   4e-52   Solanum tuberosum [potatoes]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     181   4e-52   Nelumbo nucifera [Indian lotus]
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     181   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABQ59633.1|  alpha-tubulin 3                                         181   4e-52   Populus tremuloides
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              181   4e-52   Solanum lycopersicum
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             181   4e-52   Hordeum vulgare [barley]
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        181   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     181   4e-52   
ref|XP_001764722.1|  predicted protein                                  181   4e-52   
ref|XP_005896455.1|  PREDICTED: tubulin alpha-1C chain-like             182   4e-52   Bos mutus
ref|NP_193232.1|  tubulin alpha-6 chain                                 181   4e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006974484.1|  PREDICTED: tubulin alpha-1A chain-like             178   4e-52   Peromyscus maniculatus bairdii
gb|AAO23139.1|  alpha tubulin                                           181   4e-52   Populus tremuloides
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   181   4e-52   Brassica rapa
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              181   4e-52   
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              181   4e-52   Camelina sativa [gold-of-pleasure]
gb|EKC22339.1|  Tubulin alpha chain                                     177   4e-52   Crassostrea gigas
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              181   4e-52   Nicotiana tomentosiformis
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        181   4e-52   Glycine max [soybeans]
gb|KIY93466.1|  Tubulin alpha-1 chain                                   174   4e-52   Monoraphidium neglectum
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             181   4e-52   
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                181   4e-52   Nelumbo nucifera [Indian lotus]
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              181   4e-52   Oryza brachyantha
emb|CDP02221.1|  unnamed protein product                                181   4e-52   Coffea canephora [robusta coffee]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    181   4e-52   
ref|XP_002970006.1|  hypothetical protein SELMODRAFT_231415             180   4e-52   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             181   5e-52   Selaginella moellendorffii
gb|ABP65320.1|  alpha tubulin                                           181   5e-52   Capsicum annuum
gb|EHB00536.1|  Tubulin alpha-1C chain                                  181   5e-52   Heterocephalus glaber [naked mole rat]
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                181   5e-52   Phoenix dactylifera
dbj|BAC24800.1|  alpha tubulin                                          181   5e-52   Physcomitrella patens
gb|ETN59126.1|  tubulin alpha chain                                     179   5e-52   Anopheles darlingi [American malaria mosquito]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              181   5e-52   Populus euphratica
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     181   5e-52   Phoenix dactylifera
dbj|BAJ07366.1|  alpha-tubulin                                          173   5e-52   Hydatigera taeniaeformis
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             181   5e-52   Populus trichocarpa [western balsam poplar]
ref|XP_010751704.1|  PREDICTED: tubulin alpha chain                     179   5e-52   
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             181   5e-52   Prunus persica
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     181   5e-52   Vitis vinifera
gb|AFR68185.1|  tubulin alpha                                           173   5e-52   Oplegnathus fasciatus [striped knifejaw]
ref|XP_009246735.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    178   5e-52   
ref|XP_006606007.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    181   6e-52   
gb|ADW66593.1|  alpha tubulin                                           179   6e-52   Hirschfeldia incana [buchanweed]
dbj|BAG68621.1|  putative alpha tubulin                                 170   6e-52   Pinus thunbergii [green pine]
gb|EGW14703.1|  Tubulin alpha chain, nucleomorph                        179   6e-52   Cricetulus griseus [Chinese hamsters]
ref|XP_010096739.1|  Tubulin alpha chain                                181   6e-52   
ref|XP_002599490.1|  hypothetical protein BRAFLDRAFT_81006              178   6e-52   Branchiostoma floridae
ref|XP_007606030.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    179   6e-52   
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                181   6e-52   Daucus carota [carrots]
gb|ABV55999.1|  alpha-tubulin 7                                         181   6e-52   Populus tremuloides
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                181   7e-52   Eucalyptus grandis [rose gum]
ref|XP_005354088.1|  PREDICTED: tubulin alpha-1B chain                  179   7e-52   
ref|XP_006168270.1|  PREDICTED: tubulin alpha-2 chain-like              179   7e-52   
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   181   7e-52   Nicotiana tomentosiformis
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                181   7e-52   Phoenix dactylifera
ref|XP_006589612.1|  PREDICTED: tubulin alpha chain-like isoform X2     181   7e-52   
ref|XP_006916969.1|  PREDICTED: tubulin alpha-1B chain                  180   7e-52   
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         181   7e-52   Jatropha curcas
emb|CAD32468.1|  alpha-tubulin                                          174   8e-52   Kassina maculata
ref|XP_008702766.1|  PREDICTED: tubulin alpha-1B chain-like             179   8e-52   Ursus maritimus [white bear]
ref|XP_005745106.1|  PREDICTED: tubulin alpha-1B chain-like             180   8e-52   
ref|XP_002517492.1|  tubulin alpha chain, putative                      181   8e-52   Ricinus communis
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2        179   9e-52   
gb|AAM73791.1|  alpha-tubulin                                           172   9e-52   Penaeus monodon [giant tiger prawn]
ref|XP_003608582.1|  Tubulin alpha-5 chain                              180   9e-52   Medicago truncatula
