BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF021O05

Length=563
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001240863.1|  protein kinase APK1A, chloroplastic-like           160   2e-43   Glycine max [soybeans]
ref|XP_007150326.1|  hypothetical protein PHAVU_005G144200g             158   1e-42   Phaseolus vulgaris [French bean]
ref|NP_001234409.1|  protein kinase 1b                                  155   1e-41   
ref|XP_011035314.1|  PREDICTED: protein kinase APK1A, chloroplast...    154   3e-41   Populus euphratica
emb|CDP09060.1|  unnamed protein product                                154   4e-41   Coffea canephora [robusta coffee]
gb|KHN33381.1|  Protein kinase APK1A, chloroplastic                     154   4e-41   Glycine soja [wild soybean]
ref|NP_001242670.1|  uncharacterized protein LOC100798404               154   4e-41   Glycine max [soybeans]
gb|KDO72843.1|  hypothetical protein CISIN_1g046897mg                   153   6e-41   Citrus sinensis [apfelsine]
ref|XP_006424836.1|  hypothetical protein CICLE_v10028570mg             153   7e-41   Citrus clementina [clementine]
ref|XP_007016405.1|  Kinase superfamily protein isoform 3               152   8e-41   
ref|XP_007016404.1|  Kinase superfamily protein isoform 2               150   2e-40   
ref|XP_009590400.1|  PREDICTED: protein kinase APK1A, chloroplastic     152   2e-40   
ref|XP_004487006.1|  PREDICTED: protein kinase APK1B, chloroplast...    152   2e-40   Cicer arietinum [garbanzo]
ref|XP_011035309.1|  PREDICTED: protein kinase APK1A, chloroplast...    152   2e-40   Populus euphratica
ref|XP_004487002.1|  PREDICTED: protein kinase APK1B, chloroplast...    152   4e-40   
ref|XP_009774717.1|  PREDICTED: protein kinase APK1A, chloroplast...    151   4e-40   Nicotiana sylvestris
ref|XP_002299870.1|  Protein kinase capable of phosphorylating ty...    151   5e-40   Populus trichocarpa [western balsam poplar]
ref|XP_007016403.1|  Kinase 1B isoform 1                                151   5e-40   
emb|CBI16124.3|  unnamed protein product                                150   6e-40   Vitis vinifera
ref|XP_002283646.2|  PREDICTED: protein kinase APK1A, chloroplastic     150   1e-39   Vitis vinifera
ref|XP_010685751.1|  PREDICTED: protein kinase APK1B, chloroplast...    149   2e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW88942.1|  hypothetical protein EUGRSUZ_A01268                     146   4e-39   Eucalyptus grandis [rose gum]
ref|XP_004142761.1|  PREDICTED: protein kinase APK1A, chloroplast...    147   1e-38   Cucumis sativus [cucumbers]
ref|XP_011042707.1|  PREDICTED: protein kinase APK1A, chloroplastic     147   1e-38   Populus euphratica
dbj|BAE71262.1|  putative protein kinase APK1A                          147   1e-38   Trifolium pratense [peavine clover]
ref|XP_008458866.1|  PREDICTED: protein kinase APK1A, chloroplastic     147   2e-38   Cucumis melo [Oriental melon]
ref|XP_010047703.1|  PREDICTED: probable serine/threonine-protein...    147   2e-38   Eucalyptus grandis [rose gum]
ref|XP_010106485.1|  Protein kinase APK1A                               147   2e-38   Morus notabilis
ref|XP_007205264.1|  hypothetical protein PRUPE_ppa006390mg             147   2e-38   
ref|XP_008223637.1|  PREDICTED: protein kinase APK1A, chloroplast...    146   3e-38   Prunus mume [ume]
gb|KHG20116.1|  Protein kinase APK1B, chloroplastic -like protein       146   3e-38   Gossypium arboreum [tree cotton]
ref|XP_010487664.1|  PREDICTED: protein kinase APK1A, chloroplastic     146   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010256925.1|  PREDICTED: protein kinase APK1A, chloroplastic     146   4e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010264446.1|  PREDICTED: protein kinase APK1A, chloroplastic     146   4e-38   Nelumbo nucifera [Indian lotus]
gb|KCW88940.1|  hypothetical protein EUGRSUZ_A01268                     145   5e-38   Eucalyptus grandis [rose gum]
gb|KDP20446.1|  hypothetical protein JCGZ_05291                         145   5e-38   Jatropha curcas
ref|XP_010678048.1|  PREDICTED: probable serine/threonine-protein...    144   2e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010457947.1|  PREDICTED: protein kinase APK1A, chloroplast...    144   2e-37   Camelina sativa [gold-of-pleasure]
gb|KJB55870.1|  hypothetical protein B456_009G099000                    144   3e-37   Gossypium raimondii
gb|KJB55871.1|  hypothetical protein B456_009G099000                    144   3e-37   Gossypium raimondii
ref|XP_008464124.1|  PREDICTED: protein kinase APK1A, chloroplast...    143   3e-37   Cucumis melo [Oriental melon]
ref|XP_010685750.1|  PREDICTED: protein kinase APK1B, chloroplast...    143   4e-37   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX95754.1|  BnaC03g26350D                                          142   8e-37   
ref|XP_010475518.1|  PREDICTED: protein kinase APK1A, chloroplast...    142   9e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004143118.1|  PREDICTED: protein kinase APK1A, chloroplast...    142   1e-36   
ref|XP_004165801.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    142   1e-36   
dbj|BAD12263.1|  protein kinase                                         142   1e-36   Brassica rapa
ref|XP_006307674.1|  hypothetical protein CARUB_v10009302mg             142   1e-36   
ref|XP_009124367.1|  PREDICTED: protein kinase APK1B, chloroplast...    142   2e-36   Brassica rapa
ref|XP_002314178.2|  Protein kinase capable of phosphorylating ty...    141   2e-36   
emb|CDX83305.1|  BnaA03g22010D                                          141   2e-36   
ref|XP_010678047.1|  PREDICTED: probable serine/threonine-protein...    141   3e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG10966.1|  Protein kinase APK1B, chloroplastic -like protein       141   3e-36   Gossypium arboreum [tree cotton]
ref|XP_007141880.1|  hypothetical protein PHAVU_008G233400g             140   3e-36   Phaseolus vulgaris [French bean]
ref|XP_008357182.1|  PREDICTED: protein kinase APK1A, chloroplastic     140   5e-36   
emb|CDX77220.1|  BnaC04g40150D                                          140   8e-36   
ref|XP_004236745.1|  PREDICTED: protein kinase APK1A, chloroplastic     139   8e-36   Solanum lycopersicum
emb|CDY31741.1|  BnaA04g16770D                                          140   8e-36   Brassica napus [oilseed rape]
gb|KEH39440.1|  kinase 1B                                               139   9e-36   Medicago truncatula
gb|KHF99777.1|  Protein kinase APK1B, chloroplastic -like protein       139   9e-36   Gossypium arboreum [tree cotton]
gb|KDP35639.1|  hypothetical protein JCGZ_09077                         139   9e-36   Jatropha curcas
ref|XP_010510562.1|  PREDICTED: protein kinase APK1B, chloroplast...    139   9e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010414461.1|  PREDICTED: protein kinase APK1B, chloroplast...    139   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_011089469.1|  PREDICTED: protein kinase APK1B, chloroplastic     139   1e-35   Sesamum indicum [beniseed]
ref|XP_010414460.1|  PREDICTED: protein kinase APK1B, chloroplast...    139   1e-35   Camelina sativa [gold-of-pleasure]
gb|KJB83756.1|  hypothetical protein B456_013G263600                    139   1e-35   Gossypium raimondii
gb|AGP76187.1|  MLPK                                                    139   1e-35   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010510560.1|  PREDICTED: protein kinase APK1B, chloroplast...    139   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_004294513.1|  PREDICTED: protein kinase APK1A, chloroplastic     139   2e-35   Fragaria vesca subsp. vesca
emb|CDY06715.1|  BnaA10g04940D                                          139   2e-35   
ref|XP_010521843.1|  PREDICTED: protein kinase APK1A, chloroplast...    139   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_009133856.1|  PREDICTED: protein kinase APK1B, chloroplast...    139   2e-35   Brassica rapa
ref|XP_009118950.1|  PREDICTED: protein kinase APK1A, chloroplast...    139   2e-35   Brassica rapa
ref|XP_006294292.1|  hypothetical protein CARUB_v10023308mg             139   2e-35   Capsella rubella
ref|XP_010470020.1|  PREDICTED: protein kinase APK1B, chloroplast...    138   3e-35   Camelina sativa [gold-of-pleasure]
emb|CDY09904.1|  BnaC08g45470D                                          138   3e-35   Brassica napus [oilseed rape]
gb|KJB20070.1|  hypothetical protein B456_003G131600                    138   3e-35   Gossypium raimondii
gb|AIU96237.1|  serine/threonine-protein kinase BIK1                    133   3e-35   Nicotiana benthamiana
ref|XP_003519344.1|  PREDICTED: protein kinase APK1A, chloroplast...    138   4e-35   Glycine max [soybeans]
gb|ACU19261.1|  unknown                                                 137   4e-35   Glycine max [soybeans]
emb|CDX95143.1|  BnaC05g05280D                                          138   4e-35   
ref|XP_010470019.1|  PREDICTED: protein kinase APK1B, chloroplast...    138   4e-35   Camelina sativa [gold-of-pleasure]
ref|XP_003544233.1|  PREDICTED: protein kinase APK1A, chloroplast...    137   5e-35   Glycine max [soybeans]
ref|XP_006409926.1|  hypothetical protein EUTSA_v10016722mg             137   5e-35   Eutrema salsugineum [saltwater cress]
ref|XP_011094865.1|  PREDICTED: protein kinase APK1A, chloroplastic     137   5e-35   Sesamum indicum [beniseed]
ref|XP_010554610.1|  PREDICTED: serine/threonine-protein kinase B...    137   5e-35   Tarenaya hassleriana [spider flower]
ref|XP_002892407.1|  hypothetical protein ARALYDRAFT_470784             137   6e-35   
dbj|BAC43185.1|  putative protein kinase                                133   6e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003616403.1|  Serine/threonine protein kinase                    137   7e-35   Medicago truncatula
ref|XP_002266032.1|  PREDICTED: probable serine/threonine-protein...    137   8e-35   Vitis vinifera
ref|XP_010557255.1|  PREDICTED: protein kinase APK1A, chloroplast...    137   9e-35   Tarenaya hassleriana [spider flower]
ref|XP_010557252.1|  PREDICTED: protein kinase APK1A, chloroplast...    137   1e-34   
ref|XP_009759469.1|  PREDICTED: protein kinase APK1A, chloroplast...    136   1e-34   Nicotiana sylvestris
ref|XP_009626085.1|  PREDICTED: protein kinase APK1A, chloroplastic     136   1e-34   Nicotiana tomentosiformis
ref|XP_006339025.1|  PREDICTED: protein kinase APK1A, chloroplast...    136   1e-34   Solanum tuberosum [potatoes]
ref|NP_172237.1|  protein kinase APK1A                                  136   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002533148.1|  Protein kinase APK1B, chloroplast precursor,...    136   2e-34   Ricinus communis
ref|XP_010542648.1|  PREDICTED: protein kinase APK1A, chloroplast...    133   2e-34   Tarenaya hassleriana [spider flower]
ref|XP_009364395.1|  PREDICTED: protein kinase APK1A, chloroplast...    136   2e-34   Pyrus x bretschneideri [bai li]
gb|KJB36716.1|  hypothetical protein B456_006G172600                    134   2e-34   Gossypium raimondii
ref|NP_001031440.1|  protein kinase APK1B                               136   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006365700.1|  PREDICTED: protein kinase APK1A, chloroplast...    135   2e-34   Solanum tuberosum [potatoes]
ref|XP_009118427.1|  PREDICTED: protein kinase APK1A, chloroplastic     135   3e-34   Brassica rapa
ref|XP_002322956.2|  hypothetical protein POPTR_0016s11410g             135   3e-34   
ref|XP_011011764.1|  PREDICTED: protein kinase APK1B, chloroplast...    133   3e-34   Populus euphratica
ref|XP_004249535.1|  PREDICTED: probable serine/threonine-protein...    135   4e-34   Solanum lycopersicum
ref|XP_010557253.1|  PREDICTED: protein kinase APK1A, chloroplast...    135   5e-34   
gb|AAF79545.1|AC022464_3  F22G5.5                                       135   6e-34   Arabidopsis thaliana [mouse-ear cress]
gb|EYU41728.1|  hypothetical protein MIMGU_mgv1a007413mg                135   6e-34   Erythranthe guttata [common monkey flower]
gb|KJB76052.1|  hypothetical protein B456_012G070600                    134   6e-34   Gossypium raimondii
ref|XP_010542646.1|  PREDICTED: protein kinase APK1A, chloroplast...    134   8e-34   Tarenaya hassleriana [spider flower]
gb|KJB36715.1|  hypothetical protein B456_006G172600                    134   9e-34   Gossypium raimondii
ref|XP_010043547.1|  PREDICTED: protein kinase APK1A, chloroplast...    134   1e-33   Eucalyptus grandis [rose gum]
ref|XP_009353659.1|  PREDICTED: protein kinase APK1A, chloroplast...    134   1e-33   Pyrus x bretschneideri [bai li]
gb|KHG05340.1|  Protein kinase APK1A, chloroplastic -like protein       134   1e-33   Gossypium arboreum [tree cotton]
ref|NP_001031439.1|  protein kinase APK1B                               134   1e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KJB76051.1|  hypothetical protein B456_012G070600                    134   1e-33   Gossypium raimondii
ref|XP_006417790.1|  hypothetical protein EUTSA_v10007756mg             133   2e-33   Eutrema salsugineum [saltwater cress]
ref|XP_004490898.1|  PREDICTED: protein kinase APK1A, chloroplast...    132   3e-33   Cicer arietinum [garbanzo]
ref|XP_009610451.1|  PREDICTED: probable serine/threonine-protein...    133   3e-33   
ref|XP_011011763.1|  PREDICTED: probable serine/threonine-protein...    132   3e-33   Populus euphratica
emb|CDP06608.1|  unnamed protein product                                132   4e-33   Coffea canephora [robusta coffee]
ref|XP_010543301.1|  PREDICTED: probable serine/threonine-protein...    132   4e-33   Tarenaya hassleriana [spider flower]
gb|ACJ84452.1|  unknown                                                 129   5e-33   Medicago truncatula
emb|CDP00097.1|  unnamed protein product                                131   9e-33   Coffea canephora [robusta coffee]
ref|XP_009610452.1|  PREDICTED: probable serine/threonine-protein...    131   1e-32   
gb|ACG32116.1|  protein kinase APK1B                                    131   1e-32   Zea mays [maize]
ref|XP_009772470.1|  PREDICTED: probable serine/threonine-protein...    131   1e-32   Nicotiana sylvestris
ref|XP_004487004.1|  PREDICTED: protein kinase APK1B, chloroplast...    131   1e-32   
ref|XP_009404596.1|  PREDICTED: protein kinase APK1A, chloroplast...    131   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK44181.1|  unknown                                                 130   2e-32   Lotus japonicus
gb|KEH34697.1|  tyrosine kinase family protein                          130   2e-32   Medicago truncatula
gb|KDO51148.1|  hypothetical protein CISIN_1g015909mg                   130   3e-32   Citrus sinensis [apfelsine]
gb|KEH34700.1|  tyrosine kinase family protein                          130   3e-32   Medicago truncatula
ref|XP_006429091.1|  hypothetical protein CICLE_v10011895mg             129   4e-32   Citrus clementina [clementine]
gb|KJB20072.1|  hypothetical protein B456_003G131600                    129   4e-32   Gossypium raimondii
ref|NP_001145874.1|  uncharacterized protein LOC100279389               129   4e-32   Zea mays [maize]
ref|XP_009588344.1|  PREDICTED: probable serine/threonine-protein...    129   5e-32   Nicotiana tomentosiformis
ref|XP_010047712.1|  PREDICTED: protein kinase APK1B, chloroplast...    129   5e-32   Eucalyptus grandis [rose gum]
ref|XP_010922319.1|  PREDICTED: probable serine/threonine-protein...    129   5e-32   Elaeis guineensis
gb|ACF87678.1|  unknown                                                 129   5e-32   Zea mays [maize]
ref|XP_008240890.1|  PREDICTED: probable serine/threonine-protein...    129   6e-32   Prunus mume [ume]
ref|XP_010534501.1|  PREDICTED: serine/threonine-protein kinase B...    129   6e-32   Tarenaya hassleriana [spider flower]
ref|XP_009140954.1|  PREDICTED: protein kinase APK1B, chloroplastic     129   8e-32   Brassica rapa
ref|XP_011077648.1|  PREDICTED: protein kinase APK1A, chloroplast...    129   8e-32   Sesamum indicum [beniseed]
ref|XP_006846202.1|  hypothetical protein AMTR_s00012p00221000          129   8e-32   Amborella trichopoda
ref|XP_007009313.1|  Kinase superfamily protein isoform 2               127   1e-31   
gb|KHN47889.1|  Protein kinase APK1B, chloroplastic                     128   1e-31   Glycine soja [wild soybean]
ref|XP_003522100.1|  PREDICTED: protein kinase APK1B, chloroplast...    128   1e-31   Glycine max [soybeans]
ref|XP_007009312.1|  Kinase superfamily protein isoform 1               128   2e-31   Theobroma cacao [chocolate]
ref|XP_011091519.1|  PREDICTED: probable serine/threonine-protein...    127   2e-31   Sesamum indicum [beniseed]
gb|KDP44953.1|  hypothetical protein JCGZ_01453                         128   2e-31   Jatropha curcas
ref|XP_009766459.1|  PREDICTED: probable serine/threonine-protein...    127   2e-31   Nicotiana sylvestris
ref|XP_004239839.1|  PREDICTED: probable serine/threonine-protein...    127   3e-31   Solanum lycopersicum
ref|XP_008784589.1|  PREDICTED: protein kinase APK1A, chloroplast...    127   4e-31   Phoenix dactylifera
ref|XP_010558327.1|  PREDICTED: probable serine/threonine-protein...    127   4e-31   
ref|XP_010030960.1|  PREDICTED: protein kinase APK1A, chloroplast...    126   5e-31   Eucalyptus grandis [rose gum]
ref|XP_004981243.1|  PREDICTED: protein kinase APK1B, chloroplast...    126   6e-31   Setaria italica
ref|XP_011027201.1|  PREDICTED: protein kinase APK1A, chloroplastic     126   7e-31   Populus euphratica
ref|XP_010920578.1|  PREDICTED: protein kinase APK1B, chloroplast...    126   7e-31   Elaeis guineensis
ref|XP_007027015.1|  Kinase superfamily protein                         126   8e-31   
ref|XP_009414323.1|  PREDICTED: probable serine/threonine-protein...    126   9e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010111458.1|  putative serine/threonine-protein kinase NAK       125   1e-30   Morus notabilis
ref|XP_002316286.1|  hypothetical protein POPTR_0010s21090g             125   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_009143298.1|  PREDICTED: serine/threonine-protein kinase B...    125   2e-30   Brassica rapa
gb|KHG15912.1|  Protein kinase APK1A, chloroplastic                     125   2e-30   Gossypium arboreum [tree cotton]
ref|XP_010490647.1|  PREDICTED: probable serine/threonine-protein...    124   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006573305.1|  PREDICTED: protein kinase APK1B, chloroplast...    124   3e-30   Glycine max [soybeans]
ref|XP_011030315.1|  PREDICTED: protein kinase APK1A, chloroplast...    124   4e-30   Populus euphratica
gb|AAA18853.1|  protein kinase                                          124   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195849.1|  putative serine/threonine-protein kinase NAK          124   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010531641.1|  PREDICTED: serine/threonine-protein kinase B...    124   4e-30   Tarenaya hassleriana [spider flower]
ref|XP_008784588.1|  PREDICTED: protein kinase APK1A, chloroplast...    124   4e-30   Phoenix dactylifera
ref|NP_001274846.1|  protein kinase APK1B, chloroplastic-like           124   4e-30   Solanum tuberosum [potatoes]
emb|CDY55560.1|  BnaA03g54910D                                          124   4e-30   Brassica napus [oilseed rape]
ref|XP_009130691.1|  PREDICTED: probable serine/threonine-protein...    124   4e-30   Brassica rapa
ref|XP_010937617.1|  PREDICTED: protein kinase APK1A, chloroplast...    124   5e-30   Elaeis guineensis
gb|KJB73944.1|  hypothetical protein B456_011G261900                    124   5e-30   Gossypium raimondii
ref|XP_002873046.1|  hypothetical protein ARALYDRAFT_487008             124   5e-30   
ref|XP_008371735.1|  PREDICTED: probable serine/threonine-protein...    124   6e-30   Malus domestica [apple tree]
ref|NP_001288898.1|  protein kinase APK1B, chloroplastic-like           124   6e-30   Brassica rapa
ref|XP_010470021.1|  PREDICTED: protein kinase APK1B, chloroplast...    124   6e-30   
ref|XP_010507635.1|  PREDICTED: serine/threonine-protein kinase B...    119   7e-30   
ref|XP_009357737.1|  PREDICTED: probable serine/threonine-protein...    123   7e-30   Pyrus x bretschneideri [bai li]
ref|XP_006379595.1|  hypothetical protein POPTR_0008s05650g             123   9e-30   
ref|XP_002311169.2|  hypothetical protein POPTR_0008s05650g             123   9e-30   Populus trichocarpa [western balsam poplar]
ref|XP_003567536.1|  PREDICTED: probable serine/threonine-protein...    123   9e-30   Brachypodium distachyon [annual false brome]
emb|CDY20465.1|  BnaC04g05790D                                          123   1e-29   Brassica napus [oilseed rape]
emb|CDX80814.1|  BnaC03g00680D                                          123   1e-29   
ref|XP_010452061.1|  PREDICTED: probable serine/threonine-protein...    122   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_002283701.1|  PREDICTED: protein kinase APK1A, chloroplast...    122   1e-29   Vitis vinifera
ref|XP_007140532.1|  hypothetical protein PHAVU_008G120600g             122   1e-29   Phaseolus vulgaris [French bean]
ref|XP_004142067.1|  PREDICTED: probable serine/threonine-protein...    122   2e-29   Cucumis sativus [cucumbers]
ref|XP_009343547.1|  PREDICTED: protein kinase APK1A, chloroplast...    122   2e-29   
ref|XP_008447952.1|  PREDICTED: probable serine/threonine-protein...    122   2e-29   Cucumis melo [Oriental melon]
gb|EYU26593.1|  hypothetical protein MIMGU_mgv1a007265mg                122   2e-29   Erythranthe guttata [common monkey flower]
ref|XP_002466186.1|  hypothetical protein SORBIDRAFT_01g003130          122   2e-29   Sorghum bicolor [broomcorn]
gb|KHG15911.1|  Protein kinase APK1A, chloroplastic                     123   2e-29   Gossypium arboreum [tree cotton]
ref|XP_010937616.1|  PREDICTED: protein kinase APK1A, chloroplast...    122   2e-29   Elaeis guineensis
ref|XP_002534306.1|  Protein kinase APK1B, chloroplast precursor,...    122   3e-29   
ref|XP_009124366.1|  PREDICTED: protein kinase APK1B, chloroplast...    122   3e-29   Brassica rapa
ref|XP_010067409.1|  PREDICTED: probable serine/threonine-protein...    121   3e-29   Eucalyptus grandis [rose gum]
ref|XP_009414322.1|  PREDICTED: probable serine/threonine-protein...    122   3e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC78387.1|  hypothetical protein OsI_18165                          121   3e-29   Oryza sativa Indica Group [Indian rice]
emb|CDY10453.1|  BnaCnng03540D                                          121   3e-29   Brassica napus [oilseed rape]
ref|XP_009133858.1|  PREDICTED: protein kinase APK1B, chloroplast...    121   3e-29   Brassica rapa
ref|XP_004246420.1|  PREDICTED: probable serine/threonine-protein...    121   4e-29   Solanum lycopersicum
ref|XP_008810614.1|  PREDICTED: protein kinase APK1A, chloroplastic     121   5e-29   Phoenix dactylifera
ref|NP_001241128.1|  probable serine/threonine-protein kinase NAK...    121   6e-29   Glycine max [soybeans]
emb|CDY04848.1|  BnaAnng00300D                                          120   6e-29   
gb|EYU18976.1|  hypothetical protein MIMGU_mgv1a007452mg                120   6e-29   Erythranthe guttata [common monkey flower]
emb|CDY48100.1|  BnaC02g03570D                                          120   6e-29   Brassica napus [oilseed rape]
ref|XP_008233629.1|  PREDICTED: protein kinase APK1A, chloroplast...    120   6e-29   Prunus mume [ume]
ref|XP_009125442.1|  PREDICTED: probable serine/threonine-protein...    120   7e-29   Brassica rapa
ref|XP_010423878.1|  PREDICTED: probable serine/threonine-protein...    120   7e-29   Camelina sativa [gold-of-pleasure]
emb|CDY40347.1|  BnaA10g27210D                                          120   7e-29   Brassica napus [oilseed rape]
ref|XP_009122790.1|  PREDICTED: probable serine/threonine-protein...    120   8e-29   Brassica rapa
gb|EPS63220.1|  protein kinase 1b                                       119   9e-29   Genlisea aurea
ref|NP_001184929.1|  protein kinase APK1A                               120   9e-29   
ref|XP_006650809.1|  PREDICTED: protein kinase APK1B, chloroplast...    120   1e-28   
ref|XP_010517317.1|  PREDICTED: serine/threonine-protein kinase BIK1    120   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_007133997.1|  hypothetical protein PHAVU_010G010300g             120   1e-28   Phaseolus vulgaris [French bean]
ref|XP_009414410.1|  PREDICTED: probable serine/threonine-protein...    120   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007218038.1|  hypothetical protein PRUPE_ppa006035mg             120   1e-28   
ref|XP_010508995.1|  PREDICTED: serine/threonine-protein kinase B...    119   1e-28   Camelina sativa [gold-of-pleasure]
gb|AAO18450.1|  putative protein kinase                                 119   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051730.1|  Os03g0821900                                       119   2e-28   
gb|EPS69141.1|  hypothetical protein M569_05623                         119   2e-28   Genlisea aurea
ref|XP_006294362.1|  hypothetical protein CARUB_v10023379mg             119   2e-28   Capsella rubella
ref|XP_004503146.1|  PREDICTED: protein kinase APK1A, chloroplast...    119   2e-28   Cicer arietinum [garbanzo]
ref|XP_009384873.1|  PREDICTED: protein kinase APK1A, chloroplast...    119   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_181496.1|  serine/threonine-protein kinase BIK1                  119   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001054444.1|  Os05g0110900                                       119   3e-28   
ref|NP_180459.2|  protein kinase APK1B                                  119   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879808.1|  botrytis-induced kinase1                           119   3e-28   
ref|XP_002879189.1|  hypothetical protein ARALYDRAFT_481810             119   3e-28   
ref|XP_006654906.1|  PREDICTED: protein kinase APK1A, chloroplast...    119   3e-28   
ref|XP_004505862.1|  PREDICTED: protein kinase APK1B, chloroplast...    119   4e-28   
ref|XP_007163407.1|  hypothetical protein PHAVU_001G232300g             118   5e-28   Phaseolus vulgaris [French bean]
ref|NP_001141912.1|  uncharacterized LOC100274061                       118   5e-28   Zea mays [maize]
ref|XP_008369907.1|  PREDICTED: probable serine/threonine-protein...    118   5e-28   
ref|XP_009384872.1|  PREDICTED: probable serine/threonine-protein...    118   5e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002440455.1|  hypothetical protein SORBIDRAFT_09g001190          118   6e-28   Sorghum bicolor [broomcorn]
gb|KJB76054.1|  hypothetical protein B456_012G070600                    117   9e-28   Gossypium raimondii
gb|KFK24748.1|  hypothetical protein AALP_AA8G019600                    117   1e-27   Arabis alpina [alpine rockcress]
ref|XP_006398693.1|  hypothetical protein EUTSA_v10013737mg             117   1e-27   Eutrema salsugineum [saltwater cress]
ref|XP_004505860.1|  PREDICTED: protein kinase APK1B, chloroplast...    117   1e-27   
ref|XP_006827147.1|  hypothetical protein AMTR_s00010p00251410          117   2e-27   Amborella trichopoda
ref|XP_010558329.1|  PREDICTED: probable serine/threonine-protein...    116   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_010690630.1|  PREDICTED: probable serine/threonine-protein...    117   2e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010558326.1|  PREDICTED: probable serine/threonine-protein...    117   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_010231839.1|  PREDICTED: protein kinase APK1B, chloroplast...    116   2e-27   Brachypodium distachyon [annual false brome]
ref|XP_006601720.1|  PREDICTED: protein kinase isoform X1               116   2e-27   Glycine max [soybeans]
ref|XP_008464125.1|  PREDICTED: protein kinase APK1A, chloroplast...    116   2e-27   Cucumis melo [Oriental melon]
ref|XP_004960525.1|  PREDICTED: protein kinase APK1A, chloroplast...    116   3e-27   Setaria italica
emb|CDY39519.1|  BnaC04g15180D                                          116   3e-27   Brassica napus [oilseed rape]
ref|NP_001151952.1|  LOC100285589                                       115   3e-27   Zea mays [maize]
ref|XP_009419746.1|  PREDICTED: probable serine/threonine-protein...    115   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ87345.1|  predicted protein                                      113   4e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB76739.1|  hypothetical protein B456_012G104300                    114   4e-27   Gossypium raimondii
dbj|BAJ95924.1|  predicted protein                                      115   5e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009341752.1|  PREDICTED: probable serine/threonine-protein...    115   5e-27   Pyrus x bretschneideri [bai li]
ref|XP_004145296.1|  PREDICTED: protein kinase APK1A, chloroplast...    115   5e-27   Cucumis sativus [cucumbers]
gb|KJB76738.1|  hypothetical protein B456_012G104300                    114   6e-27   Gossypium raimondii
ref|XP_004171473.1|  PREDICTED: probable serine/threonine-protein...    115   6e-27   
ref|XP_004307510.1|  PREDICTED: protein kinase APK1A, chloroplast...    115   6e-27   Fragaria vesca subsp. vesca
ref|NP_001241432.1|  probable serine/threonine-protein kinase NAK...    115   6e-27   Glycine max [soybeans]
ref|NP_001242718.1|  protein kinase APK1A, chloroplastic-like           115   6e-27   Glycine max [soybeans]
ref|XP_006590337.1|  PREDICTED: uncharacterized protein LOC100809...    115   6e-27   Glycine max [soybeans]
ref|XP_008457478.1|  PREDICTED: protein kinase APK1B, chloroplast...    115   7e-27   Cucumis melo [Oriental melon]
gb|EMT08269.1|  Protein kinase APK1A, chloroplastic                     114   7e-27   
gb|KHN21952.1|  Protein kinase APK1A, chloroplastic                     115   8e-27   Glycine soja [wild soybean]
ref|XP_004165824.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    114   8e-27   
ref|XP_002893367.1|  hypothetical protein ARALYDRAFT_472702             115   8e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_008343582.1|  PREDICTED: protein kinase APK1A, chloroplast...    114   9e-27   
gb|KEH30162.1|  kinase 1B                                               114   9e-27   Medicago truncatula
ref|XP_008387769.1|  PREDICTED: probable serine/threonine-protein...    114   1e-26   
ref|XP_008354131.1|  PREDICTED: protein kinase APK1A, chloroplast...    114   1e-26   
ref|XP_006646742.1|  PREDICTED: protein kinase APK1A, chloroplast...    114   1e-26   
ref|XP_009419747.1|  PREDICTED: probable serine/threonine-protein...    114   1e-26   
gb|KHN17927.1|  Protein kinase APK1B, chloroplastic                     113   2e-26   
ref|XP_007132065.1|  hypothetical protein PHAVU_011G064000g             114   2e-26   
ref|XP_006411192.1|  hypothetical protein EUTSA_v10016758mg             114   2e-26   
gb|AFK41166.1|  unknown                                                 114   2e-26   
gb|KHN31764.1|  Protein kinase 2B, chloroplastic                        114   2e-26   
ref|NP_001235430.1|  protein kinase                                     113   2e-26   
gb|ABD39229.1|  protein kinase ABC1063                                  113   2e-26   
ref|XP_004302742.1|  PREDICTED: probable serine/threonine-protein...    113   2e-26   
gb|ABF18545.1|  serine/threonine kinase-like protein ABC1063            113   2e-26   
gb|KJB16970.1|  hypothetical protein B456_002G257500                    112   3e-26   
gb|KEH30161.1|  kinase 1B                                               113   3e-26   
gb|AET14353.1|  protein kinase 1b                                       113   3e-26   
gb|KFK36852.1|  hypothetical protein AALP_AA4G180100                    113   3e-26   
ref|XP_006602311.1|  PREDICTED: protein kinase 2B, chloroplastic-...    113   3e-26   
ref|NP_001045548.1|  Os01g0973500                                       113   3e-26   
gb|EAZ15004.1|  hypothetical protein OsJ_04942                          113   3e-26   
gb|EEC72262.1|  hypothetical protein OsI_05407                          113   3e-26   
ref|XP_009384874.1|  PREDICTED: protein kinase APK1B, chloroplast...    113   3e-26   
gb|AAF79849.1|AC000348_2  T7N9.2                                        113   3e-26   
ref|XP_006602310.1|  PREDICTED: protein kinase 2B, chloroplastic-...    113   4e-26   
ref|NP_174019.2|  putative protein kinase                               113   4e-26   
gb|KJB16969.1|  hypothetical protein B456_002G257500                    112   4e-26   
ref|XP_008802716.1|  PREDICTED: protein kinase APK1B, chloroplast...    112   5e-26   
gb|ABC74580.1|  rust resistance gene ABC1041                            112   5e-26   
ref|NP_001238650.1|  protein kinase                                     112   6e-26   
ref|XP_006287879.1|  hypothetical protein CARUB_v10001106mg             112   6e-26   
gb|EMT20337.1|  Protein kinase APK1A, chloroplastic                     112   7e-26   
gb|ACJ84784.1|  unknown                                                 111   7e-26   
ref|XP_004492356.1|  PREDICTED: probable serine/threonine-protein...    112   7e-26   
gb|KEH30163.1|  kinase 1B                                               112   8e-26   