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             180   1e-51   Phaseolus vulgaris [French bean]
ref|XP_007936041.1|  PREDICTED: tubulin alpha-1A chain isoform X2       181   1e-51   Orycteropus afer afer
gb|KFM01620.1|  Tubulin alpha-1C chain                                  176   1e-51   
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             180   1e-51   
gb|AAX29832.1|  tubulin alpha 2                                         179   1e-51   
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                180   1e-51   
ref|XP_004085980.2|  PREDICTED: tubulin alpha-1D chain-like             171   1e-51   
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    180   1e-51   
gb|EFO61055.1|  Alpha-tubulin                                           173   1e-51   
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                180   1e-51   
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     180   1e-51   
ref|XP_004863237.1|  PREDICTED: uncharacterized protein LOC101707673    177   1e-51   
ref|XP_010852034.1|  PREDICTED: tubulin alpha-1C chain                  180   1e-51   
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like              180   1e-51   
ref|XP_001101935.1|  PREDICTED: tubulin alpha-3C/D chain-like iso...    179   1e-51   
gb|ACU19580.1|  unknown                                                 180   1e-51   
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          180   1e-51   
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                180   1e-51   
ref|XP_003762783.1|  PREDICTED: uncharacterized protein LOC100934416    179   1e-51   
ref|NP_001291325.1|  tubulin alpha chain-like                           180   1e-51   
ref|XP_006752422.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    180   1e-51   
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    180   1e-51   
ref|XP_006779408.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    178   1e-51   
ref|XP_009554397.1|  PREDICTED: tubulin alpha-1A chain                  176   1e-51   
ref|XP_001427644.1|  hypothetical protein                               173   1e-51   
emb|CDQ59454.1|  unnamed protein product                                178   1e-51   
emb|CAB66336.1|  alpha-tubulin                                          180   1e-51   
gb|AFX62793.1|  alpha tubulin 84B                                       179   1e-51   
ref|XP_008069065.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    180   1e-51   
gb|AFX62858.1|  alpha tubulin 84B                                       179   1e-51   
gb|AFX62798.1|  alpha tubulin 84B                                       179   1e-51   
gb|AFX62788.1|  alpha tubulin 84B                                       179   1e-51   
gb|AFX62804.1|  alpha tubulin 84B                                       179   1e-51   
gb|AFX62792.1|  alpha tubulin 84B                                       179   1e-51   
gb|AFX62784.1|  alpha tubulin 84B                                       179   1e-51   
ref|XP_004863093.1|  PREDICTED: tubulin alpha-1B chain-like             180   1e-51   
gb|AFX62790.1|  alpha tubulin 84B                                       179   1e-51   
gb|AFX62789.1|  alpha tubulin 84B                                       179   1e-51   
pdb|3DU7|A  Chain A, Tubulin-Colchicine-Phomopsin A: Stathmin-Lik...    180   1e-51   
ref|XP_004274417.1|  PREDICTED: tubulin alpha-1C chain-like             180   1e-51   
gb|AFX62786.1|  alpha tubulin 84B                                       179   1e-51   
ref|XP_007107561.1|  PREDICTED: tubulin alpha-1C chain isoform X1       180   1e-51   
gb|AFX62791.1|  alpha tubulin 84B                                       179   1e-51   
gb|AFX62787.1|  alpha tubulin 84B                                       179   1e-51   
ref|XP_010971611.1|  PREDICTED: tubulin alpha-1C chain-like             180   1e-51   
gb|AFX62802.1|  alpha tubulin 84B                                       179   1e-51   
ref|XP_004880762.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    180   1e-51   
dbj|BAE34741.1|  unnamed protein product                                180   1e-51   
gb|AFX62862.1|  alpha tubulin 84B                                       179   1e-51   
pdb|4DRX|A  Chain A, Gtp-Tubulin In Complex With A Darpin               180   1e-51   
ref|XP_007179355.1|  PREDICTED: tubulin alpha-1B chain                  180   1e-51   
ref|XP_004400918.1|  PREDICTED: tubulin alpha-1B chain-like             180   1e-51   
ref|XP_004400917.1|  PREDICTED: tubulin alpha-1B chain-like             180   1e-51   
ref|NP_919369.2|  tubulin alpha-1C chain                                180   1e-51   
gb|AFX62861.1|  alpha tubulin 84B                                       179   1e-51   
gb|AFX62805.1|  alpha tubulin 84B                                       179   1e-51   
gb|AFX62800.1|  alpha tubulin 84B                                       179   1e-51   
gb|AFX62799.1|  alpha tubulin 84B                                       179   1e-51   
ref|XP_002714140.1|  PREDICTED: tubulin alpha-1B chain-like             180   1e-51   
ref|XP_004569650.1|  PREDICTED: tubulin alpha chain-like                180   1e-51   
ref|XP_004447014.1|  PREDICTED: tubulin alpha-1C chain                  180   1e-51   
gb|AFX62863.1|  alpha tubulin 84B                                       179   1e-51   
gb|AFX62860.1|  alpha tubulin 84B                                       179   1e-51   
ref|XP_008831082.1|  PREDICTED: tubulin alpha-1B chain                  180   1e-51   
ref|XP_005986295.1|  PREDICTED: tubulin alpha-1A chain-like             180   1e-51   
gb|AFX62864.1|  alpha tubulin 84B                                       179   1e-51   
gb|AFX62785.1|  alpha tubulin 84B                                       179   1e-51   
ref|XP_007235803.1|  PREDICTED: tubulin alpha chain-like isoform X2     180   1e-51   
gb|AAI51892.1|  MGC171407 protein                                       180   1e-51   
gb|AAB84143.1|  alpha-tubulin                                           180   1e-51   
gb|AFX62797.1|  alpha tubulin 84B                                       179   1e-51   
sp|P36220.1|TBA_TORMA  RecName: Full=Tubulin alpha chain; AltName...    180   1e-51   
ref|XP_004880763.1|  PREDICTED: tubulin alpha-1B chain-like             180   1e-51   
ref|NP_001095253.1|  tubulin alpha chain                                180   1e-51   
ref|NP_001098596.2|  tubulin alpha-1B chain                             180   1e-51   
ref|XP_007198449.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    180   1e-51   
ref|NP_035784.1|  tubulin alpha-1B chain                                180   1e-51   
ref|XP_004429038.1|  PREDICTED: tubulin alpha-1B chain                  180   1e-51   
ref|NP_001029267.1|  tubulin alpha-1B chain                             180   1e-51   
ref|XP_006035257.1|  PREDICTED: tubulin alpha-1B chain                  180   1e-51   
ref|XP_006916875.1|  PREDICTED: tubulin alpha-1C chain                  180   1e-51   
tpg|DAA32343.1|  TPA: tubulin alpha-1C chain-like                       180   1e-51   
ref|XP_006054596.1|  PREDICTED: tubulin alpha-1B chain                  180   1e-51   
ref|XP_005981039.1|  PREDICTED: tubulin alpha-1B chain-like             180   1e-51   
ref|NP_989078.1|  tubulin, alpha 1c                                     180   1e-51   
ref|NP_001165669.1|  tubulin, alpha 3e                                  180   1e-51   
ref|XP_010348074.1|  PREDICTED: tubulin alpha-1B chain                  180   1e-51   
ref|NP_001029376.1|  tubulin alpha-1C chain                             180   1e-51   
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             180   1e-51   
gb|AAH42319.1|  Tuba1 protein                                           180   1e-51   
pdb|1TUB|A  Chain A, Tubulin Alpha-Beta Dimer, Electron Diffraction     179   1e-51   
ref|XP_008580941.1|  PREDICTED: tubulin alpha-1C chain                  180   1e-51   
gb|AAA91576.1|  alpha-tubulin                                           180   2e-51   
ref|XP_010594690.1|  PREDICTED: tubulin alpha-1C chain                  180   2e-51   
ref|XP_009001973.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    180   2e-51   
ref|XP_008144051.1|  PREDICTED: tubulin alpha-1C chain                  180   2e-51   
ref|XP_006168269.1|  PREDICTED: tubulin alpha-1C chain                  180   2e-51   
ref|XP_005532034.1|  PREDICTED: tubulin alpha-1C chain isoform X1       180   2e-51   
ref|XP_005061430.1|  PREDICTED: tubulin alpha-1C chain-like isofo...    180   2e-51   
dbj|BAE39705.1|  unnamed protein product                                180   2e-51   
ref|XP_011233044.1|  PREDICTED: tubulin alpha-1B chain                  180   2e-51   
ref|XP_010348076.1|  PREDICTED: tubulin alpha-1C chain                  180   2e-51   
ref|XP_003355423.1|  PREDICTED: tubulin alpha-1C chain isoformX1        180   2e-51   
ref|XP_001790595.1|  PREDICTED: tubulin alpha-1C chain-like isofo...    180   2e-51   
pdb|1Z2B|A  Chain A, Tubulin-Colchicine-Vinblastine: Stathmin-Lik...    180   2e-51   
gb|AFX62796.1|  alpha tubulin 84B                                       179   2e-51   
ref|XP_003765945.1|  PREDICTED: tubulin alpha-1D chain-like             180   2e-51   
ref|XP_006131233.1|  PREDICTED: tubulin alpha-1C chain                  180   2e-51   
pdb|3J6E|A  Chain A, Energy Minimized Average Structure Of Microt...    179   2e-51   
sp|P02550.1|TBA1A_PIG  RecName: Full=Tubulin alpha-1A chain; AltN...    180   2e-51   
ref|XP_001632842.1|  predicted protein                                  180   2e-51   
ref|XP_010803242.1|  PREDICTED: tubulin alpha-1C chain isoform X1       180   2e-51   
ref|XP_007634877.1|  PREDICTED: tubulin alpha-1A chain isoform X3       176   2e-51   
gb|AFX62859.1|  alpha tubulin 84B                                       179   2e-51   
ref|XP_005986293.1|  PREDICTED: tubulin alpha-1A chain-like isofo...    180   2e-51   
gb|AAX29538.1|  tubulin alpha 6                                         180   2e-51   
ref|XP_005809818.1|  PREDICTED: tubulin alpha-1B chain-like             180   2e-51   
ref|XP_011282203.1|  PREDICTED: tubulin alpha-1C chain                  180   2e-51   
ref|XP_010383709.1|  PREDICTED: tubulin alpha-1C chain                  180   2e-51   
ref|NP_116093.1|  tubulin alpha-1C chain isoform c                      180   2e-51   
ref|NP_033474.1|  tubulin alpha-1C chain                                180   2e-51   
ref|XP_006811914.1|  PREDICTED: tubulin alpha-1A chain-like             180   2e-51   
ref|XP_005532033.1|  PREDICTED: tubulin alpha-1A chain isoform X3       180   2e-51   
ref|XP_008400581.1|  PREDICTED: tubulin alpha-1B chain-like             180   2e-51   
dbj|BAE29999.1|  unnamed protein product                                180   2e-51   
dbj|BAF82043.1|  unnamed protein product                                180   2e-51   
ref|NP_001011995.1|  tubulin alpha-1C chain                             180   2e-51   
ref|XP_001504231.1|  PREDICTED: tubulin alpha-1C chain isoform 1        180   2e-51   
gb|AAX29190.1|  tubulin alpha 3                                         180   2e-51   
ref|XP_007501737.1|  PREDICTED: tubulin alpha-1D chain-like             180   2e-51   
gb|AAH62238.1|  Tubulin, alpha 1A                                       180   2e-51   
pdb|1SA0|A  Chain A, Tubulin-Colchicine: Stathmin-Like Domain Com...    180   2e-51   
ref|XP_006008956.1|  PREDICTED: tubulin alpha-1A chain-like             180   2e-51   
ref|XP_005532035.1|  PREDICTED: tubulin alpha-1C chain isoform X2       180   2e-51   
ref|XP_003223237.1|  PREDICTED: tubulin alpha-1C chain                  180   2e-51   
ref|XP_004880760.1|  PREDICTED: tubulin alpha-1C chain isoform X1       180   2e-51   
ref|XP_005709455.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    180   2e-51   
dbj|BAE40598.1|  unnamed protein product                                180   2e-51   
ref|NP_035783.1|  tubulin alpha-1A chain                                180   2e-51   
ref|XP_005324965.1|  PREDICTED: tubulin alpha-1A chain                  180   2e-51   
dbj|BAK03519.1|  predicted protein                                      180   2e-51   
ref|NP_001177911.1|  tubulin, alpha 1, like 2                           180   2e-51   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             180   2e-51   
ref|XP_005097254.1|  PREDICTED: tubulin alpha-1D chain-like isofo...    179   2e-51   
ref|XP_002732020.1|  PREDICTED: tubulin alpha-1A chain-like             180   2e-51   
dbj|BAD96744.1|  tubulin alpha 6 variant                                180   2e-51   
ref|XP_006573681.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    179   2e-51   
ref|XP_005896454.1|  PREDICTED: tubulin alpha-1A chain-like             180   2e-51   