ref|XP_010325852.1|  PREDICTED: probable serine/threonine-protein...    112   8e-26   
ref|XP_009380641.1|  PREDICTED: probable serine/threonine-protein...    112   9e-26   
gb|EMS53821.1|  putative serine/threonine-protein kinase NAK            112   1e-25   
gb|KFK34793.1|  hypothetical protein AALP_AA5G193900                    111   1e-25   
ref|XP_006438645.1|  hypothetical protein CICLE_v10031645mg             111   1e-25   
tpg|DAA50034.1|  TPA: putative protein kinase superfamily protein       110   1e-25   
ref|XP_003558236.1|  PREDICTED: protein kinase APK1B, chloroplast...    110   2e-25   
ref|XP_006435539.1|  hypothetical protein CICLE_v10031723mg             111   2e-25   
ref|XP_009133374.1|  PREDICTED: serine/threonine-protein kinase BIK1    111   2e-25   
gb|KDO69307.1|  hypothetical protein CISIN_1g015731mg                   110   2e-25   
ref|XP_006486482.1|  PREDICTED: protein kinase APK1B, chloroplast...    111   2e-25   
emb|CDY07643.1|  BnaA03g18680D                                          110   2e-25   
ref|XP_011025834.1|  PREDICTED: protein kinase 2B, chloroplastic-...    111   2e-25   
ref|XP_004490013.1|  PREDICTED: protein kinase 2B, chloroplastic-...    110   2e-25   
ref|XP_011025841.1|  PREDICTED: protein kinase 2B, chloroplastic-...    111   2e-25   
gb|EPS59398.1|  hypothetical protein M569_15409                         110   2e-25   
ref|XP_008654993.1|  PREDICTED: LOC100283086 isoform X2                 110   2e-25   
ref|NP_001049704.1|  Os03g0274800                                       110   2e-25   
gb|ABF95246.1|  Protein kinase APK1B, chloroplast precursor, puta...    110   2e-25   
ref|XP_006438644.1|  hypothetical protein CICLE_v10031645mg             110   2e-25   
gb|KDO82855.1|  hypothetical protein CISIN_1g014623mg                   110   2e-25   
ref|XP_010258573.1|  PREDICTED: protein kinase 2B, chloroplastic-...    110   3e-25   
emb|CDY45196.1|  BnaA06g34000D                                          110   3e-25   
ref|XP_010111129.1|  Protein kinase APK1A                               111   3e-25   
ref|XP_002311595.1|  KINASE 2B family protein                           110   3e-25   
ref|XP_003517946.2|  PREDICTED: protein kinase 2B, chloroplastic-...    110   3e-25   
emb|CDY24954.1|  BnaC03g22180D                                          110   4e-25   
ref|XP_009101235.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    110   4e-25   
ref|XP_007157675.1|  hypothetical protein PHAVU_002G089100g             110   4e-25   
ref|NP_001183697.1|  uncharacterized LOC100502290                       110   4e-25   
ref|XP_003519043.2|  PREDICTED: protein kinase 2B, chloroplastic-...    110   4e-25   
ref|XP_010452063.1|  PREDICTED: probable serine/threonine-protein...    109   5e-25   
ref|XP_010268227.1|  PREDICTED: protein kinase 2B, chloroplastic-...    109   5e-25   
ref|XP_008780759.1|  PREDICTED: protein kinase 2B, chloroplastic-...    110   5e-25   
gb|KHG05760.1|  Protein kinase 2B, chloroplastic -like protein          109   6e-25   
emb|CDX93249.1|  BnaC04g46470D                                          109   7e-25   
gb|KJB80149.1|  hypothetical protein B456_013G083100                    109   8e-25   
ref|XP_009129122.1|  PREDICTED: protein kinase 2B, chloroplastic ...    109   9e-25   
gb|KEH30160.1|  kinase 1B                                               109   9e-25   
ref|XP_010258572.1|  PREDICTED: protein kinase 2B, chloroplastic-...    109   9e-25   
ref|XP_009344675.1|  PREDICTED: probable serine/threonine-protein...    108   1e-24   
ref|XP_007153823.1|  hypothetical protein PHAVU_003G067900g             108   1e-24   
ref|XP_006576543.1|  PREDICTED: protein kinase APK1B, chloroplast...    108   1e-24   
ref|XP_010507637.1|  PREDICTED: serine/threonine-protein kinase B...    108   1e-24   
ref|XP_007208720.1|  hypothetical protein PRUPE_ppa015273mg             108   1e-24   
gb|KFK44604.1|  hypothetical protein AALP_AA1G280500                    108   1e-24   
emb|CDY07022.1|  BnaA04g22930D                                          108   1e-24   
ref|XP_009141824.1|  PREDICTED: serine/threonine-protein kinase B...    108   1e-24   
gb|EYU28722.1|  hypothetical protein MIMGU_mgv1a007163mg                108   1e-24   
ref|XP_011071021.1|  PREDICTED: protein kinase 2B, chloroplastic-...    108   1e-24   
ref|XP_010096366.1|  Protein kinase 2B                                  108   1e-24   
ref|XP_008221672.1|  PREDICTED: protein kinase 2B, chloroplastic-...    108   2e-24   
gb|AFW83844.1|  putative protein kinase superfamily protein             107   2e-24   
ref|XP_008663158.1|  PREDICTED: protein kinase 2B, chloroplastic-...    103   3e-24   
ref|XP_006291104.1|  hypothetical protein CARUB_v10017216mg             107   3e-24   
ref|XP_009592152.1|  PREDICTED: protein kinase 2B, chloroplastic-...    107   3e-24   
ref|XP_009412594.1|  PREDICTED: probable serine/threonine-protein...    107   3e-24   
ref|XP_004983145.1|  PREDICTED: protein kinase 2B, chloroplastic-...    107   3e-24   
gb|KJB50673.1|  hypothetical protein B456_008G182000                    107   3e-24   
ref|XP_006649840.1|  PREDICTED: protein kinase APK1B, chloroplast...    107   3e-24   
ref|XP_010234717.1|  PREDICTED: protein kinase 2B, chloroplastic-...    107   3e-24   
ref|XP_007046178.1|  Kinase 2B isoform 1                                107   3e-24   
ref|XP_006291105.1|  hypothetical protein CARUB_v10017216mg             107   3e-24   
gb|KJB80150.1|  hypothetical protein B456_013G083100                    107   4e-24   
ref|XP_003573903.1|  PREDICTED: protein kinase 2B, chloroplastic-...    107   4e-24   
ref|XP_008221674.1|  PREDICTED: protein kinase 2B, chloroplastic-...    107   4e-24   
ref|XP_010229119.1|  PREDICTED: protein kinase 2B, chloroplastic        107   4e-24   
ref|XP_004985548.1|  PREDICTED: protein kinase 2B, chloroplastic-...    107   4e-24   
gb|KEH39442.1|  kinase 1B                                               107   4e-24   
emb|CDY41675.1|  BnaC02g34790D                                          107   5e-24   
ref|XP_009590721.1|  PREDICTED: protein kinase 2B, chloroplastic-...    107   5e-24   
ref|XP_008654992.1|  PREDICTED: LOC100283086 isoform X1                 107   5e-24   
emb|CDY03036.1|  BnaC07g21910D                                          107   5e-24   
emb|CDY67404.1|  BnaA02g36850D                                          107   5e-24   
gb|ACF83789.1|  unknown                                                 106   5e-24   
ref|XP_008339927.1|  PREDICTED: protein kinase 2B, chloroplastic-...    107   5e-24   
ref|XP_002315799.1|  KINASE 2B family protein                           107   6e-24   
gb|ACJ84335.1|  unknown                                                 107   6e-24   
ref|XP_003613630.1|  Protein kinase 2B                                  107   6e-24   
ref|XP_009129123.1|  PREDICTED: protein kinase 2B, chloroplastic ...    107   6e-24   
ref|NP_001149460.1|  LOC100283086                                       106   7e-24   
ref|XP_008457480.1|  PREDICTED: protein kinase APK1B, chloroplast...    106   8e-24   
ref|XP_010044713.1|  PREDICTED: protein kinase 2B, chloroplastic-...    106   8e-24   
ref|XP_009129121.1|  PREDICTED: protein kinase 2B, chloroplastic ...    107   8e-24   
ref|XP_010227588.1|  PREDICTED: probable serine/threonine-protein...    107   8e-24   
emb|CDP00299.1|  unnamed protein product                                106   8e-24   
ref|XP_010652320.1|  PREDICTED: protein kinase 2B, chloroplastic ...    106   8e-24   
ref|XP_002277256.1|  PREDICTED: protein kinase 2B, chloroplastic ...    106   9e-24   
ref|XP_004228391.1|  PREDICTED: protein kinase 2B, chloroplastic-...    106   9e-24   
ref|XP_004142838.1|  PREDICTED: protein kinase APK1A, chloroplast...    105   9e-24   
ref|XP_006363926.1|  PREDICTED: protein kinase 2B, chloroplastic-...    106   1e-23   
ref|XP_009769692.1|  PREDICTED: protein kinase 2B, chloroplastic-...    106   1e-23   
ref|XP_008241951.1|  PREDICTED: probable serine/threonine-protein...    106   1e-23   
ref|XP_011086380.1|  PREDICTED: protein kinase 2B, chloroplastic        106   1e-23   
emb|CDY46426.1|  BnaA08g20040D                                          106   1e-23   
ref|NP_178383.1|  protein kinase 2B                                     106   1e-23   
ref|XP_009110056.1|  PREDICTED: protein kinase 2B, chloroplastic        105   1e-23   
dbj|BAC42058.1|  putative protein kinase                                106   1e-23   
ref|XP_002876829.1|  hypothetical protein ARALYDRAFT_484186             106   1e-23   
ref|XP_006403457.1|  hypothetical protein EUTSA_v10010443mg             105   1e-23   
ref|XP_008811563.1|  PREDICTED: protein kinase 2B, chloroplastic-...    105   1e-23   
ref|XP_010554324.1|  PREDICTED: protein kinase 2B, chloroplastic-...    105   1e-23   
ref|XP_006649471.1|  PREDICTED: protein kinase 2B, chloroplastic-...    105   1e-23   
ref|XP_010502291.1|  PREDICTED: protein kinase 2B, chloroplastic        105   1e-23   
gb|AGU99598.1|  protein kinase                                          106   1e-23   
ref|XP_010514052.1|  PREDICTED: protein kinase 2B, chloroplastic-...    105   1e-23   
ref|XP_002465785.1|  hypothetical protein SORBIDRAFT_01g045780          105   1e-23   
ref|XP_010425051.1|  PREDICTED: protein kinase 2B, chloroplastic-...    105   1e-23   
ref|NP_001130876.1|  LOC100191980                                       105   1e-23   
ref|XP_007219460.1|  hypothetical protein PRUPE_ppa021223mg             105   2e-23   
ref|NP_001147807.1|  serine/threonine-protein kinase NAK                105   2e-23   
gb|KFK33463.1|  hypothetical protein AALP_AA5G016500                    106   2e-23   
ref|XP_002520117.1|  Protein kinase APK1A, chloroplast precursor,...    105   2e-23   
gb|ACF81963.1|  unknown                                                 105   2e-23   
ref|XP_006390970.1|  hypothetical protein EUTSA_v10018676mg             105   2e-23   
ref|XP_008233630.1|  PREDICTED: protein kinase APK1B, chloroplast...    105   2e-23   
ref|XP_004238776.1|  PREDICTED: protein kinase 2B, chloroplastic-...    105   2e-23   
gb|KDP21209.1|  hypothetical protein JCGZ_21680                         105   2e-23   
ref|XP_010523451.1|  PREDICTED: protein kinase 2B, chloroplastic-...    105   2e-23   
ref|XP_008653698.1|  PREDICTED: protein kinase 2B, chloroplastic-...    102   3e-23   
ref|XP_010917006.1|  PREDICTED: protein kinase 2B, chloroplastic-...    105   3e-23   
ref|XP_002467271.1|  hypothetical protein SORBIDRAFT_01g022400          105   3e-23   
ref|XP_008221673.1|  PREDICTED: protein kinase 2B, chloroplastic-...    104   3e-23   
gb|EMS62888.1|  Protein kinase APK1A, chloroplastic                     105   3e-23   
ref|XP_008245730.1|  PREDICTED: protein kinase APK1B, chloroplast...    101   3e-23   
gb|EMS68595.1|  Protein kinase APK1A, chloroplastic                     105   3e-23   
gb|EEC74601.1|  hypothetical protein OsI_10191                          104   4e-23   
ref|XP_007222585.1|  hypothetical protein PRUPE_ppa006262mg             104   4e-23   
gb|AAL84315.1|AC073556_32  putative protein tyrosine-serine-threo...    104   4e-23   
ref|XP_009762807.1|  PREDICTED: protein kinase 2B, chloroplastic-...    104   4e-23   
gb|ABF94203.1|  serine/threonine-protein kinase NAK, putative, ex...    104   4e-23   
ref|XP_009389572.1|  PREDICTED: protein kinase 2A, chloroplastic-...    104   4e-23   
ref|XP_009389571.1|  PREDICTED: protein kinase 2A, chloroplastic-...    104   4e-23   
ref|XP_010044714.1|  PREDICTED: protein kinase 2B, chloroplastic-...    104   4e-23   
ref|XP_011021613.1|  PREDICTED: protein kinase 2B, chloroplastic-...    104   4e-23   
gb|KHG12048.1|  Protein kinase 2B, chloroplastic -like protein          104   4e-23   
ref|XP_006395757.1|  hypothetical protein EUTSA_v10004126mg             105   4e-23   
gb|AAT40481.1|  putative protein kinase                                 104   4e-23   
gb|AAT39953.2|  Protein kinase APK1B, chloroplast precursor, puta...    104   5e-23   
ref|XP_002465484.1|  hypothetical protein SORBIDRAFT_01g039630          103   5e-23   
ref|XP_006363247.1|  PREDICTED: protein kinase 2B, chloroplastic-...    104   5e-23   
emb|CDY52768.1|  BnaC08g48570D                                          103   5e-23   
gb|EMT32058.1|  Protein kinase APK1A, chloroplastic                     103   7e-23   
ref|XP_006661758.1|  PREDICTED: protein kinase 2B, chloroplastic-...    103   7e-23   
dbj|BAK02513.1|  predicted protein                                      103   7e-23   
ref|XP_010504399.1|  PREDICTED: probable receptor-like protein ki...    103   8e-23   
ref|XP_010427316.1|  PREDICTED: probable receptor-like protein ki...    103   8e-23   
ref|XP_010516114.1|  PREDICTED: probable receptor-like protein ki...    103   8e-23   
ref|XP_006587767.1|  PREDICTED: probable receptor-like protein ki...    104   8e-23   
ref|XP_010504400.1|  PREDICTED: probable receptor-like protein ki...    103   9e-23   
ref|XP_003534465.1|  PREDICTED: probable receptor-like protein ki...    104   9e-23   
ref|XP_010320662.1|  PREDICTED: probable receptor-like protein ki...    104   9e-23   
ref|XP_010427317.1|  PREDICTED: probable receptor-like protein ki...    103   9e-23   
ref|XP_009360375.1|  PREDICTED: protein kinase 2B, chloroplastic-...    103   9e-23   
ref|XP_009116239.1|  PREDICTED: probable receptor-like protein ki...    103   9e-23   
ref|XP_011021612.1|  PREDICTED: protein kinase 2B, chloroplastic-...    104   9e-23   
ref|XP_006357263.1|  PREDICTED: probable receptor-like protein ki...    104   9e-23   
ref|XP_009116240.1|  PREDICTED: probable receptor-like protein ki...    103   9e-23   
ref|XP_008464126.1|  PREDICTED: protein kinase APK1A, chloroplast...    103   9e-23   
ref|XP_010477782.1|  PREDICTED: protein kinase 2B, chloroplastic-...    103   1e-22   
ref|XP_010476493.1|  PREDICTED: protein kinase 2A, chloroplastic-...    102   1e-22   
emb|CDY40221.1|  BnaA09g35030D                                          103   1e-22   
emb|CDY41231.1|  BnaC08g26270D                                          103   1e-22   
gb|KDP35640.1|  hypothetical protein JCGZ_09078                         102   1e-22   
ref|XP_010552590.1|  PREDICTED: protein kinase 2B, chloroplastic        103   1e-22   
ref|NP_001147720.1|  serine/threonine-protein kinase Cx32               103   1e-22   
ref|XP_006307552.1|  hypothetical protein CARUB_v10009175mg             103   1e-22   
emb|CDY53554.1|  BnaA09g57130D                                          103   1e-22   
ref|XP_010496035.1|  PREDICTED: protein kinase 2A, chloroplastic        103   1e-22   
gb|KHN13655.1|  Putative receptor-like protein kinase                   103   1e-22   
emb|CDX81634.1|  BnaC08g39670D                                          103   1e-22   
ref|XP_010458935.1|  PREDICTED: protein kinase 2A, chloroplastic-...    103   1e-22   
ref|XP_009392863.1|  PREDICTED: probable serine/threonine-protein...    102   1e-22   
dbj|BAC57958.1|  serine/threonine protein kinase                        103   1e-22   
gb|ABR16118.1|  unknown                                                 100   1e-22   
ref|XP_004238768.1|  PREDICTED: probable receptor-like protein ki...    103   1e-22   
gb|EMS64110.1|  Protein kinase 2B, chloroplastic                        103   1e-22   
gb|EMT28025.1|  Putative serine/threonine-protein kinase NAK            103   1e-22   
ref|XP_006601719.1|  PREDICTED: serine/threonine protein kinase-l...    103   2e-22   
ref|NP_001238522.1|  serine/threonine protein kinase-like protein       103   2e-22   
ref|XP_010527880.1|  PREDICTED: protein kinase 2B, chloroplastic-...    102   2e-22   
dbj|BAJ91759.1|  predicted protein                                      102   2e-22   
gb|EPS58949.1|  hypothetical protein M569_15863                         102   2e-22   
emb|CDY02940.1|  BnaC04g25460D                                          102   2e-22   
ref|XP_009117905.1|  PREDICTED: protein kinase 2A, chloroplastic        102   2e-22   
ref|XP_008643601.1|  PREDICTED: serine/threonine-protein kinase C...    102   3e-22   
ref|XP_010926227.1|  PREDICTED: protein kinase 2B, chloroplastic-...    102   3e-22   
gb|EMS64273.1|  Protein kinase APK1B, chloroplastic                     102   3e-22   
ref|XP_009392862.1|  PREDICTED: probable serine/threonine-protein...    102   3e-22   
ref|XP_009587494.1|  PREDICTED: probable receptor-like protein ki...    102   3e-22   