prf||0812252A  tubulin alpha                                            180   2e-51
gb|AAH83344.1|  Tubulin, alpha 1A                                       180   2e-51   
emb|CAA25855.1|  alpha-tubulin                                          180   2e-51   
ref|NP_524264.1|  alpha-Tubulin at 84D                                  180   2e-51   
ref|XP_005680058.1|  PREDICTED: tubulin alpha-1C chain                  180   2e-51   
ref|XP_007073038.1|  PREDICTED: tubulin alpha-1A chain-like             180   2e-51   
ref|XP_002718632.1|  PREDICTED: tubulin alpha-1C chain-like             180   2e-51   
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                180   2e-51   
ref|XP_005324967.1|  PREDICTED: tubulin alpha-1C chain                  180   2e-51   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             180   2e-51   
ref|XP_005353993.1|  PREDICTED: tubulin alpha-1C chain isoform X1       179   2e-51   
ref|NP_001292201.1|  tubulin alpha-1 chain                              180   2e-51   
ref|XP_004429037.1|  PREDICTED: tubulin alpha-1A chain                  180   2e-51   
ref|XP_002038709.1|  GM10965                                            179   2e-51   
ref|XP_004032593.1|  PREDICTED: tubulin alpha-3 chain-like              179   2e-51   
ref|XP_005097255.1|  PREDICTED: tubulin alpha-1D chain-like isofo...    178   2e-51   
ref|XP_002752478.1|  PREDICTED: tubulin alpha-1A chain                  180   2e-51   
pdb|1JFF|A  Chain A, Refined Structure Of Alpha-beta Tubulin From...    179   2e-51   
ref|XP_004429035.1|  PREDICTED: tubulin alpha-1C chain isoform 1        179   2e-51   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        179   2e-51   
ref|XP_007566938.1|  PREDICTED: tubulin alpha-1A chain-like             179   2e-51   
ref|XP_003793653.1|  PREDICTED: tubulin alpha-1C chain isoform 2        179   2e-51   
ref|XP_003603670.1|  Tubulin alpha-7 chain                              179   2e-51   
ref|XP_003825879.1|  PREDICTED: tubulin alpha-1C chain isoform X2       179   2e-51   
pdb|2XRP|B  Chain B, Human Doublecortin N-Dc Repeat (1mjd) And Ma...    179   2e-51   
ref|XP_007426281.1|  PREDICTED: tubulin alpha-1A chain isoform X3       179   2e-51   
ref|XP_007032501.1|  Tubulin alpha-2 chain                              179   2e-51   
ref|XP_003215119.2|  PREDICTED: tubulin alpha-1D chain-like             179   2e-51   
emb|CDQ72000.1|  unnamed protein product                                179   2e-51   
ref|XP_004470253.1|  PREDICTED: tubulin alpha-1B chain-like             178   2e-51   
gb|AGV54441.1|  tubulin alpha-2 chain-like protein                      179   2e-51   
dbj|BAE37745.1|  unnamed protein product                                179   2e-51   
gb|AIV98130.1|  tubulin alpha-2                                         179   2e-51   
ref|NP_476772.1|  alpha-Tubulin at 84B                                  179   2e-51   
ref|XP_008542826.1|  PREDICTED: tubulin alpha-3 chain-like              178   2e-51   
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               179   2e-51   
ref|XP_008831083.1|  PREDICTED: tubulin alpha-1B chain-like             179   2e-51   
ref|XP_007073036.1|  PREDICTED: tubulin alpha-1A chain-like             179   2e-51   
ref|XP_005532031.1|  PREDICTED: tubulin alpha-1A chain isoform X1       179   2e-51   
ref|XP_006213088.1|  PREDICTED: tubulin alpha-1C chain-like             179   2e-51   
gb|AEJ38211.1|  tubulin                                                 179   2e-51   
dbj|BAE26417.1|  unnamed protein product                                179   2e-51   
dbj|BAN20459.1|  tubulin alpha chain                                    179   2e-51   
ref|XP_004616768.1|  PREDICTED: tubulin alpha-1B chain isoform X1       179   2e-51   
ref|XP_003726964.1|  PREDICTED: tubulin alpha-1C chain-like isofo...    179   2e-51   
gb|ACQ58153.1|  Tubulin alpha chain                                     179   2e-51   
emb|CDQ56615.1|  unnamed protein product                                178   2e-51   
ref|XP_008317371.1|  PREDICTED: tubulin alpha chain-like                179   2e-51   
gb|AAB08791.1|  alpha tubulin                                           179   2e-51   
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     179   2e-51   
gb|AAH57810.1|  Tubulin, alpha 3d                                       179   2e-51   
ref|XP_003243865.1|  PREDICTED: tubulin alpha-1C chain                  179   2e-51   
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             179   2e-51   
gb|ABD92930.1|  alpha tubulin-2A                                        179   2e-51   
ref|XP_005330562.1|  PREDICTED: tubulin alpha-1D chain-like             179   2e-51   
ref|XP_004071061.1|  PREDICTED: tubulin alpha-1B chain-like isofo...    179   2e-51   
gb|ELT87969.1|  hypothetical protein CAPTEDRAFT_156933                  179   2e-51   
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                179   2e-51   
ref|XP_006472373.1|  PREDICTED: tubulin alpha chain isoform X2          179   2e-51   
ref|XP_005883525.1|  PREDICTED: tubulin alpha-1D chain-like             179   2e-51   
ref|XP_006763432.1|  PREDICTED: tubulin alpha-1D chain-like             179   2e-51   
ref|XP_004076821.1|  PREDICTED: tubulin alpha chain isoform X1          179   2e-51   
ref|XP_004878662.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    179   2e-51   
ref|XP_007566936.1|  PREDICTED: tubulin alpha-1B chain isoform X3       179   2e-51   
ref|XP_006805262.1|  PREDICTED: tubulin alpha chain-like                179   2e-51   
ref|XP_006082613.1|  PREDICTED: tubulin alpha-1D chain-like             179   2e-51   
ref|XP_004427645.1|  PREDICTED: tubulin alpha-1D chain-like isofo...    179   2e-51   
ref|XP_005640747.1|  PREDICTED: tubulin alpha-1B chain                  179   2e-51   
gb|AEE61427.1|  unknown                                                 179   2e-51   
ref|XP_010751708.1|  PREDICTED: tubulin alpha-1A chain-like             178   2e-51   
dbj|BAK63748.1|  tubulin alpha-2 chain                                  179   2e-51   
ref|XP_001928233.1|  PREDICTED: tubulin alpha-1D chain                  179   2e-51   
ref|XP_005889747.1|  PREDICTED: tubulin alpha-1D chain-like             179   3e-51   
ref|XP_010873509.1|  PREDICTED: tubulin alpha-1B chain                  179   3e-51   
gb|ELR55924.1|  hypothetical protein M91_03110                          177   3e-51   



>gb|AAV33983.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33984.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33985.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33986.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33987.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33988.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33989.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33990.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33991.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33992.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33993.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33994.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33995.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33996.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33997.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33998.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33999.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34000.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34001.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34002.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34003.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34004.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34005.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34006.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34007.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34008.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34009.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34010.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34011.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34012.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34013.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34014.1| alpha tubulin, partial [Pinus taeda]
 gb|AHY28653.1| alpha-tubulin, partial [Pinus echinata]
 gb|AHY28654.1| alpha-tubulin, partial [Pinus echinata]
 gb|AHY28655.1| alpha-tubulin, partial [Pinus elliottii]
 gb|AHY28656.1| alpha-tubulin, partial [Pinus elliottii]
 gb|AHY28657.1| alpha-tubulin, partial [Pinus palustris]
 gb|AHY28658.1| alpha-tubulin, partial [Pinus palustris]
 gb|AHY28659.1| alpha-tubulin, partial [Pinus taeda]
 gb|AHY28660.1| alpha-tubulin, partial [Pinus taeda]
Length=95

 Score =   179 bits (455),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ACU24494.1| unknown [Glycine max]
Length=173

 Score =   182 bits (461),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>ref|NP_001275472.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABA46784.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=237

 Score =   184 bits (466),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AAI59362.1| Unknown (protein for MGC:185872) [Xenopus (Silurana) tropicalis]
Length=145

 Score =   179 bits (454),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_001786415.1| predicted protein [Physcomitrella patens]
 gb|EDQ48774.1| predicted protein, partial [Physcomitrella patens]
Length=127

 Score =   179 bits (453),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYR  84



>gb|ACU18775.1| unknown [Glycine max]
Length=202

 Score =   181 bits (459),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYR  84



>gb|AAK51091.1| alpha tubulin [Coffea arabica]
Length=92

 Score =   177 bits (449),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDHTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_005932718.1| PREDICTED: tubulin alpha chain-like [Haplochromis burtoni]
Length=142

 Score =   178 bits (452),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ABE66388.1| alpha-tubulin [Striga asiatica]
Length=206

 Score =   180 bits (457),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_008581337.1| PREDICTED: tubulin alpha chain-like, partial [Galeopterus variegatus]
Length=93

 Score =   176 bits (447),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ERE81184.1| tubulin alpha-1C chain [Cricetulus griseus]
Length=197

 Score =   180 bits (456),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  36   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  95

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  96   HVPRAVFVDLEPTVIDEVRTGTYR  119



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_003793694.1| PREDICTED: tubulin alpha chain-like [Otolemur garnettii]
Length=142

 Score =   178 bits (451),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_005466520.1| PREDICTED: tubulin alpha chain-like [Oreochromis niloticus]
Length=142

 Score =   178 bits (451),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_002609253.1| hypothetical protein BRAFLDRAFT_86837 [Branchiostoma floridae]
 gb|EEN65263.1| hypothetical protein BRAFLDRAFT_86837, partial [Branchiostoma 
floridae]
Length=125

 Score =   177 bits (449),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|XP_006264718.1| PREDICTED: tubulin alpha chain-like [Alligator mississippiensis]
Length=158

 Score =   178 bits (451),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AAW30622.1| unknown, partial [Sus scrofa]
Length=189

 Score =   179 bits (454),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_004019820.1| PREDICTED: tubulin alpha chain-like [Ovis aries]
Length=129

 Score =   177 bits (448),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_003392163.2| PREDICTED: tubulin alpha chain, testis-specific-like, partial 
[Amphimedon queenslandica]
Length=163

 Score =   178 bits (451),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>gb|AAW30623.1| unknown [Sus scrofa]
Length=201

 Score =   179 bits (454),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ABF13307.1| alpha-tubulin [Phaseolus vulgaris]
Length=132

 Score =   177 bits (448),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVR+G YR
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGPYR  84



>ref|XP_008294350.1| PREDICTED: tubulin alpha chain [Stegastes partitus]
Length=202

 Score =   179 bits (454),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AFW67745.1| alpha tubulin4 [Zea mays]
Length=111

 Score =   176 bits (445),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>emb|CAJ26346.1| alpha-tubulin [Platynereis dumerilii]
Length=190

 Score =   178 bits (452),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   186 bits (471),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/86 (99%), Positives = 86/86 (100%), Gaps = 0/86 (0%)
 Frame = +1

Query  118  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  297
            +KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA
Sbjct  3    SKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  62

Query  298  GKHVPRAVFVDLEPTVIDEVRTGTYR  375
            GKHVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  63   GKHVPRAVFVDLEPTVIDEVRTGTYR  88



>ref|XP_005466564.1| PREDICTED: tubulin alpha chain-like [Oreochromis niloticus]
Length=142

 Score =   177 bits (448),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVR+GTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGTYR  84



>ref|XP_004599399.1| PREDICTED: tubulin alpha-1B chain, partial [Ochotona princeps]
Length=231

 Score =   179 bits (455),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_010774362.1| PREDICTED: tubulin alpha-1D chain-like, partial [Notothenia coriiceps]
Length=99

 Score =   175 bits (444),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAG Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGAQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYR  84



>ref|XP_005932717.1| PREDICTED: tubulin alpha-1B chain-like [Haplochromis burtoni]
Length=243

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>dbj|BAE01779.1| unnamed protein product [Macaca fascicularis]
Length=251

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_003979912.1| PREDICTED: tubulin alpha-1D chain-like, partial [Takifugu rubripes]
Length=121

 Score =   176 bits (445),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAG+Q+GNACWELYCLEHGIQPDG MPSDKTVGGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGVQIGNACWELYCLEHGIQPDGLMPSDKTVGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_006056311.1| PREDICTED: tubulin alpha-1B chain-like, partial [Bubalus bubalis]
Length=233

 Score =   179 bits (455),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_009124557.1| PREDICTED: tubulin alpha-6 chain-like isoform X2 [Brassica rapa]
Length=431

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|EPZ32931.1| Tubulin domain-containing protein [Rozella allomycis CSF55]
Length=144