>ref|NP_001240863.1| protein kinase APK1A, chloroplastic-like [Glycine max]
 ref|XP_006593429.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Glycine max]
 gb|ACM89549.1| putative protein kinase [Glycine max]
 gb|KHN30169.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=419

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 95/118 (81%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNLK  389
            MG+CLS +IKAESP   + +   +STDG+ LG ++ K   NS PQTP+SEGEILQS NLK
Sbjct  1    MGVCLSAQIKAESPFNTVFNSKYVSTDGNDLGSTNDKVSANSVPQTPRSEGEILQSSNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SFT ++LK ATR+FR DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G
Sbjct  61   SFTLSELKTATRNFRPDSVLGEGGFGSVFKGWIDENSLTATKPGTGIVIAVKRLNQDG  118



>ref|XP_007150326.1| hypothetical protein PHAVU_005G144200g [Phaseolus vulgaris]
 gb|ESW22320.1| hypothetical protein PHAVU_005G144200g [Phaseolus vulgaris]
Length=422

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 98/119 (82%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNL  386
            MG+CLS +IKAESP+  GL+SK   STDG+ LG ++ K   NS PQTP+SEGEILQS NL
Sbjct  1    MGVCLSAQIKAESPYNTGLNSK-YGSTDGNYLGSTNDKVSGNSVPQTPRSEGEILQSSNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSFT ++LK ATR+FR DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G
Sbjct  60   KSFTLSELKTATRNFRPDSVLGEGGFGSVFKGWIDENSLTATKPGTGIVIAVKRLNQDG  118



>ref|NP_001234409.1| protein kinase 1b [Solanum lycopersicum]
 gb|ACD77110.1| protein kinase 1b [Solanum lycopersicum]
Length=401

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 94/116 (81%), Gaps = 5/116 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MGICLS RIKAESP H GL+S+ V S DG   G S+S +  P T +SEGEILQSPNLKSF
Sbjct  1    MGICLSARIKAESPFHTGLNSRSV-SIDG---GDSNSSSRVPSTTRSEGEILQSPNLKSF  56

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F+DLK ATR+FR DSVLGEGGFG VFKGWID+N+ + TKPGTG++IAVKRLN  G
Sbjct  57   SFSDLKTATRNFRPDSVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEG  112



>ref|XP_011035314.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Populus euphratica]
Length=405

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 94/119 (79%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNL  386
            MGICLS +IKAES  + GLSSK V STDGS L  + SK    S P TP+SEGEILQS NL
Sbjct  1    MGICLSAQIKAESSCNTGLSSKYV-STDGSDLSSTGSKVLSVSVPPTPRSEGEILQSTNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF+F+DLKMATR+FR DSVLGEGGFG VFKGWID+ S S  KPGTG+VIAVKRLN  G
Sbjct  60   KSFSFSDLKMATRNFRPDSVLGEGGFGSVFKGWIDEQSFSAAKPGTGIVIAVKRLNQAG  118



>emb|CDP09060.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 96/119 (81%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  386
            MGICLS RIKAESP H GL+SK V STDG+ L  S  K S    P  P+SEGEILQSPNL
Sbjct  1    MGICLSARIKAESPYHTGLTSKNV-STDGNSLKSSSGKVSSGSVPPPPRSEGEILQSPNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF+F+DLKMATR+FR DSVLGEGGFG VFKGWID+NS + TKPGTG+VIAVKRLN  G
Sbjct  60   KSFSFSDLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFAATKPGTGVVIAVKRLNLEG  118



>gb|KHN33381.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=422

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 96/119 (81%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNL  386
            MG+CLS +IKAESP+  G +SK V STDG+  G ++ K   NS PQTP+SE EIL+S NL
Sbjct  1    MGVCLSAQIKAESPYNTGFNSKYV-STDGNDFGSTNDKVSANSIPQTPRSEVEILRSSNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSFT ++LK ATR+FR DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G
Sbjct  60   KSFTLSELKTATRNFRPDSVLGEGGFGSVFKGWIDENSLTATKPGTGIVIAVKRLNQDG  118



>ref|NP_001242670.1| uncharacterized protein LOC100798404 [Glycine max]
 gb|ACU24124.1| unknown [Glycine max]
Length=422

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 96/119 (81%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNL  386
            MG+CLS +IKAESP+  G +SK V STDG+  G ++ K   NS PQTP+SEGEIL+S NL
Sbjct  1    MGVCLSAQIKAESPYNTGFNSKYV-STDGNDFGSTNDKVSANSIPQTPRSEGEILRSSNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF  ++LK ATR+FR DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G
Sbjct  60   KSFPLSELKTATRNFRPDSVLGEGGFGSVFKGWIDENSLTATKPGTGIVIAVKRLNQDG  118



>gb|KDO72843.1| hypothetical protein CISIN_1g046897mg [Citrus sinensis]
Length=404

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  386
            MGICLS RIKAESP + G+SSK V S+DG+ +  + SK S    P TP+SEGEIL+SPNL
Sbjct  1    MGICLSARIKAESPFNTGVSSKYV-SSDGNDMSSTGSKVSSLSVPPTPRSEGEILRSPNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF+F+DLK ATR+FR DSVLGEGGFG VFKGWID++S + TKPGTG+VIAVKRLN  G
Sbjct  60   KSFSFSDLKTATRNFRPDSVLGEGGFGSVFKGWIDEHSFAATKPGTGMVIAVKRLNQDG  118



>ref|XP_006424836.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 ref|XP_006424837.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 ref|XP_006488335.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Citrus sinensis]
 gb|ESR38076.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 gb|ESR38077.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
Length=404

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  386
            MGICLS RIKAESP + G+SSK V S+DG+ +  + SK S    P TP+SEGEIL+SPNL
Sbjct  1    MGICLSARIKAESPFNTGVSSKYV-SSDGNDMSSTGSKVSSLSVPPTPRSEGEILRSPNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF+F+DLK ATR+FR DSVLGEGGFG VFKGWID++S + TKPGTG+VIAVKRLN  G
Sbjct  60   KSFSFSDLKTATRNFRPDSVLGEGGFGSVFKGWIDEHSFAATKPGTGMVIAVKRLNQDG  118



>ref|XP_007016405.1| Kinase superfamily protein isoform 3, partial [Theobroma cacao]
 gb|EOY34024.1| Kinase superfamily protein isoform 3, partial [Theobroma cacao]
Length=337

 Score =   152 bits (383),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 95/120 (79%), Gaps = 5/120 (4%)
 Frame = +3

Query  216  MMGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPN  383
            +MGICLS RIKAESP   GLSSK V S DG  +  + SK S    P TP+SEGEIL SPN
Sbjct  12   LMGICLSARIKAESPSSTGLSSKYV-SGDGKDMSSTSSKVSSVSVPLTPRSEGEILLSPN  70

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            LKSF+FADLKMATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTG+VIAVKRLN  G
Sbjct  71   LKSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWIDENSLTAAKPGTGIVIAVKRLNQDG  130



>ref|XP_007016404.1| Kinase superfamily protein isoform 2, partial [Theobroma cacao]
 gb|EOY34023.1| Kinase superfamily protein isoform 2, partial [Theobroma cacao]
Length=325

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 94/119 (79%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  386
            MGICLS RIKAESP   GLSSK V S DG  +  + SK S    P TP+SEGEIL SPNL
Sbjct  1    MGICLSARIKAESPSSTGLSSKYV-SGDGKDMSSTSSKVSSVSVPLTPRSEGEILLSPNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF+FADLKMATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTG+VIAVKRLN  G
Sbjct  60   KSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWIDENSLTAAKPGTGIVIAVKRLNQDG  118



>ref|XP_009590400.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009590401.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009590402.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
Length=404

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 91/116 (78%), Gaps = 2/116 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MGICLS RIKAESP H GL+S+   STDG     S   ++ P  P+SEGEILQS NLKSF
Sbjct  1    MGICLSARIKAESPFHTGLNSRSA-STDGYDSNPSSRVSTVPLAPRSEGEILQSANLKSF  59

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F+DLK ATR+FR DSVLGEGGFG VFKGWID+N+ + TKPGTG++IAVKRLN  G
Sbjct  60   SFSDLKTATRNFRPDSVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEG  115



>ref|XP_004487006.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X5 
[Cicer arietinum]
Length=411

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 93/119 (78%), Gaps = 4/119 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPH-PGLSSKCV--ISTDGSGLGKS-DSKNSPPQTPKSEGEILQSPNL  386
            MG+CLS +IKAESP+  GL+SK    I  D S    S DS  S PQTP+SEGEILQS NL
Sbjct  1    MGVCLSAQIKAESPYNTGLNSKSAGSIGNDLSSTNNSKDSAVSVPQTPRSEGEILQSSNL  60

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KS+T A+LK ATR+FR DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G
Sbjct  61   KSYTLAELKAATRNFRPDSVLGEGGFGSVFKGWIDENSLAATKPGTGIVIAVKRLNQDG  119



>ref|XP_011035309.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035310.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035311.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035312.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
Length=407

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 93/121 (77%), Gaps = 7/121 (6%)
 Frame = +3

Query  219  MGICLSVRIKAES---PHPGLSSKCVISTDGSGLGKSDSKN---SPPQTPKSEGEILQSP  380
            MGICLS +IKAES      GLSSK V STDGS L  + SK    S P TP+SEGEILQS 
Sbjct  1    MGICLSAQIKAESSCNTVAGLSSKYV-STDGSDLSSTGSKVLSVSVPPTPRSEGEILQST  59

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            NLKSF+F+DLKMATR+FR DSVLGEGGFG VFKGWID+ S S  KPGTG+VIAVKRLN  
Sbjct  60   NLKSFSFSDLKMATRNFRPDSVLGEGGFGSVFKGWIDEQSFSAAKPGTGIVIAVKRLNQA  119

Query  561  G  563
            G
Sbjct  120  G  120



>ref|XP_004487002.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Cicer arietinum]
 ref|XP_004487003.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=441

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 93/119 (78%), Gaps = 4/119 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPH-PGLSSKCV--ISTDGSGLGKS-DSKNSPPQTPKSEGEILQSPNL  386
            MG+CLS +IKAESP+  GL+SK    I  D S    S DS  S PQTP+SEGEILQS NL
Sbjct  1    MGVCLSAQIKAESPYNTGLNSKSAGSIGNDLSSTNNSKDSAVSVPQTPRSEGEILQSSNL  60

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KS+T A+LK ATR+FR DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G
Sbjct  61   KSYTLAELKAATRNFRPDSVLGEGGFGSVFKGWIDENSLAATKPGTGIVIAVKRLNQDG  119



>ref|XP_009774717.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
 ref|XP_009774718.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
Length=404

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 92/116 (79%), Gaps = 2/116 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MGICLS RIKAESP H GL+S+ V STDG     S   ++ P  P+SEGEILQS NLKSF
Sbjct  1    MGICLSARIKAESPFHTGLNSRSV-STDGYDSNPSSRVSTVPPAPRSEGEILQSANLKSF  59

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F++L+ ATR+FR DSVLGEGGFG VFKGWID+N+ + TKPGTG++IAVKRLN  G
Sbjct  60   SFSELRTATRNFRPDSVLGEGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEG  115



>ref|XP_002299870.1| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
 gb|EEE84675.1| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
Length=405

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 93/119 (78%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNL  386
            MGICLS +IKAES  + GLSSK V STDG+ L  + SK    S P TP+SEGEILQS NL
Sbjct  1    MGICLSAQIKAESSCNTGLSSKYV-STDGNDLSSTGSKVLSVSVPPTPRSEGEILQSTNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF+F+DLKMATR FR DSVLGEGGFG VFKGWID+ S S  KPGTG+VIAVKRLN  G
Sbjct  60   KSFSFSDLKMATRSFRPDSVLGEGGFGSVFKGWIDEQSFSAAKPGTGIVIAVKRLNQDG  118



>ref|XP_007016403.1| Kinase 1B isoform 1 [Theobroma cacao]
 gb|EOY34022.1| Kinase 1B isoform 1 [Theobroma cacao]
Length=405

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 94/119 (79%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  386
            MGICLS RIKAESP   GLSSK V S DG  +  + SK S    P TP+SEGEIL SPNL
Sbjct  1    MGICLSARIKAESPSSTGLSSKYV-SGDGKDMSSTSSKVSSVSVPLTPRSEGEILLSPNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF+FADLKMATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTG+VIAVKRLN  G
Sbjct  60   KSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWIDENSLTAAKPGTGIVIAVKRLNQDG  118



>emb|CBI16124.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 5/116 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNL  386
            MG+CLS RIKAESP H G SSK V STDG+    + SK    S P TP+SEG+ILQSPNL
Sbjct  1    MGVCLSARIKAESPCHTGGSSKYV-STDGNEQNSTSSKVSVASVPPTPRSEGDILQSPNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  554
            K+FTF++LKMATR+FR DSVLGEGGFG VFKGWID+ S +  +PGTG+VIAVKRLN
Sbjct  60   KNFTFSELKMATRNFRPDSVLGEGGFGSVFKGWIDEQSFAAARPGTGMVIAVKRLN  115



>ref|XP_002283646.2| PREDICTED: protein kinase APK1A, chloroplastic [Vitis vinifera]
 ref|XP_010651014.1| PREDICTED: protein kinase APK1A, chloroplastic [Vitis vinifera]
Length=442

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 5/116 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNL  386
            MG+CLS RIKAESP H G SSK V STDG+    + SK    S P TP+SEG+ILQSPNL
Sbjct  1    MGVCLSARIKAESPCHTGGSSKYV-STDGNEQNSTSSKVSVASVPPTPRSEGDILQSPNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  554
            K+FTF++LKMATR+FR DSVLGEGGFG VFKGWID+ S +  +PGTG+VIAVKRLN
Sbjct  60   KNFTFSELKMATRNFRPDSVLGEGGFGSVFKGWIDEQSFAAARPGTGMVIAVKRLN  115



>ref|XP_010685751.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=395

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 93/115 (81%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSK-NSPPQTPKSEGEILQSPNLKS  392
            MGICLS RIKAESP H G++SK V S DG+      SK +S P TP+SEGEILQS NLK+
Sbjct  1    MGICLSARIKAESPSHTGINSKYV-SKDGNDPTFPSSKVSSAPLTPRSEGEILQSSNLKN  59

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            F+F++LK ATR+FR DSVLGEGGFG VFKGWID+NS + TKPGTG+VIAVKRLN 
Sbjct  60   FSFSELKAATRNFRPDSVLGEGGFGSVFKGWIDENSYAATKPGTGMVIAVKRLNQ  114



>gb|KCW88942.1| hypothetical protein EUGRSUZ_A01268 [Eucalyptus grandis]
Length=291

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 93/116 (80%), Gaps = 2/116 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG+C S RIKAE+P + G+SSK V S DG+ L    S  S PQTP+S+GEILQS NLK+F
Sbjct  1    MGVCWSNRIKAETPTNTGVSSKNV-SHDGNDLSSRISSASGPQTPRSQGEILQSSNLKNF  59

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F++L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+P +PGTG+++AVKRLN  G
Sbjct  60   SFSELRTATRNFRPDSVLGEGGFGAVFKGWIDEQTLAPARPGTGMIVAVKRLNQEG  115



>ref|XP_004142761.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004170949.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis 
sativus]
 gb|KGN51318.1| hypothetical protein Csa_5G517160 [Cucumis sativus]
Length=401