 Score =   176 bits (447),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPR VFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRTVFVDLEPTVVDEVRTGTYR  84



>ref|XP_010726225.1| PREDICTED: tubulin alpha chain-like, partial [Meleagris gallopavo]
Length=181

 Score =   177 bits (450),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +1

Query  94   VCSSNSSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFN  273
            + S   S    RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FN
Sbjct  3    ISSQTPSLTPQRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN  62

Query  274  TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYR  375
            TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  63   TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYR  96



>gb|EYU34086.1| hypothetical protein MIMGU_mgv1a0196711mg, partial [Erythranthe 
guttata]
Length=199

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_005801996.1| PREDICTED: tubulin alpha-1B chain-like, partial [Xiphophorus 
maculatus]
Length=255

 Score =   180 bits (456),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYR  84



>ref|XP_006109205.1| PREDICTED: tubulin alpha-1D chain-like, partial [Myotis lucifugus]
Length=223

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_004704287.1| PREDICTED: tubulin alpha chain-like [Echinops telfairi]
Length=120

 Score =   175 bits (444),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQP+GQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPNGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_004778983.1| PREDICTED: tubulin alpha-1C chain [Mustela putorius furo]
Length=249

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AAG49533.3| alpha tubulin [Glossina morsitans morsitans]
Length=278

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKTVGGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|XP_006264720.1| PREDICTED: tubulin alpha-1C chain [Alligator mississippiensis]
Length=159

 Score =   176 bits (447),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQP GQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPXGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|KDO78780.1| hypothetical protein CISIN_1g037616mg, partial [Citrus sinensis]
Length=383

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_008969760.1| PREDICTED: tubulin alpha chain-like [Pan paniscus]
Length=194

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|XP_006433709.1| hypothetical protein CICLE_v100015521mg, partial [Citrus clementina]
 gb|ESR46949.1| hypothetical protein CICLE_v100015521mg, partial [Citrus clementina]
Length=153

 Score =   176 bits (446),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_008440460.1| PREDICTED: tubulin alpha chain-like isoform X2 [Cucumis melo]
Length=437

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AIK29207.1| putative alpha-tubulin, partial [Cynoglossus semilaevis]
Length=270

 Score =   180 bits (456),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_006895063.1| PREDICTED: tubulin alpha-1B chain-like [Elephantulus edwardii]
Length=249

 Score =   179 bits (454),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDE+RTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYR  84



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>ref|XP_005906298.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-1 chain-like [Bos 
mutus]
Length=202

 Score =   177 bits (450),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSE GAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSEMGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_011366648.1| PREDICTED: tubulin alpha-1C chain-like [Pteropus vampyrus]
Length=301

 Score =   181 bits (458),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_008949708.1| PREDICTED: tubulin alpha-1A chain-like [Pan paniscus]
Length=218

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_007426287.1| PREDICTED: tubulin alpha-1C chain [Python bivittatus]
Length=256

 Score =   179 bits (454),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFIDLEPTVIDEVRTGTYR  84



>gb|AIJ27191.1| alpha-tubulin 1a, partial [Mytilus galloprovincialis]
Length=271

 Score =   179 bits (455),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|XP_009107245.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Brassica rapa]
Length=459

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|EDL87015.1| rCG50513, isoform CRA_a [Rattus norvegicus]
Length=319

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_008172101.1| PREDICTED: tubulin alpha-1B chain [Chrysemys picta bellii]
Length=279

 Score =   179 bits (455),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_004644630.1| PREDICTED: tubulin alpha-3 chain-like [Octodon degus]
Length=182

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTSGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|XP_006466395.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Citrus sinensis]
Length=447

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ABO33166.1| alpha tubulin a2 [Mesenchytraeus solifugus]
Length=241

 Score =   178 bits (452),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|XP_005801995.1| PREDICTED: tubulin alpha-1A chain-like, partial [Xiphophorus 
maculatus]
Length=256

 Score =   179 bits (453),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVR+GTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGTYR  84



>ref|XP_010531322.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Tarenaya hassleriana]
Length=454

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_007663362.1| PREDICTED: tubulin alpha chain-like, partial [Ornithorhynchus 
anatinus]
Length=144

 Score =   175 bits (444),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 87/89 (98%), Gaps = 1/89 (1%)
 Frame = +1

Query  109  SSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSE  288
            +SF + RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSE
Sbjct  3    TSFPQ-RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSE  61

Query  289  TGAGKHVPRAVFVDLEPTVIDEVRTGTYR  375
            TGAGKHVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  62   TGAGKHVPRAVFVDLEPTVIDEVRTGTYR  90



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYR  84



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>tpg|DAA51110.1| TPA: alpha-tubulin, partial [Zea mays]
 tpg|DAA51116.1| TPA: alpha-tubulin, partial [Zea mays]
Length=240

 Score =   178 bits (452),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_008575749.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-3E chain [Galeopterus 
variegatus]
Length=308

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|XP_008317242.1| PREDICTED: tubulin alpha-1C chain-like, partial [Cynoglossus 
semilaevis]
Length=307

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_008475351.1| PREDICTED: tubulin alpha-1 chain-like [Diaphorina citri]
Length=307

 Score =   180 bits (456),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKTVGGGDD+FNTFFSETG+GK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGSGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYR  84



>ref|XP_010557536.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Tarenaya hassleriana]
Length=455

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_005365400.1| PREDICTED: tubulin alpha-3 chain-like [Microtus ochrogaster]
Length=215

 Score =   177 bits (449),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_010995722.1| PREDICTED: tubulin alpha-1B chain, partial [Camelus dromedarius]
Length=339

 Score =   181 bits (458),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|KGL81705.1| Tubulin alpha-1C chain, partial [Tinamus guttatus]
Length=239

 Score =   178 bits (451),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +1

Query  127  RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKH  306
            RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGKH
Sbjct  1    RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH  60

Query  307  VPRAVFVDLEPTVIDEVRTGTYR  375
            VPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   VPRAVFVDLEPTVIDEVRTGTYR  83



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>emb|CBI25125.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   182 bits (461),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_006264719.1| PREDICTED: tubulin alpha-1A chain [Alligator mississippiensis]
Length=340

 Score =   181 bits (458),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AAT77076.1| alpha tubulin [Oryza sativa Japonica Group]
Length=128