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 93/118 (79%), Gaps = 5/118 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNS--PPQTPKSEGEILQSPNLK  389
            MG CLS RIKAESP H GLSS+   + DG+  G S SK+S   P+TP++EGEILQS NLK
Sbjct  1    MGSCLSARIKAESPLHNGLSSR--YARDGNDKGNSTSKSSVSTPRTPRTEGEILQSSNLK  58

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F++ +LK ATR+FR DSVLGEGGFG VFKGWID+ S + TKPGTGLVIAVKRLN  G
Sbjct  59   NFSYNELKAATRNFRPDSVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKRLNQEG  116



>ref|XP_011042707.1| PREDICTED: protein kinase APK1A, chloroplastic [Populus euphratica]
Length=405

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 91/119 (76%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGS---GLGKSDSKNSPPQTPKSEGEILQSPNL  386
            MGICLS +IKAESP   GLSSK V STDG+         S  S P TP+SEGEILQS NL
Sbjct  1    MGICLSAQIKAESPCSTGLSSKNV-STDGTDLSSTSSKVSSLSVPPTPRSEGEILQSSNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF+F+DLKMATR+FR DSVLGEGGFG VFKGWID+ S S  KPGTG+VIAVKRLN  G
Sbjct  60   KSFSFSDLKMATRNFRPDSVLGEGGFGSVFKGWIDEQSFSAAKPGTGIVIAVKRLNQAG  118



>dbj|BAE71262.1| putative protein kinase APK1A [Trifolium pratense]
Length=409

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 94/117 (80%), Gaps = 5/117 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNL  386
            MG+CLS +IKAESP+  GL+SK   S  G+ L  ++SK    S PQTP+SEGEIL+S N+
Sbjct  1    MGVCLSAQIKAESPYNTGLNSKNSNSA-GNDLSSTNSKVSTGSVPQTPRSEGEILKSTNV  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            KS+T A+LK ATR+FR DSVLGEGGFG VFKGWID+NSL+P KPGTG+VIAVKRLN 
Sbjct  60   KSYTLAELKSATRNFRPDSVLGEGGFGSVFKGWIDENSLAPAKPGTGIVIAVKRLNQ  116



>ref|XP_008458866.1| PREDICTED: protein kinase APK1A, chloroplastic [Cucumis melo]
Length=401

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 92/118 (78%), Gaps = 5/118 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNS--PPQTPKSEGEILQSPNLK  389
            MG CLS RIKAESP H GLSSK   + DG+  G S SK+S   P+TP++EGEILQS NLK
Sbjct  1    MGSCLSARIKAESPLHNGLSSK--YARDGNDKGNSTSKSSVSTPRTPRTEGEILQSSNLK  58

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F + +LK ATR+FR DSVLGEGGFG VFKGWID+ S + TKPGTGLVIAVK+LN  G
Sbjct  59   NFAYNELKAATRNFRPDSVLGEGGFGSVFKGWIDEQSFAVTKPGTGLVIAVKKLNQEG  116



>ref|XP_010047703.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Eucalyptus grandis]
 gb|KCW88941.1| hypothetical protein EUGRSUZ_A01268 [Eucalyptus grandis]
Length=407

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 93/116 (80%), Gaps = 2/116 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG+C S RIKAE+P + G+SSK V S DG+ L    S  S PQTP+S+GEILQS NLK+F
Sbjct  1    MGVCWSNRIKAETPTNTGVSSKNV-SHDGNDLSSRISSASGPQTPRSQGEILQSSNLKNF  59

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F++L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+P +PGTG+++AVKRLN  G
Sbjct  60   SFSELRTATRNFRPDSVLGEGGFGAVFKGWIDEQTLAPARPGTGMIVAVKRLNQEG  115



>ref|XP_010106485.1| Protein kinase APK1A [Morus notabilis]
 gb|EXC10661.1| Protein kinase APK1A [Morus notabilis]
Length=402

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 91/117 (78%), Gaps = 5/117 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGS--GLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MGICLS +IKAES   GL+SK V STDG+        S  S P TP+SEGEILQS NLKS
Sbjct  1    MGICLSAQIKAESQ--GLNSKYV-STDGNLSSTSSKVSSVSVPPTPRSEGEILQSSNLKS  57

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F FADL+MATR+FR DSVLGEGGFG VFKGWID+NS + TKPGTG+VIAVKRLN  G
Sbjct  58   FCFADLRMATRNFRPDSVLGEGGFGSVFKGWIDENSFAATKPGTGMVIAVKRLNQDG  114



>ref|XP_007205264.1| hypothetical protein PRUPE_ppa006390mg [Prunus persica]
 gb|EMJ06463.1| hypothetical protein PRUPE_ppa006390mg [Prunus persica]
Length=414

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 92/115 (80%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGS-GLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MG+CLS RIKAESP + G++SK ++STDG+       S  S P TP+SEGEILQS NLKS
Sbjct  1    MGVCLSARIKAESPCNTGVNSK-IVSTDGNLSTSSKVSSFSAPPTPRSEGEILQSSNLKS  59

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            F+F DLKMATR+FR DSVLGEGGFG VFKGWID+NS +  KPGTG+V+AVKRLN 
Sbjct  60   FSFNDLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFTAAKPGTGIVLAVKRLNQ  114



>ref|XP_008223637.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Prunus mume]
 ref|XP_008223643.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Prunus mume]
Length=414

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 92/115 (80%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGS-GLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MG+CLS RIKAESP + G++SK ++STDG+       S  S P TP+SEGEILQS NLKS
Sbjct  1    MGVCLSARIKAESPCNTGVNSK-IVSTDGNLSTSSKVSSFSAPPTPRSEGEILQSSNLKS  59

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            F+F DLKMATR+FR DSVLGEGGFG VFKGWID+NS +  KPGTG+V+AVKRLN 
Sbjct  60   FSFNDLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFTAAKPGTGIVLAVKRLNQ  114



>gb|KHG20116.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=404

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 87/117 (74%), Gaps = 2/117 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MGICLS RI     + GLSSK V S   D S      S  S P TP+SEGEILQSPNLKS
Sbjct  1    MGICLSARINESPSNTGLSSKYVSSDGKDTSSTSSKASSFSAPLTPRSEGEILQSPNLKS  60

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F+FADLKMATR+FR DSVLGEGGFG VFK WID+NSL+ +KPGTG VIAVKRLN  G
Sbjct  61   FSFADLKMATRNFRPDSVLGEGGFGSVFKAWIDENSLAASKPGTGTVIAVKRLNQEG  117



>ref|XP_010487664.1| PREDICTED: protein kinase APK1A, chloroplastic [Camelina sativa]
Length=413

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 90/117 (77%), Gaps = 4/117 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MGICLS ++KAESP  G SSK V S   D   LG   S  S   TP++EGEILQSPNLKS
Sbjct  1    MGICLSAQVKAESP--GTSSKYVSSDVKDTGSLGSKASSVSVRPTPRTEGEILQSPNLKS  58

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F+FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G
Sbjct  59   FSFAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDG  115



>ref|XP_010256925.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
 ref|XP_010256926.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
Length=415

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 92/119 (77%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  386
            MG C S RIKAESP H G++SKCV S DG+ +  S S+ S    P TP+  GEI+ S NL
Sbjct  1    MGACWSARIKAESPFHTGVNSKCV-SKDGNDVSGSSSRASATSVPLTPRGAGEIIPSSNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF+F++LKMATR+FR DSVLGEGGFG VFKGWID+N+L+  KPGTG++IAVKRLN  G
Sbjct  60   KSFSFSELKMATRNFRPDSVLGEGGFGSVFKGWIDENALTAAKPGTGMIIAVKRLNQEG  118



>ref|XP_010264446.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
Length=413

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 88/118 (75%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVI--STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MG C S RIKAESP H G++SK V     D SG     S  S PQTP+SEGEIL S NLK
Sbjct  1    MGACWSARIKAESPFHTGVNSKYVSKDENDVSGASSKVSAASVPQTPRSEGEILLSSNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF+F +LKMATR+FR DSVLGEGGFG VFKGWID+++ +  KPGTG+VIAVKRLN  G
Sbjct  61   SFSFNELKMATRNFRPDSVLGEGGFGSVFKGWIDEHAFTAAKPGTGIVIAVKRLNQEG  118



>gb|KCW88940.1| hypothetical protein EUGRSUZ_A01268 [Eucalyptus grandis]
Length=408

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 92/117 (79%), Gaps = 3/117 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPH--PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MG+C S RIKAE+P    G+SSK V S DG+ L    S  S PQTP+S+GEILQS NLK+
Sbjct  1    MGVCWSNRIKAETPTNTAGVSSKNV-SHDGNDLSSRISSASGPQTPRSQGEILQSSNLKN  59

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F+F++L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+P +PGTG+++AVKRLN  G
Sbjct  60   FSFSELRTATRNFRPDSVLGEGGFGAVFKGWIDEQTLAPARPGTGMIVAVKRLNQEG  116



>gb|KDP20446.1| hypothetical protein JCGZ_05291 [Jatropha curcas]
Length=404

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 93/118 (79%), Gaps = 4/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MG+CLS +IKAESP + GLSSK V +   D S   K  S + PP TP+SEGEILQS NLK
Sbjct  1    MGVCLSAQIKAESPFNTGLSSKYVSTDVNDRSTSSKVSSASMPP-TPRSEGEILQSSNLK  59

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF+F+DLKMATR+FR DSVLGEGGFG VFKGWID+NS +  KPGTG+VIAVKRLN  G
Sbjct  60   SFSFSDLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFAAAKPGTGMVIAVKRLNQEG  117



>ref|XP_010678048.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=408

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 90/117 (77%), Gaps = 3/117 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSD-SKNSPPQTPKSEGEILQSPNLKS  392
            MG C S RIKAESP H G +S+   S DG     S  S  S PQTP+SEGEILQS NLK+
Sbjct  1    MGACWSKRIKAESPLHTGYNSRTG-SKDGKDWSNSKLSSASTPQTPRSEGEILQSSNLKN  59

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F+F +LK ATR+FR DSVLGEGGFG VFKGWID+++L+PT+PGTG+VIAVKRLN  G
Sbjct  60   FSFNELKTATRNFRPDSVLGEGGFGAVFKGWIDEHALTPTRPGTGIVIAVKRLNQEG  116



>ref|XP_010457947.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
Length=413

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 89/117 (76%), Gaps = 4/117 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MGICLS ++KAE P  G SSK V S   D   LG   S  S   TP++EGEILQSPNLKS
Sbjct  1    MGICLSAQVKAEIP--GTSSKYVSSDVKDTGSLGSKASSVSVRPTPRTEGEILQSPNLKS  58

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F+FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G
Sbjct  59   FSFAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDG  115



>gb|KJB55870.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
 gb|KJB55872.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
Length=404

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 85/117 (73%), Gaps = 2/117 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MGICLS RI     + GLSSK V S   D S      S  S P TP+SEGEILQSPNLK 
Sbjct  1    MGICLSARINESPSNTGLSSKYVSSDGKDTSSTSSKASSFSAPLTPRSEGEILQSPNLKC  60

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F+FADLKMATR+FR DSVLGEGGFG VFK WID+NSL+  KPGTG VIAVKRLN  G
Sbjct  61   FSFADLKMATRNFRPDSVLGEGGFGSVFKAWIDENSLAAAKPGTGTVIAVKRLNQEG  117



>gb|KJB55871.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
 gb|KJB55873.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
Length=475

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 86/118 (73%), Gaps = 2/118 (2%)
 Frame = +3

Query  216  MMGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            +MGICLS RI     + GLSSK V S   D S      S  S P TP+SEGEILQSPNLK
Sbjct  71   LMGICLSARINESPSNTGLSSKYVSSDGKDTSSTSSKASSFSAPLTPRSEGEILQSPNLK  130

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F+FADLKMATR+FR DSVLGEGGFG VFK WID+NSL+  KPGTG VIAVKRLN  G
Sbjct  131  CFSFADLKMATRNFRPDSVLGEGGFGSVFKAWIDENSLAAAKPGTGTVIAVKRLNQEG  188



>ref|XP_008464124.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Cucumis melo]
Length=404

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAE-SPHPGLSSKCVISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNL  386
            MG+CLS RIKAE S + G++S  V STDG+ +G ++SK    S P TP++EGEILQS NL
Sbjct  1    MGVCLSTRIKAENSCNTGVNSNAV-STDGNDIGSTNSKINLLSMPPTPRTEGEILQSSNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF+F +LK ATR+FR DSV+GEGGFG VFKGWID++S +  KPGTG+VIAVKRLN  G
Sbjct  60   KSFSFTELKAATRNFRPDSVVGEGGFGSVFKGWIDEHSFAAAKPGTGMVIAVKRLNQDG  118



>ref|XP_010685750.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=404

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 92/125 (74%), Gaps = 14/125 (11%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCV----------ISTDGSGLGKSDSK-NSPPQTPKSEG  362
            MGICLS RIKAESP H G  S CV          +S DG+      SK +S P TP+SEG
Sbjct  1    MGICLSARIKAESPSHTG--SNCVLACLGINSKYVSKDGNDPTFPSSKVSSAPLTPRSEG  58

Query  363  EILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAV  542
            EILQS NLK+F+F++LK ATR+FR DSVLGEGGFG VFKGWID+NS + TKPGTG+VIAV
Sbjct  59   EILQSSNLKNFSFSELKAATRNFRPDSVLGEGGFGSVFKGWIDENSYAATKPGTGMVIAV  118

Query  543  KRLNH  557
            KRLN 
Sbjct  119  KRLNQ  123



>emb|CDX95754.1| BnaC03g26350D [Brassica napus]
Length=404

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 90/118 (76%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MGICLS +IKAESP + G S K + S   D   +G   S  S   +P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAESPSNTGASPKYMSSEANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F+FA+LK ATR+FRLDSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G
Sbjct  61   CFSFAELKAATRNFRLDSVLGEGGFGCVFKGWIDEESLTASKPGTGMVIAVKRLNKEG  118



>ref|XP_010475518.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
 ref|XP_010475519.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
Length=413

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 89/117 (76%), Gaps = 4/117 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MG+CLS ++KAESP  G SSK   S   D   LG   S  S   TP++EGEILQSPNLKS
Sbjct  1    MGMCLSAQVKAESP--GTSSKYASSDGKDTGSLGSKASSVSVRPTPRTEGEILQSPNLKS  58

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F+FA+L+ ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G
Sbjct  59   FSFAELRSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDG  115



>ref|XP_004143118.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis 
sativus]
 gb|KGN47146.1| hypothetical protein Csa_6G190370 [Cucumis sativus]
Length=404

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAE-SPHPGLSSKCVISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNL  386
            MG+CLS RIKAE S + G++S  V STDG+ +G ++SK    S P TP++EGEILQS NL
Sbjct  1    MGVCLSTRIKAENSCNTGVNSNGV-STDGNDIGSTNSKINLLSVPPTPRTEGEILQSSNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF+F +LK ATR+FR DSV+GEGGFG VFKGWID++S +  KPGTG+VIAVKRLN  G
Sbjct  60   KSFSFTELKAATRNFRPDSVVGEGGFGSVFKGWIDEHSFAAAKPGTGMVIAVKRLNQDG  118



>ref|XP_004165801.1| PREDICTED: LOW QUALITY PROTEIN: protein kinase APK1A, chloroplastic-like 
[Cucumis sativus]
Length=404

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAE-SPHPGLSSKCVISTDGSGLGKSDSKN---SPPQTPKSEGEILQSPNL  386
            MG+CLS RIKAE S + G++S  V STDG+ +G ++SK    S P TP++EGEILQS NL
Sbjct  1    MGVCLSTRIKAENSCNTGVNSNGV-STDGNDIGSTNSKINLLSVPPTPRTEGEILQSSNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF+F +LK ATR+FR DSV+GEGGFG VFKGWID++S +  KPGTG+VIAVKRLN  G
Sbjct  60   KSFSFTELKAATRNFRPDSVVGEGGFGSVFKGWIDEHSFAAAKPGTGMVIAVKRLNQDG  118



>dbj|BAD12263.1| protein kinase [Brassica rapa]
Length=404

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MGIC+SV++KAESP + G S K + S   D   +G   S  S   +P++EGEILQSPNLK
Sbjct  1    MGICMSVQVKAESPSNTGASPKYMSSEANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F+FA+LK ATR+FRLDSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G
Sbjct  61   CFSFAELKAATRNFRLDSVLGEGGFGCVFKGWIDEESLTASKPGTGMVIAVKRLNIEG  118



>ref|XP_006307674.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 ref|XP_006307675.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 gb|EOA40572.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 gb|EOA40573.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
Length=410

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MGICLS ++KAESP  G S K      GS LG   S  S   TP++EGEILQSPNLKSF+
Sbjct  1    MGICLSAQVKAESP--GTSPKYDAKDTGS-LGSKASSVSVRPTPRTEGEILQSPNLKSFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G
Sbjct  58   FAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDG  112



>ref|XP_009124367.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Brassica 
rapa]
 ref|XP_009124368.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Brassica 
rapa]
 ref|XP_009124369.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Brassica 
rapa]
 emb|CDY47885.1| BnaA07g14300D [Brassica napus]
Length=413

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MGICLS +IKAESP + G+SSK + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAESPSNTGVSSKYMSSEANDSQSMGSKCSSASIRTNPRTEGEILQSPNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF+  +LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G
Sbjct  61   SFSLDELKSATRNFRQDSVLGEGGFGCVFKGWIDEQSLAASKPGTGMVIAVKRLNQDG  118