 Score =   174 bits (441),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGCYR  84



>gb|ABO47737.1| alpha-tubulin [Gossypium hirsutum]
Length=451

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_003770912.1| PREDICTED: tubulin alpha-1C chain [Sarcophilus harrisii]
Length=334

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_006601463.1| PREDICTED: tubulin alpha-3 chain-like [Glycine max]
Length=432

 Score =   183 bits (464),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>ref|XP_003804211.2| PREDICTED: tubulin alpha-3E chain [Pan paniscus]
Length=145

 Score =   174 bits (442),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+ GGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTISGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|NP_849388.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 dbj|BAH19475.1| AT4G14960 [Arabidopsis thaliana]
 gb|AEE83529.1| tubulin alpha-6 chain [Arabidopsis thaliana]
Length=427

 Score =   182 bits (463),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AAI53472.1| Unknown (protein for MGC:173992) [Danio rerio]
Length=220

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSD+T+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDETIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ELK23510.1| Tubulin alpha chain [Myotis davidii]
Length=120

 Score =   173 bits (439),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQ G+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQGGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVR GTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRNGTYR  84



>gb|AAX21196.1| putative alpha-tubulin [Solanum betaceum]
Length=204

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AAC97930.1| alpha tubulin, partial [Notothenia coriiceps]
Length=168

 Score =   175 bits (443),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDG+MPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGRMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGIYR  84



>gb|AHJ80818.1| Tua1, partial [Eragrostis tef]
Length=291

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ETE59910.1| Tubulin alpha-1A chain, partial [Ophiophagus hannah]
Length=310

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +1

Query  121  KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAG  300
            K+RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAG
Sbjct  124  KLRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAG  183

Query  301  KHVPRAVFVDLEPTVIDEVRTGTYR  375
            KHVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  184  KHVPRAVFVDLEPTVIDEVRTGTYR  208


 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_006821303.1| PREDICTED: tubulin alpha-1 chain-like [Saccoglossus kowalevskii]
Length=190

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +1

Query  121  KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAG  300
            + RECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAG
Sbjct  12   RRRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAG  71

Query  301  KHVPRAVFVDLEPTVIDEVRTGTYR  375
            KHVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  72   KHVPRAVFVDLEPTVVDEVRTGTYR  96



>gb|AAH33064.1| TUBA1C protein [Homo sapiens]
Length=325

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>gb|KHN01709.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>ref|XP_003524707.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Glycine max]
 gb|KHN47565.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_004617224.1| PREDICTED: tubulin alpha-1D chain-like [Sorex araneus]
Length=200

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            +RECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  20   VRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  79

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  80   HVPRAVFVDLEPTVIDEVRTGTYR  103



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYR  84



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYR  84



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYR  84



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYR  84



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYR  84



>gb|ABS57456.1| alpha-tubulin [Heliconius melpomene]
Length=221

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMP+DKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +1

Query  106  NSSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFS  285
             S+  KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFS
Sbjct  45   QSNHEKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFS  104

Query  286  ETGAGKHVPRAVFVDLEPTVIDEVRTGTYR  375
            ETG+GKHVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  105  ETGSGKHVPRAVFVDLEPTVIDEVRTGTYR  134



>gb|AII97815.1| BLTX443 [Nephila pilipes]
Length=274

 Score =   178 bits (451),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+H+GQAG+QVGNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAV+VDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVYVDLEPTVVDEVRTGTYR  84



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYR  84



>ref|XP_005139691.1| PREDICTED: tubulin alpha-1B chain-like, partial [Melopsittacus 
undulatus]
Length=407

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +1

Query  121  KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAG  300
            K+RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAG
Sbjct  66   KLRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAG  125

Query  301  KHVPRAVFVDLEPTVIDEVRTGTYR  375
            KHVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  126  KHVPRAVFVDLEPTVIDEVRTGTYR  150



>gb|EDL87016.1| rCG50513, isoform CRA_b [Rattus norvegicus]
Length=325

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            +RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  7    LRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  66

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  67   HVPRAVFVDLEPTVIDEVRTGTYR  90



>ref|XP_008236966.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=427

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_008412910.1| PREDICTED: tubulin alpha-1B chain-like [Poecilia reticulata]
Length=381

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPNDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>ref|XP_003976815.1| PREDICTED: tubulin alpha-1 chain-like, partial [Takifugu rubripes]
Length=180

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDG+MPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGRMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEP+VIDEVR+GTYR
Sbjct  61   HVPRAVFVDLEPSVIDEVRSGTYR  84



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYR  84



>ref|XP_006581475.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=466

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYR  84



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVF DLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFADLEPTVIDEVRTGTYR  84



>gb|AEM36066.1| alpha tubulin [Mytilus edulis]
Length=99

 Score =   172 bits (436),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHG QPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGTQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+D VRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDXVRTGTYR  84



>gb|AAW30624.1| unknown [Sus scrofa]
Length=193

 Score =   175 bits (444),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FN FFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNAFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_006579968.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Glycine max]
Length=462

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>ref|XP_010500556.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
Length=462

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_008372962.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=438

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AAH21564.1| TUBA1B protein [Homo sapiens]
 gb|AIC63288.1| TUBA1B, partial [synthetic construct]
Length=335

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_004560331.1| PREDICTED: tubulin alpha-1A chain-like [Maylandia zebra]
Length=282

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_005324966.1| PREDICTED: tubulin alpha-1B chain [Ictidomys tridecemlineatus]
Length=294

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AFV46219.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=440

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/86 (97%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +1

Query  118  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  297
            AKMRECISIHIG+AGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGA
Sbjct  36   AKMRECISIHIGRAGIQVGNACWELYCLEHGIQPDGQMPGDHTVGGGDDAFNTFFSETGA  95

Query  298  GKHVPRAVFVDLEPTVIDEVRTGTYR  375
            GKHVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  96   GKHVPRAVFVDLEPTVIDEVRTGTYR  121



>gb|AEF59080.1| alpha tubulin-like protein [Phragmatopoma lapidosa]
Length=301

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GN CWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNGCWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|XP_003979092.1| PREDICTED: tubulin alpha-1B chain-like, partial [Takifugu rubripes]
Length=236