>ref|XP_002314178.2| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
 gb|EEE88133.2| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
Length=382

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 87/118 (74%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSK--CVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MGICLS +IKAES    GLSSK      TD S      S  S P TP+SEGEILQS NLK
Sbjct  1    MGICLSAQIKAESSCSTGLSSKNASTYGTDLSSTSSKVSSLSVPPTPRSEGEILQSSNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF+F+DLKMATR+FR DSVLGEGGFG VFKGWID+ + +  KPGTG+VIAVKRLN  G
Sbjct  61   SFSFSDLKMATRNFRPDSVLGEGGFGSVFKGWIDEQTFAAAKPGTGMVIAVKRLNQDG  118



>emb|CDX83305.1| BnaA03g22010D [Brassica napus]
Length=404

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 90/118 (76%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MGICLS +IKAESP + G S K + S   D   +G   S  S   +P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAESPSNTGASPKYMSSEANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F+FA+LK ATR+FRLDSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G
Sbjct  61   CFSFAELKAATRNFRLDSVLGEGGFGCVFKGWIDEESLTASKPGTGMVIAVKRLNIEG  118



>ref|XP_010678047.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 87/117 (74%), Gaps = 2/117 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSD-SKNSPPQTPKSEGEILQSPNLKS  392
            MG C S RIKAESP H    +    S DG     S  S  S PQTP+SEGEILQS NLK+
Sbjct  1    MGACWSKRIKAESPLHTAGYNSRTGSKDGKDWSNSKLSSASTPQTPRSEGEILQSSNLKN  60

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F+F +LK ATR+FR DSVLGEGGFG VFKGWID+++L+PT+PGTG+VIAVKRLN  G
Sbjct  61   FSFNELKTATRNFRPDSVLGEGGFGAVFKGWIDEHALTPTRPGTGIVIAVKRLNQEG  117



>gb|KHG10966.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=418

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 90/121 (74%), Gaps = 7/121 (6%)
 Frame = +3

Query  219  MGICLSVRIKAES-PHPGLSSKCVISTDGSGLGKSDSKNS-----PPQTPKSEGEILQSP  380
            MG CLS  IKAES  + GLSSK   S DG  +    S +       P TP+SEGEILQSP
Sbjct  12   MGNCLSAGIKAESHSNTGLSSK-YDSGDGKDISSESSNSKVSSFSAPLTPRSEGEILQSP  70

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            NLKSF+FADLKMATR+FR DSVLGEGGFG VFKGWID+NS + TKPG+G+VIAVKRLN  
Sbjct  71   NLKSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFTATKPGSGIVIAVKRLNQD  130

Query  561  G  563
            G
Sbjct  131  G  131



>ref|XP_007141880.1| hypothetical protein PHAVU_008G233400g [Phaseolus vulgaris]
 gb|ESW13874.1| hypothetical protein PHAVU_008G233400g [Phaseolus vulgaris]
Length=400

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG CLS +IKAESP   GLSSK   +T+  GL    S  S P TP++EGEIL+S N+KSF
Sbjct  1    MGCCLSAKIKAESPPRNGLSSKDG-NTEEDGLSGKISTPSVPPTPRTEGEILKSSNMKSF  59

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            TF +LK+ATR+FR DSV+GEGGFG VFKGWID+ SL+P +PGTGLVIAVKRLN  G
Sbjct  60   TFGELKIATRNFRPDSVVGEGGFGCVFKGWIDEQSLAPVRPGTGLVIAVKRLNQEG  115



>ref|XP_008357182.1| PREDICTED: protein kinase APK1A, chloroplastic [Malus domestica]
Length=418

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 86/115 (75%), Gaps = 5/115 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDG--SGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MG+CLS RIKAESP    +     S DG  S   K  S  +PP TP+SEGEILQS NLKS
Sbjct  1    MGVCLSARIKAESP--ANTGSNFKSNDGNLSASSKVSSYTAPP-TPRSEGEILQSSNLKS  57

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            F+F +LKMATR+FR DSVLGEGGFG VFKGWID+NS +  KPGTG+V+AVKRLN 
Sbjct  58   FSFNNLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFTAAKPGTGIVLAVKRLNQ  112



>emb|CDX77220.1| BnaC04g40150D [Brassica napus]
Length=418

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MGICLS +IKAESP + G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAESPSNTGASPKYMSSEANDTQSMGSKGSSVSIRTNPRTEGEILQSPNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF+FA++K ATR+FR DSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G
Sbjct  61   SFSFAEVKSATRNFRPDSVLGEGGFGCVFKGWIDEQSLTASKPGTGMVIAVKRLNQDG  118



>ref|XP_004236745.1| PREDICTED: protein kinase APK1A, chloroplastic [Solanum lycopersicum]
Length=394

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 86/116 (74%), Gaps = 8/116 (7%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG CLSVRIKAESP H G       ++DG  L    S +S P TP+S+ EIL+S NLKSF
Sbjct  1    MGSCLSVRIKAESPLHHG-------ASDGRELSSRHSYSSAPLTPRSQSEILESSNLKSF  53

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F +L++ATR+FR DSVLGEGGFG VFKGWID+N+    +PGTGLVIAVKRLN  G
Sbjct  54   SFNELRVATRNFRPDSVLGEGGFGCVFKGWIDENTFKAARPGTGLVIAVKRLNQEG  109



>emb|CDY31741.1| BnaA04g16770D [Brassica napus]
Length=418

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MGICLS +IKAESP + G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAESPSNTGASPKYMSSEANDTQSMGSKGSSVSIRTNPRTEGEILQSPNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF+FA++K ATR+FR DSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G
Sbjct  61   SFSFAEVKSATRNFRPDSVLGEGGFGCVFKGWIDEQSLTASKPGTGMVIAVKRLNQDG  118



>gb|KEH39440.1| kinase 1B [Medicago truncatula]
Length=407

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 90/117 (77%), Gaps = 5/117 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  386
            MG+CLS +IKAESP + G +SK   S  G+ L  ++SK S    P TP+SEGEILQS NL
Sbjct  1    MGVCLSAQIKAESPFNTGFNSKNSNSA-GNDLSSTNSKVSAASVPPTPRSEGEILQSSNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            KS+T A+LK ATR+FR DSVLGEGGFG VFKGWID+N+L   KPGTG+VIAVKRLN 
Sbjct  60   KSYTLAELKSATRNFRPDSVLGEGGFGSVFKGWIDENTLVAAKPGTGIVIAVKRLNQ  116



>gb|KHF99777.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=402

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 86/116 (74%), Gaps = 5/116 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MGICLS RIKAESP+  GLSS  V            S  S P TP+SEGEILQ  NLKSF
Sbjct  1    MGICLSARIKAESPNNTGLSSNYV----SGDTSSKVSSVSVPLTPRSEGEILQCTNLKSF  56

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +FA+LK ATR+FR DSVLGEGGFG VFKGWID+NS + +KPGTG+VIAVKRLN  G
Sbjct  57   SFANLKTATRNFRPDSVLGEGGFGSVFKGWIDENSFNASKPGTGIVIAVKRLNQEG  112



>gb|KDP35639.1| hypothetical protein JCGZ_09077 [Jatropha curcas]
Length=392

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 93/119 (78%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  386
            MG+CLS RIKA +P + GL+SK   S DG  L    SK S    PQTP+SEGEILQSPNL
Sbjct  1    MGLCLSNRIKAYTPSNTGLNSKSA-SRDGKNLSSVSSKVSSASIPQTPRSEGEILQSPNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            K+F+F++L+ +TR+FR DSVLGEGGFG VFKGWID++SLS TKP +G+VIAVKRLN  G
Sbjct  60   KNFSFSELRTSTRNFRPDSVLGEGGFGSVFKGWIDEHSLSATKPDSGMVIAVKRLNQEG  118



>ref|XP_010510562.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Camelina 
sativa]
Length=414

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 87/117 (74%), Gaps = 4/117 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MGICLS +IKA SP  G S K + S   D   +G   S  S    P++EGEILQSPNLKS
Sbjct  1    MGICLSAQIKAVSP--GASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKS  58

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G
Sbjct  59   FTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDG  115



>ref|XP_010414461.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Camelina sativa]
Length=414

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 87/117 (74%), Gaps = 4/117 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MGICLS +IKA SP  G S K + S   D   +G   S  S    P++EGEILQSPNLKS
Sbjct  1    MGICLSAQIKAVSP--GASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKS  58

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G
Sbjct  59   FTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDG  115



>ref|XP_011089469.1| PREDICTED: protein kinase APK1B, chloroplastic [Sesamum indicum]
 ref|XP_011089470.1| PREDICTED: protein kinase APK1B, chloroplastic [Sesamum indicum]
Length=406

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 91/117 (78%), Gaps = 5/117 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSPNL  386
            MGIC S RIKA++P H G++S+ V S+DG  +    SK    S P TP++EGEILQS NL
Sbjct  1    MGICFSARIKADTPAHTGVNSQYV-SSDGYDMSLGSSKISSTSVPPTPRTEGEILQSSNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            KSF+F+DLK+ATR+FR DSVLG GGFG VFKGWID+NS +  KPGTG++IAVK+L+ 
Sbjct  60   KSFSFSDLKVATRNFRPDSVLGGGGFGSVFKGWIDENSFTAAKPGTGMIIAVKKLHQ  116



>ref|XP_010414460.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Camelina sativa]
Length=417

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 87/118 (74%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MGICLS +IKA SP   G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAVSPGKQGASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SFTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G
Sbjct  61   SFTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDG  118



>gb|KJB83756.1| hypothetical protein B456_013G263600 [Gossypium raimondii]
 gb|KJB83757.1| hypothetical protein B456_013G263600 [Gossypium raimondii]
Length=402

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 86/116 (74%), Gaps = 5/116 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MGICLS RIKAESP+  GLSS  V            S  S P TP++EGEILQ  NLKSF
Sbjct  1    MGICLSARIKAESPNNTGLSSNYV----SGDTSSRVSSVSVPLTPRTEGEILQCTNLKSF  56

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +FA+LK ATR+FR DSVLGEGGFG VFKGWID+NS + +KPGTG+VIAVKRLN  G
Sbjct  57   SFANLKTATRNFRPDSVLGEGGFGSVFKGWIDENSFNASKPGTGIVIAVKRLNQEG  112



>gb|AGP76187.1| MLPK [Brassica rapa subsp. chinensis]
Length=418

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MGIC+S +IKAESP + G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICMSAQIKAESPSNTGASPKYMSSEANDTQSMGSKGSSVSIRTNPRTEGEILQSPNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF+FA++K ATR+FR DSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G
Sbjct  61   SFSFAEVKSATRNFRPDSVLGEGGFGCVFKGWIDEQSLTASKPGTGMVIAVKRLNQDG  118



>ref|XP_010510560.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X1 [Camelina 
sativa]
Length=417

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 87/118 (74%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MGICLS +IKA SP   G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAVSPGKQGASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SFTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G
Sbjct  61   SFTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDG  118



>ref|XP_004294513.1| PREDICTED: protein kinase APK1A, chloroplastic [Fragaria vesca 
subsp. vesca]
 ref|XP_011461211.1| PREDICTED: protein kinase APK1A, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=407

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 3/113 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG+C S +IKAESP     SK V S DGS   K  S ++PP TP++EGEILQS NL+SF+
Sbjct  1    MGVCWSAQIKAESP-LNTGSKFV-SNDGSTSSKVSSFSAPP-TPRTEGEILQSTNLRSFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            FADLK+ATR+FR DSVLGEGGFG VFKGWID+NS +  KPGTG+V+AVKRLN 
Sbjct  58   FADLKLATRNFRPDSVLGEGGFGSVFKGWIDENSFTAAKPGTGIVLAVKRLNQ  110



>emb|CDY06715.1| BnaA10g04940D [Brassica napus]
Length=408

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 86/115 (75%), Gaps = 5/115 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG CLS ++KAESP  G S K     D   LG   S  S   TP+SEGEILQSPNLKSF+
Sbjct  1    MGACLSAQVKAESP--GASPKF---KDTGSLGSKGSSVSVRPTPRSEGEILQSPNLKSFS  55

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G
Sbjct  56   FAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDG  110



>ref|XP_010521843.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010521844.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Tarenaya 
hassleriana]
Length=414

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 6/118 (5%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGS---GLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MG+CLS ++KAE+P  G S K  +S+DG+    LG   S  S   TP++EGEILQSPNLK
Sbjct  1    MGVCLSAQVKAENP--GASPKH-LSSDGNDTGSLGSKASSMSVRPTPRTEGEILQSPNLK  57

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF+F++LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ TKPGTG VIAVKRLN  G
Sbjct  58   SFSFSELKTATRNFRPDSVLGEGGFGCVFKGWIDEQTLTATKPGTGTVIAVKRLNQDG  115



>ref|XP_009133856.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Brassica rapa]
 ref|XP_009133857.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Brassica rapa]
Length=404

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 90/118 (76%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MGIC+SV++KAESP + G S K + S   D   +G   S  S   +P++EGEILQSPNLK
Sbjct  1    MGICMSVQVKAESPSNTGASPKYMSSEANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F+FA+LK ATR+FRL SVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G
Sbjct  61   CFSFAELKAATRNFRLYSVLGEGGFGCVFKGWIDEESLTASKPGTGMVIAVKRLNIEG  118



>ref|XP_009118950.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Brassica 
rapa]
Length=408

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 86/115 (75%), Gaps = 5/115 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG CLS ++KAESP  G S K     D   LG   S  S   TP+SEGEILQSPNLKSF+
Sbjct  1    MGACLSAQVKAESP--GASPKF---KDTGSLGSKGSSVSVRPTPRSEGEILQSPNLKSFS  55

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G
Sbjct  56   FAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDG  110



>ref|XP_006294292.1| hypothetical protein CARUB_v10023308mg [Capsella rubella]
 gb|EOA27190.1| hypothetical protein CARUB_v10023308mg [Capsella rubella]
Length=414

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 87/117 (74%), Gaps = 4/117 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MGICLS +IKA SP  G S K + S   D   +G   S  S    P++EGEILQSPNLKS
Sbjct  1    MGICLSAQIKAVSP--GASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKS  58

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ +KPGTG+VIAVK+LN  G
Sbjct  59   FTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTGVVIAVKKLNQDG  115



>ref|XP_010470020.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Camelina sativa]
Length=414

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 87/117 (74%), Gaps = 4/117 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MG+CLS +IKA SP  G S K + S   D   +G   S  S    P++EGEILQSPNLKS
Sbjct  1    MGLCLSAQIKAVSP--GASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKS  58

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G
Sbjct  59   FTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDG  115



>emb|CDY09904.1| BnaC08g45470D [Brassica napus]
Length=406

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 87/115 (76%), Gaps = 7/115 (6%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MGICLS ++KAESP  G S K     D   LG   S  S   +P++EGEILQSPNLKSF+
Sbjct  1    MGICLSAQVKAESP--GASPK-----DTKSLGSKGSSVSVRPSPRTEGEILQSPNLKSFS  53

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F++LK ATR+FR DSVLGEGGFG VFKGWID+ SLS T+PGTGLVIAVK+LN  G
Sbjct  54   FSELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLSATRPGTGLVIAVKKLNQDG  108



>gb|KJB20070.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
 gb|KJB20071.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
Length=418

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 90/121 (74%), Gaps = 7/121 (6%)
 Frame = +3

Query  219  MGICLSVRIKAES-PHPGLSSKCVISTDGSGLGKSDSKNS-----PPQTPKSEGEILQSP  380
            +G CLS  IKAES  + GLSSK   S DG  +    S +       P TP+SEGEILQSP
Sbjct  12   IGNCLSAGIKAESHSNTGLSSK-YDSGDGKDVSSESSNSKVSSFSAPLTPRSEGEILQSP  70

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            NLKSF+FADLKMATR+FR DSVLGEGGFG VFKGW+D+NS + TKPG+G+VIAVKRLN  
Sbjct  71   NLKSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWVDENSFTATKPGSGIVIAVKRLNQD  130

Query  561  G  563
            G
Sbjct  131  G  131



>gb|AIU96237.1| serine/threonine-protein kinase BIK1, partial [Nicotiana benthamiana]
Length=196

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 85/116 (73%), Gaps = 8/116 (7%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG C+SVRIKAESP H G       ++DG  L    S +S P TP+S+ EIL+S NL SF
Sbjct  1    MGSCISVRIKAESPLHAG-------ASDGRDLSSRLSYSSAPLTPRSQNEILESTNLNSF  53

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F +L++ATR+FR DSVLGEGGFG VFKGWID+++    +PGTGLVIAVKRLN  G
Sbjct  54   SFNELRVATRNFRPDSVLGEGGFGCVFKGWIDEHTFKSARPGTGLVIAVKRLNQEG  109



>ref|XP_003519344.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform 1 
[Glycine max]
 gb|KHN41092.1| Protein kinase APK1A-like protein, chloroplastic [Glycine soja]
Length=392

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 89/120 (74%), Gaps = 10/120 (8%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGS----GLGKSDSKNSPPQTPKSEGEILQSPN  383
            MG CLS RIKAESP   GLSSK     DG+    GL    S  S P TP++EGEIL+S N
Sbjct  1    MGCCLSARIKAESPPRNGLSSK-----DGNKEEDGLSSKASTPSVPPTPRTEGEILKSSN  55

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +KSF F++LK ATR+FR DSV+GEGGFG VFKGWID+ +L+P +PGTG+VIAVKRLN  G
Sbjct  56   MKSFNFSELKTATRNFRPDSVVGEGGFGCVFKGWIDEQTLAPVRPGTGMVIAVKRLNQEG  115



>gb|ACU19261.1| unknown [Glycine max]
Length=392

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 89/120 (74%), Gaps = 10/120 (8%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGS----GLGKSDSKNSPPQTPKSEGEILQSPN  383
            MG CLS RIKAESP   GLSSK     DG+    GL    S  S P TP++EGEIL+S N
Sbjct  1    MGCCLSARIKAESPPRNGLSSK-----DGNKEEDGLSSKASTPSVPPTPRTEGEILKSSN  55

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +KSF F++LK ATR+FR DSV+GEGGFG VFKGWID+ +L+P +PGTG+VIAVKRLN  G
Sbjct  56   MKSFNFSELKTATRNFRPDSVVGEGGFGCVFKGWIDEQTLAPVRPGTGMVIAVKRLNQEG  115



>emb|CDX95143.1| BnaC05g05280D [Brassica napus]
Length=408

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 86/115 (75%), Gaps = 5/115 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG CLS ++KAESP  G S K     D   LG   S  S   TP++EGEILQSPNLKSF+
Sbjct  1    MGACLSAQVKAESP--GASPKF---KDTGSLGSKGSSVSVRPTPRTEGEILQSPNLKSFS  55

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKPGTGLVIAVK+LN  G
Sbjct  56   FAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATKPGTGLVIAVKKLNQDG  110



>ref|XP_010470019.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Camelina sativa]
Length=417

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 87/118 (74%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MG+CLS +IKA SP   G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGLCLSAQIKAVSPGKQGASPKYMSSEANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SFTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +LS +KPGTG+VIAVK+LN  G
Sbjct  61   SFTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLSASKPGTGVVIAVKKLNQDG  118



>ref|XP_003544233.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Glycine 
max]
 gb|KHN20929.1| Protein kinase APK1A-like protein, chloroplastic [Glycine soja]
Length=399

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 89/120 (74%), Gaps = 10/120 (8%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGS----GLGKSDSKNSPPQTPKSEGEILQSPN  383
            MG CLS RIKAESP   GLSSK     DG+    GL    S  S P TP++EGEIL+S N
Sbjct  1    MGCCLSARIKAESPPRNGLSSK-----DGNKEEDGLSSKVSTPSDPPTPRTEGEILKSSN  55

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +KSF F++LK ATR+FR DSV+GEGGFG VFKGWID+ +L+P +PGTG+VIAVKRLN  G
Sbjct  56   MKSFNFSELKTATRNFRPDSVVGEGGFGCVFKGWIDEQTLAPVRPGTGMVIAVKRLNQEG  115



>ref|XP_006409926.1| hypothetical protein EUTSA_v10016722mg [Eutrema salsugineum]
 gb|ESQ51379.1| hypothetical protein EUTSA_v10016722mg [Eutrema salsugineum]
Length=417

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 90/118 (76%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MGICLS +IKAESP + G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAESPSNTGASPKYMSSEANDTQSMGSKSSSVSIRTNPRTEGEILQSPNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF+FA+LK+ATR+FR DSVLGEGGFG VFKGWID+ SLS +KPGTG+VIAVKRLN  G
Sbjct  61   SFSFAELKLATRNFRPDSVLGEGGFGCVFKGWIDEQSLSASKPGTGMVIAVKRLNQDG  118



>ref|XP_011094865.1| PREDICTED: protein kinase APK1A, chloroplastic [Sesamum indicum]
Length=414

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 94/121 (78%), Gaps = 6/121 (5%)
 Frame = +3

Query  219  MGICLSVRIKAESPH---PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSP  380
            MGICLS +IKAESP     G++S  ++S DG+ L  S SK S    P TP++EGEILQS 
Sbjct  1    MGICLSNQIKAESPFHTGTGVNSSKMVSGDGTELSNSVSKASSASVPPTPRTEGEILQSS  60

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            NLKSFTF+DLK ATR+FR DSVLGEGGFG VFKGWID++SL+ ++PG+ +V+AVKRLN  
Sbjct  61   NLKSFTFSDLKAATRNFRPDSVLGEGGFGSVFKGWIDESSLAASRPGSSMVVAVKRLNQE  120

Query  561  G  563
            G
Sbjct  121  G  121



>ref|XP_010554610.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Tarenaya 
hassleriana]
Length=397

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQ-TPKSEGEILQSPNLKSF  395
            MG CLS RIKAESP    ++    S+D  GL  S  K+S    + K+EGEILQS ++KSF
Sbjct  1    MGSCLSSRIKAESPPRNGANSSGKSSDLYGLSLSSQKSSMTTVSHKTEGEILQSASVKSF  60

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            TF +LK+ATR+FR DSV+GEGGFG VFKGWID+N+L+PTKPGTGLVIAVKRLN  G
Sbjct  61   TFNELKLATRNFRPDSVVGEGGFGSVFKGWIDENTLTPTKPGTGLVIAVKRLNQEG  116



>ref|XP_002892407.1| hypothetical protein ARALYDRAFT_470784 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68666.1| hypothetical protein ARALYDRAFT_470784 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MGICLS ++KAES   G S K   + D + LG   S  S   +P++EGEILQSPNLKSF+
Sbjct  1    MGICLSAQVKAESS--GASPK-YDAKDTASLGSKGSSVSVRPSPRTEGEILQSPNLKSFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FADLK ATR+FR DSVLGEGGFG VFKGWID+ SL+ ++PGTGLVIAVK+LN  G
Sbjct  58   FADLKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTASRPGTGLVIAVKKLNQDG  112



>dbj|BAC43185.1| putative protein kinase [Arabidopsis thaliana]
Length=215

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 86/115 (75%), Gaps = 2/115 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MGICLS +IKA SP  G S K + S     LG   S  S    P++EGEILQSPNLKSFT
Sbjct  1    MGICLSAQIKAVSP--GASPKYMSSEANDSLGSKSSSVSIRTNPRTEGEILQSPNLKSFT  58

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ +KPGTG+VIAVK+LN  G
Sbjct  59   FAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTGVVIAVKKLNQDG  113



>ref|XP_003616403.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES99361.1| kinase 1B [Medicago truncatula]
Length=418

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 87/119 (73%), Gaps = 4/119 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSK---CVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNL  386
            MG CLS RIKAESP   G SSK         G   GK  +  + P TP++EGEIL+S N+
Sbjct  1    MGCCLSARIKAESPPRNGSSSKDRSRETGLSGRSSGKVSTAPTAPPTPRTEGEILKSSNM  60

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSFTF++LK ATR+FR DSV+GEGGFG VFKGWID+N+L P +PGTG+VIAVKRLN  G
Sbjct  61   KSFTFSELKTATRNFRPDSVVGEGGFGAVFKGWIDENTLVPVRPGTGVVIAVKRLNQEG  119



>ref|XP_002266032.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 ref|XP_010654281.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 ref|XP_010654282.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 emb|CBI30550.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 91/119 (76%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  386
            MG C S RIKAESP H G SSK V S D + L +S SK S    PQTP++EGEILQ+ NL
Sbjct  1    MGACCSNRIKAESPVHTGASSKNV-SKDENDLSRSSSKFSSTSIPQTPRTEGEILQASNL  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL  T+PG G+V+AVKRLN  G
Sbjct  60   KSFGFSELRTATRNFRPDSVLGEGGFGSVFKGWIDENSLMATRPGAGMVVAVKRLNQEG  118



>ref|XP_010557255.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X3 
[Tarenaya hassleriana]
Length=412

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 90/118 (76%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQ---TPKSEGEILQSPNLK  389
            MGIC+S R+KAESP     S   +S+DG+  G   SK+S      TP++EGEILQSPNLK
Sbjct  1    MGICMSARVKAESPGKTGGSPKYMSSDGNDKGSLGSKSSSMSVRPTPRTEGEILQSPNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF F+DLK ATR+FR DSVLGEGGFG VFKGWID+ +L+ TKPGTG+VIAVKRLN  G
Sbjct  61   SFGFSDLKTATRNFRPDSVLGEGGFGCVFKGWIDEVALTATKPGTGMVIAVKRLNQDG  118



>ref|XP_010557252.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
Length=435

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 90/118 (76%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQ---TPKSEGEILQSPNLK  389
            MGIC+S R+KAESP     S   +S+DG+  G   SK+S      TP++EGEILQSPNLK
Sbjct  24   MGICMSARVKAESPGKTGGSPKYMSSDGNDKGSLGSKSSSMSVRPTPRTEGEILQSPNLK  83

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF F+DLK ATR+FR DSVLGEGGFG VFKGWID+ +L+ TKPGTG+VIAVKRLN  G
Sbjct  84   SFGFSDLKTATRNFRPDSVLGEGGFGCVFKGWIDEVALTATKPGTGMVIAVKRLNQDG  141



>ref|XP_009759469.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
Length=395

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 86/116 (74%), Gaps = 8/116 (7%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG C+SVRIKAESP H G       ++DG  L    S +S P TP+S+ EIL+S NLKSF
Sbjct  1    MGSCISVRIKAESPLHAG-------ASDGRDLSSRLSYSSAPLTPRSQNEILESSNLKSF  53

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F +L++ATR+FR DSVLGEGGFG VFKGWID+++    +PGTGLVIAVKRLN  G
Sbjct  54   SFNELRVATRNFRPDSVLGEGGFGCVFKGWIDEHTFKAARPGTGLVIAVKRLNQEG  109



>ref|XP_009626085.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
Length=395

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 86/116 (74%), Gaps = 8/116 (7%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG C+SVRIKAESP H G       ++DG  L    S +S P TP+S+ EIL+S NLKSF
Sbjct  1    MGSCISVRIKAESPLHAG-------ASDGRDLSSRLSYSSAPLTPRSQNEILESSNLKSF  53

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F +L++ATR+FR DSVLGEGGFG VFKGWID+++    +PGTGLVIAVKRLN  G
Sbjct  54   SFNELRVATRNFRPDSVLGEGGFGCVFKGWIDEHTFKSARPGTGLVIAVKRLNQEG  109



>ref|XP_006339025.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Solanum 
tuberosum]
Length=413

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 95/121 (79%), Gaps = 7/121 (6%)
 Frame = +3

Query  219  MGICLSVRIKAESPH---PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSP  380
            MGICLS +IKAE+      GL S+ V S +G+ +  S+SK+S    P TP+SEGEILQS 
Sbjct  1    MGICLSNQIKAETTFYTVSGLDSRNV-SGNGTDISNSNSKHSSASVPPTPRSEGEILQSS  59

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            NL+SFTF++L+ ATR+FR DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN  
Sbjct  60   NLRSFTFSELRSATRNFRPDSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLNQE  119

Query  561  G  563
            G
Sbjct  120  G  120



>ref|NP_172237.1| protein kinase APK1A [Arabidopsis thaliana]
 ref|NP_973778.1| protein kinase APK1A [Arabidopsis thaliana]
 sp|Q06548.1|APK1A_ARATH RecName: Full=Protein kinase APK1A, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02092.1| tyrosine-serine-threonine kinase [Arabidopsis thaliana]
 gb|AAO42086.1| putative protein kinase APK1A [Arabidopsis thaliana]
 gb|AAO50645.1| putative protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28143.1| protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28144.1| protein kinase APK1A [Arabidopsis thaliana]
Length=410

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MGICLS ++KAES   G S+K      GS LG   S  S   +P++EGEILQSPNLKSF+
Sbjct  1    MGICLSAQVKAESS--GASTKYDAKDIGS-LGSKASSVSVRPSPRTEGEILQSPNLKSFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ ++PGTGLVIAVK+LN  G
Sbjct  58   FAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTASRPGTGLVIAVKKLNQDG  112



>ref|XP_002533148.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF29229.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=410

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 86/116 (74%), Gaps = 4/116 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG C SVRIKAESP H G   +   +    G   S S ++ P TP++EGEILQS NLKSF
Sbjct  1    MGSCFSVRIKAESPLHHGADPR---NRSKGGHDVSGSSSAVPSTPRTEGEILQSSNLKSF  57

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F +LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGTG+VIAVKRLN  G
Sbjct  58   SFNELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGTGIVIAVKRLNQEG  113



>ref|XP_010542648.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Tarenaya hassleriana]
Length=257

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 87/118 (74%), Gaps = 6/118 (5%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQ---TPKSEGEILQSPNLK  389
            MGICLS ++KAE    G S K  +S+DG+  G   SK S      TP++EGEILQSP L 
Sbjct  1    MGICLSAQVKAEVS--GASPK-YMSSDGNQTGSMGSKASSVSVRPTPRTEGEILQSPTLN  57

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF+FA+LK ATR+FR DSVLGEGGFG VFKGWI + SL+ TKPGTGLVIAVKRLN  G
Sbjct  58   SFSFAELKAATRNFRPDSVLGEGGFGCVFKGWIHEQSLTATKPGTGLVIAVKRLNQDG  115



>ref|XP_009364395.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Pyrus x 
bretschneideri]
Length=418

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG+CLS RIKAESP     SK   +          S  + P TP+SEGEILQS NLKSF+
Sbjct  1    MGVCLSARIKAESP-ANTGSKFESNDGSLSASSKVSSYTAPPTPRSEGEILQSSNLKSFS  59

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            F +LKMATR+FR DSVLGEGGFG VFKGWID+NS +  KPGTG+V+AVKRLN 
Sbjct  60   FNNLKMATRNFRPDSVLGEGGFGSVFKGWIDENSFTAAKPGTGIVLAVKRLNQ  112



>gb|KJB36716.1| hypothetical protein B456_006G172600 [Gossypium raimondii]
Length=283

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 87/117 (74%), Gaps = 2/117 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSP--PQTPKSEGEILQSPNLKS  392
            MG+C S RIK+ SP  G++S+       +    S  ++S   PQTP+SEGEILQS NLK+
Sbjct  1    MGVCWSHRIKSVSPSTGVNSRNASRNGNNLSSSSSRESSASIPQTPRSEGEILQSSNLKT  60

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FTF++LK ATR+FR DSVLGEGGFG VFKGWID++S   TKPGTG++IAVKRLN  G
Sbjct  61   FTFSELKAATRNFRPDSVLGEGGFGSVFKGWIDEHSFKATKPGTGIIIAVKRLNQEG  117



>ref|NP_001031440.1| protein kinase APK1B [Arabidopsis thaliana]
 gb|AEC08191.1| protein kinase APK1B [Arabidopsis thaliana]
Length=415

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 87/116 (75%), Gaps = 1/116 (1%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MGICLS +IKA SP  PG S K + S     LG   S  S    P++EGEILQSPNLKSF
Sbjct  1    MGICLSAQIKAVSPGKPGASPKYMSSEANDSLGSKSSSVSIRTNPRTEGEILQSPNLKSF  60

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            TFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ +KPGTG+VIAVK+LN  G
Sbjct  61   TFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTGVVIAVKKLNQDG  116



>ref|XP_006365700.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Solanum 
tuberosum]
Length=394

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 84/116 (72%), Gaps = 8/116 (7%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG CLSVRIKAESP H G       ++DG  L    S +S P TP+S+ EIL+  NL SF
Sbjct  1    MGSCLSVRIKAESPLHHG-------ASDGRELSSRHSYSSAPLTPRSQSEILELSNLNSF  53

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F +L++ATR+FR DSVLGEGGFG VFKGWID+N+    +PGTGLVIAVKRLN  G
Sbjct  54   SFNELRVATRNFRPDSVLGEGGFGCVFKGWIDENTFKAARPGTGLVIAVKRLNQEG  109



>ref|XP_009118427.1| PREDICTED: protein kinase APK1A, chloroplastic [Brassica rapa]
 emb|CDY06271.1| BnaA09g49320D [Brassica napus]
Length=406

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 84/115 (73%), Gaps = 7/115 (6%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MGICLS ++KAESP            D   LG   S  S   +P++EGEILQSPNLKSF+
Sbjct  1    MGICLSAQVKAESP-------VASPKDTKSLGSKGSSVSVRPSPRTEGEILQSPNLKSFS  53

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F++LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ T+PGTGLVIAVK+LN  G
Sbjct  54   FSELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATRPGTGLVIAVKKLNQDG  108



>ref|XP_002322956.2| hypothetical protein POPTR_0016s11410g [Populus trichocarpa]
 gb|EEF04717.2| hypothetical protein POPTR_0016s11410g [Populus trichocarpa]
Length=428

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 92/125 (74%), Gaps = 13/125 (10%)
 Frame = +3

Query  213  LMMGICLSVRIKAES-PHPGLSSKCVISTDGSGLGKS-------DSKNSPPQTPKSEGEI  368
            ++MG+C S RIK+ +  + GLSSKC     GS  GK+        S  S PQTP+SEGEI
Sbjct  28   VLMGLCWSNRIKSYTCSNTGLSSKC-----GSRNGKTLSSSSSKVSIVSVPQTPRSEGEI  82