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +1

Query  127  RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKH  306
            RECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGKH
Sbjct  47   RECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGKH  106

Query  307  VPRAVFVDLEPTVIDEVRTGTYR  375
            VPRAVFVDLEPTVIDEVRTGTYR
Sbjct  107  VPRAVFVDLEPTVIDEVRTGTYR  129



>ref|XP_002110664.1| alpha tubulin [Trichoplax adhaerens]
 gb|EDV26668.1| alpha tubulin [Trichoplax adhaerens]
Length=265

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+G GDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGYGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|XP_007068754.1| PREDICTED: tubulin alpha-1D chain-like [Chelonia mydas]
Length=234

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +1

Query  127  RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKH  306
            RECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGKH
Sbjct  41   RECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH  100

Query  307  VPRAVFVDLEPTVIDEVRTGTYR  375
            VPRAVFVDLEPTVIDEVRTGTYR
Sbjct  101  VPRAVFVDLEPTVIDEVRTGTYR  123



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGT+R
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTFR  84



>gb|AGE09583.1| TUA1-like protein [Eucalyptus cladocalyx]
 gb|KCW68570.1| hypothetical protein EUGRSUZ_F02183 [Eucalyptus grandis]
Length=420

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_005406777.1| PREDICTED: tubulin alpha-1A chain-like [Chinchilla lanigera]
Length=287

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +1

Query  118  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  297
            ++ RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGA
Sbjct  4    SRPRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGA  63

Query  298  GKHVPRAVFVDLEPTVIDEVRTGTYR  375
            GKHVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  64   GKHVPRAVFVDLEPTVIDEVRTGTYR  89



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYR  84



>ref|XP_007248487.1| PREDICTED: tubulin alpha-1B chain-like, partial [Astyanax mexicanus]
Length=384

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYR  84



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGSGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_004874971.1| PREDICTED: tubulin alpha-3 chain-like [Heterocephalus glaber]
Length=299

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTTGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_004817225.1| PREDICTED: tubulin alpha-3 chain-like [Mustela putorius furo]
Length=376

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGN+CWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDE+RTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYR  84



>gb|KFO33466.1| Tubulin alpha-1C chain [Fukomys damarensis]
Length=343

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYR  84



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGMYR  84



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_005452428.1| PREDICTED: tubulin alpha-1A chain-like [Oreochromis niloticus]
Length=292

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MREC+S+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECLSVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYR  84



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYR  84



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGN+CWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYR  84



>ref|XP_007073037.1| PREDICTED: tubulin alpha-1C chain [Panthera tigris altaica]
Length=333

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_011475942.1| PREDICTED: tubulin alpha chain-like [Oryzias latipes]
Length=314

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_002763662.3| PREDICTED: tubulin alpha chain-like, partial [Callithrix jacchus]
Length=178

 Score =   174 bits (441),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  100  SSNSSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTF  279
            SS        ECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTF
Sbjct  40   SSPRGSGPRHECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTF  99

Query  280  FSETGAGKHVPRAVFVDLEPTVIDEVRTGTYR  375
            FSETGAGKHVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  100  FSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR  131



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            +VPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   YVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPADKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYR  84



>ref|XP_005896455.1| PREDICTED: tubulin alpha-1C chain-like [Bos mutus]
Length=470

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  100  SSNSSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTF  279
            S  + F+  RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTF
Sbjct  10   SQQTPFSPTRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTF  69

Query  280  FSETGAGKHVPRAVFVDLEPTVIDEVRTGTYR  375
            FSETGAGKHVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  70   FSETGAGKHVPRAVFVDLEPTVIDEVRTGTYR  101



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_006974484.1| PREDICTED: tubulin alpha-1A chain-like [Peromyscus maniculatus 
bairdii]
Length=327

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|AAO23139.1| alpha tubulin [Populus tremuloides]
Length=451

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYR  84



>ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa]
Length=450

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_010461854.1| PREDICTED: tubulin alpha-6 chain-like [Camelina sativa]
Length=450

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|EKC22339.1| Tubulin alpha chain [Crassostrea gigas]
Length=294

 Score =   177 bits (450),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYR  84



>gb|KIY93466.1| Tubulin alpha-1 chain [Monoraphidium neglectum]
Length=193

 Score =   174 bits (441),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPR +F+DLEPTV+DEVRTGTYR
Sbjct  61   HVPRCIFLDLEPTVVDEVRTGTYR  84



>ref|XP_002989721.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
 ref|XP_002993678.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ05267.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ09198.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
Length=451

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPR+VF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYR  84



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGQYR  84



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDHTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYR  84



>ref|XP_002970006.1| hypothetical protein SELMODRAFT_231415 [Selaginella moellendorffii]
 gb|EFJ29130.1| hypothetical protein SELMODRAFT_231415 [Selaginella moellendorffii]
Length=396

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVG+ACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGSACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPR+VF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYR  84



>ref|XP_002989731.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
 ref|XP_002991763.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ07167.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ09208.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
Length=451

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPR+VF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYR  84



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>gb|EHB00536.1| Tubulin alpha-1C chain [Heterocephalus glaber]
Length=437

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +1

Query  112  SFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSET  291
            S A MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSET
Sbjct  21   SRAIMRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSET  80

Query  292  GAGKHVPRAVFVDLEPTVIDEVRTGTYR  375
            GAGKHVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  81   GAGKHVPRAVFVDLEPTVIDEVRTGTYR  108



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVF+DLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYR  84



>gb|ETN59126.1| tubulin alpha chain [Anopheles darlingi]
Length=364

 Score =   179 bits (454),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYR  84



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVR GTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRPGTYR  84



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>dbj|BAJ07366.1| alpha-tubulin [Hydatigera taeniaeformis]
Length=162

 Score =   173 bits (438),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETG+GK
Sbjct  1    MRECISIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGSGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTV+DEVR GTYR
Sbjct  61   HVPRAVFVDLEPTVVDEVRCGTYR  84



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRA+FVDLEPTVIDEVRTG YR
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYR  84



>ref|XP_010751704.1| PREDICTED: tubulin alpha chain [Larimichthys crocea]
Length=349

 Score =   179 bits (453),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYR  375
            HVPRAVFVDLEPTVIDEVRTGTYR
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYR  84



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553125100440