Query  369  LQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKR  548
            LQS NLK FTF +LK ATR+FR DSVLGEGGFG VFKGW+D++SL+ T+PGTG+VIAVKR
Sbjct  83   LQSSNLKIFTFGELKTATRNFRPDSVLGEGGFGSVFKGWVDEHSLAATRPGTGMVIAVKR  142

Query  549  LNHGG  563
            LN  G
Sbjct  143  LNQEG  147



>ref|XP_011011764.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Populus euphratica]
Length=275

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 91/123 (74%), Gaps = 13/123 (11%)
 Frame = +3

Query  219  MGICLSVRIKAES-PHPGLSSKCVISTDGSGLGKS-------DSKNSPPQTPKSEGEILQ  374
            MG+C S RIK+ +  + GLSSKC     GS  GK+        S  S PQTP+SEGEIL+
Sbjct  1    MGLCWSNRIKSYTCSNTGLSSKC-----GSRNGKTLSSSSSKVSIVSVPQTPRSEGEILE  55

Query  375  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  554
            S NLK+FTF +LK ATR+FR DSVLGEGGFG VFKGW+D++SL+ T+PGTG+VIA+KRLN
Sbjct  56   SSNLKTFTFGELKTATRNFRPDSVLGEGGFGSVFKGWVDEHSLAATRPGTGMVIALKRLN  115

Query  555  HGG  563
              G
Sbjct  116  QEG  118



>ref|XP_004249535.1| PREDICTED: probable serine/threonine-protein kinase NAK [Solanum 
lycopersicum]
Length=413

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 93/121 (77%), Gaps = 7/121 (6%)
 Frame = +3

Query  219  MGICLSVRIKAESPH---PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSP  380
            MGICLS +IKAE+      GL S+ V S +G+ +  S+SK S    P TP+SEGEILQS 
Sbjct  1    MGICLSNQIKAETTFYTVSGLDSRNV-SGNGTDISNSNSKRSSASIPPTPRSEGEILQSS  59

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            NL+SFTF +L+ ATR+FR DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN  
Sbjct  60   NLRSFTFNELRSATRNFRPDSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLNQE  119

Query  561  G  563
            G
Sbjct  120  G  120



>ref|XP_010557253.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Tarenaya hassleriana]
Length=432

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 92/118 (78%), Gaps = 6/118 (5%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQ---TPKSEGEILQSPNLK  389
            MGIC+S R+KAESP  G S K  +S+DG+  G   SK+S      TP++EGEILQSPNLK
Sbjct  24   MGICMSARVKAESP--GGSPK-YMSSDGNDKGSLGSKSSSMSVRPTPRTEGEILQSPNLK  80

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF F+DLK ATR+FR DSVLGEGGFG VFKGWID+ +L+ TKPGTG+VIAVKRLN  G
Sbjct  81   SFGFSDLKTATRNFRPDSVLGEGGFGCVFKGWIDEVALTATKPGTGMVIAVKRLNQDG  138



>gb|AAF79545.1|AC022464_3 F22G5.5 [Arabidopsis thaliana]
Length=464

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MGICLS ++KAES   G S+K      GS LG   S  S   +P++EGEILQSPNLKSF+
Sbjct  1    MGICLSAQVKAESS--GASTKYDAKDIGS-LGSKASSVSVRPSPRTEGEILQSPNLKSFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ ++PGTGLVIAVK+LN  G
Sbjct  58   FAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTASRPGTGLVIAVKKLNQDG  112



>gb|EYU41728.1| hypothetical protein MIMGU_mgv1a007413mg [Erythranthe guttata]
Length=408

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 90/121 (74%), Gaps = 6/121 (5%)
 Frame = +3

Query  219  MGICLSVRIKAESPH---PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSP  380
            MGIC S +IKAESP     G+ S  ++S DG  L  S SK S    P TP++EGEILQS 
Sbjct  1    MGICFSNQIKAESPFHTGTGVISSRMVSGDGIELSNSSSKRSSSSVPPTPRTEGEILQSS  60

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            NLKSF F+DLK ATR+FR DSVLGEGGFG VFKGWID+NSL+ +KPG+ LV+AVKRLN  
Sbjct  61   NLKSFGFSDLKAATRNFRPDSVLGEGGFGSVFKGWIDENSLAASKPGSSLVVAVKRLNQD  120

Query  561  G  563
            G
Sbjct  121  G  121



>gb|KJB76052.1| hypothetical protein B456_012G070600 [Gossypium raimondii]
Length=376

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 88/116 (76%), Gaps = 2/116 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG C S RIKAESP H G +S+   S +G  +G S S+ S    P++EGEILQS NLKSF
Sbjct  1    MGSCFSARIKAESPLHNGANSR-YGSKNGEEMGGSSSRVSSMSMPRTEGEILQSSNLKSF  59

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTGLVIAVKRLN  G
Sbjct  60   NFSELRTATRNFRPDSVLGEGGFGCVFKGWIDENSLTAAKPGTGLVIAVKRLNQEG  115



>ref|XP_010542646.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010542647.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
Length=398

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 87/118 (74%), Gaps = 6/118 (5%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQ---TPKSEGEILQSPNLK  389
            MGICLS ++KAE    G S K  +S+DG+  G   SK S      TP++EGEILQSP L 
Sbjct  1    MGICLSAQVKAEVS--GASPK-YMSSDGNQTGSMGSKASSVSVRPTPRTEGEILQSPTLN  57

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF+FA+LK ATR+FR DSVLGEGGFG VFKGWI + SL+ TKPGTGLVIAVKRLN  G
Sbjct  58   SFSFAELKAATRNFRPDSVLGEGGFGCVFKGWIHEQSLTATKPGTGLVIAVKRLNQDG  115



>gb|KJB36715.1| hypothetical protein B456_006G172600 [Gossypium raimondii]
Length=397

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 87/117 (74%), Gaps = 2/117 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSP--PQTPKSEGEILQSPNLKS  392
            MG+C S RIK+ SP  G++S+       +    S  ++S   PQTP+SEGEILQS NLK+
Sbjct  1    MGVCWSHRIKSVSPSTGVNSRNASRNGNNLSSSSSRESSASIPQTPRSEGEILQSSNLKT  60

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FTF++LK ATR+FR DSVLGEGGFG VFKGWID++S   TKPGTG++IAVKRLN  G
Sbjct  61   FTFSELKAATRNFRPDSVLGEGGFGSVFKGWIDEHSFKATKPGTGIIIAVKRLNQEG  117



>ref|XP_010043547.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010043548.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010043549.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010043550.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW85564.1| hypothetical protein EUGRSUZ_B02363 [Eucalyptus grandis]
 gb|KCW85565.1| hypothetical protein EUGRSUZ_B02363 [Eucalyptus grandis]
 gb|KCW85566.1| hypothetical protein EUGRSUZ_B02363 [Eucalyptus grandis]
Length=406

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 85/116 (73%), Gaps = 3/116 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNS---PPQTPKSEGEILQSPNLK  389
            MGICLS RIKAESP+   ++   I T  + L  + SK S    P T +SE EILQS N++
Sbjct  1    MGICLSARIKAESPYNTGTNTKSIGTSENDLSSNGSKTSSVLAPLTLRSECEILQSLNVQ  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
             F++ADL+MATR+FR DSVLGEGGFG VFKGWID+NS S  K GTG+VIAVK+LN 
Sbjct  61   IFSYADLRMATRNFRPDSVLGEGGFGSVFKGWIDENSFSAAKAGTGIVIAVKKLNQ  116



>ref|XP_009353659.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009353660.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Pyrus x bretschneideri]
Length=391

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 84/115 (73%), Gaps = 4/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGS--GLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MGICLS RIK ES      SKCV S DG         S  S P TP+SEGEIL+SPNLKS
Sbjct  1    MGICLSARIKVESS-VNTGSKCV-SNDGDLSSTSSKVSSFSAPPTPRSEGEILKSPNLKS  58

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            F++ DLK+ATR+FR DSVLGEGGFG VFKGWID+NS +  KPG+G+ +AVKRLN 
Sbjct  59   FSYNDLKLATRNFRPDSVLGEGGFGSVFKGWIDENSFTAAKPGSGIDLAVKRLNQ  113



>gb|KHG05340.1| Protein kinase APK1A, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG05994.1| Protein kinase APK1A, chloroplastic -like protein [Gossypium 
arboreum]
Length=411

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 88/116 (76%), Gaps = 2/116 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG C S RIKAESP H G +S+   S +G  +G S S+ S    P++EGEILQS NLKSF
Sbjct  1    MGSCFSARIKAESPLHNGANSR-YGSKNGEEMGGSSSRISSMSMPRTEGEILQSSNLKSF  59

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTGLVIAVKRLN  G
Sbjct  60   NFSELRTATRNFRPDSVLGEGGFGCVFKGWIDENSLTAAKPGTGLVIAVKRLNQEG  115



>ref|NP_001031439.1| protein kinase APK1B [Arabidopsis thaliana]
 sp|P46573.2|APK1B_ARATH RecName: Full=Protein kinase APK1B, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC33221.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM15075.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC08190.1| protein kinase APK1B [Arabidopsis thaliana]
Length=412

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 86/115 (75%), Gaps = 2/115 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MGICLS +IKA SP  G S K + S     LG   S  S    P++EGEILQSPNLKSFT
Sbjct  1    MGICLSAQIKAVSP--GASPKYMSSEANDSLGSKSSSVSIRTNPRTEGEILQSPNLKSFT  58

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ +KPGTG+VIAVK+LN  G
Sbjct  59   FAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTGVVIAVKKLNQDG  113



>gb|KJB76051.1| hypothetical protein B456_012G070600 [Gossypium raimondii]
 gb|KJB76053.1| hypothetical protein B456_012G070600 [Gossypium raimondii]
Length=411

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 88/116 (76%), Gaps = 2/116 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG C S RIKAESP H G +S+   S +G  +G S S+ S    P++EGEILQS NLKSF
Sbjct  1    MGSCFSARIKAESPLHNGANSR-YGSKNGEEMGGSSSRVSSMSMPRTEGEILQSSNLKSF  59

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTGLVIAVKRLN  G
Sbjct  60   NFSELRTATRNFRPDSVLGEGGFGCVFKGWIDENSLTAAKPGTGLVIAVKRLNQEG  115



>ref|XP_006417790.1| hypothetical protein EUTSA_v10007756mg [Eutrema salsugineum]
 gb|ESQ36143.1| hypothetical protein EUTSA_v10007756mg [Eutrema salsugineum]
Length=413

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MGICLS ++KAESP          + D   LG   S  S   +P++EGEILQSPNLKSF+
Sbjct  1    MGICLSAQVKAESPGASPKYTSSDAKDSGSLGSKGSSVSVRPSPRTEGEILQSPNLKSFS  60

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            FA+LK ATR+FR DSVLGEGGFG VFKGWID+ SL+ T+PGTGLVIAVK+LN  G
Sbjct  61   FAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTATRPGTGLVIAVKKLNQDG  115



>ref|XP_004490898.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cicer arietinum]
Length=397

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 90/119 (76%), Gaps = 9/119 (8%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGS---GLGKSDSKNSPPQTPKSEGEILQSPNL  386
            MG CLS RIKAESP   GLSSK     DGS   GL    +  + P TP++EGEIL S N+
Sbjct  1    MGCCLSARIKAESPPRNGLSSK-----DGSKDNGLSGRTTPTTGPPTPRTEGEILNSSNM  55

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSFTF++LK+ATR+FR DSV+GEGGFG VFKGWID++SL P KPGTG+VIAVKRLN  G
Sbjct  56   KSFTFSELKIATRNFRPDSVVGEGGFGAVFKGWIDEHSLVPVKPGTGVVIAVKRLNQEG  114



>ref|XP_009610451.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Nicotiana tomentosiformis]
Length=428

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 92/123 (75%), Gaps = 8/123 (7%)
 Frame = +3

Query  216  MMGICLSVRIKAESPH----PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQ  374
            +MGICLS +IK E+       GL S+   S +G+    S+SK S    P TP+SEGEILQ
Sbjct  14   LMGICLSYQIKTETTFYTAASGLDSRNA-SGNGTETSNSNSKRSSASIPPTPRSEGEILQ  72

Query  375  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  554
            S NL+S+TF++L+ ATR+FR DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN
Sbjct  73   SSNLRSYTFSELRAATRNFRPDSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLN  132

Query  555  HGG  563
              G
Sbjct  133  QEG  135



>ref|XP_011011763.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Populus euphratica]
Length=399

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 91/123 (74%), Gaps = 13/123 (11%)
 Frame = +3

Query  219  MGICLSVRIKAES-PHPGLSSKCVISTDGSGLGKS-------DSKNSPPQTPKSEGEILQ  374
            MG+C S RIK+ +  + GLSSKC     GS  GK+        S  S PQTP+SEGEIL+
Sbjct  1    MGLCWSNRIKSYTCSNTGLSSKC-----GSRNGKTLSSSSSKVSIVSVPQTPRSEGEILE  55

Query  375  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  554
            S NLK+FTF +LK ATR+FR DSVLGEGGFG VFKGW+D++SL+ T+PGTG+VIA+KRLN
Sbjct  56   SSNLKTFTFGELKTATRNFRPDSVLGEGGFGSVFKGWVDEHSLAATRPGTGMVIALKRLN  115

Query  555  HGG  563
              G
Sbjct  116  QEG  118



>emb|CDP06608.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 88/121 (73%), Gaps = 7/121 (6%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPG---LSSKCVISTDG---SGLGKSDSKNSPPQTPKSEGEILQSP  380
            MGICLS ++KAE P      ++S+ V S DG   S L    S  S  QTP+SEGEIL+S 
Sbjct  1    MGICLSQQVKAEFPFSSGTEVNSRNV-SEDGTQTSNLSSKASSFSMCQTPRSEGEILESS  59

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            NLKSFTF +LK ATR+FR DSVLGEGGFG VFKGWID+ S + +KPGTG+V+AVKRLN  
Sbjct  60   NLKSFTFGELKAATRNFRPDSVLGEGGFGSVFKGWIDEQSQAASKPGTGIVVAVKRLNQD  119

Query  561  G  563
            G
Sbjct  120  G  120



>ref|XP_010543301.1| PREDICTED: probable serine/threonine-protein kinase NAK [Tarenaya 
hassleriana]
Length=387

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 82/115 (71%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG+C S R+KA+       S   +S DGS   K  S  S    P+SEGEILQSPNLK+F 
Sbjct  1    MGVCFSNRVKADISSTTWLSSRFLSRDGS---KCSSTASFSHGPRSEGEILQSPNLKNFC  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F DLK ATR+FR DSV+GEGGFG VFKGWID+NS + +KPG+G+V+AVKRLN  G
Sbjct  58   FGDLKSATRNFRPDSVVGEGGFGSVFKGWIDENSFAASKPGSGIVVAVKRLNQEG  112



>gb|ACJ84452.1| unknown [Medicago truncatula]
Length=272

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 88/118 (75%), Gaps = 3/118 (3%)
 Frame = +3

Query  213  LMMGICLSVRIKAESP-HPGLSSKCVISTD--GSGLGKSDSKNSPPQTPKSEGEILQSPN  383
            +MMG C S ++KAESP H GL+SK V   +   SGL +  S +S   + ++EGEILQS  
Sbjct  1    MMMGCCFSAKVKAESPTHNGLNSKVVGREEDVSSGLSRRASSSSVLLSSRTEGEILQSNY  60

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            LK FT  +++ ATR+FR DS++GEGGFG VFKGWID+++L+PTKPGTG VIAVKRLN 
Sbjct  61   LKCFTINEVRAATRNFRPDSMIGEGGFGCVFKGWIDEHTLAPTKPGTGFVIAVKRLNQ  118



>emb|CDP00097.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 82/116 (71%), Gaps = 2/116 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG C S RIKAESP H G +S+ V S          S  S PQTP+SE EIL+S NL+SF
Sbjct  1    MGSCFSARIKAESPLHAGANSRYVSSDGRDS-SSRLSSASVPQTPRSESEILESSNLRSF  59

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F DLK ATR+FR DSVLGEGGFG VFKGW+D++S    KPGTGLVIAVKRLN  G
Sbjct  60   GFNDLKTATRNFRPDSVLGEGGFGCVFKGWVDQHSCKAAKPGTGLVIAVKRLNQEG  115



>ref|XP_009610452.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Nicotiana tomentosiformis]
Length=414

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 91/122 (75%), Gaps = 8/122 (7%)
 Frame = +3

Query  219  MGICLSVRIKAESPH----PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQS  377
            MGICLS +IK E+       GL S+   S +G+    S+SK S    P TP+SEGEILQS
Sbjct  1    MGICLSYQIKTETTFYTAASGLDSRNA-SGNGTETSNSNSKRSSASIPPTPRSEGEILQS  59

Query  378  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
             NL+S+TF++L+ ATR+FR DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN 
Sbjct  60   SNLRSYTFSELRAATRNFRPDSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLNQ  119

Query  558  GG  563
             G
Sbjct  120  EG  121



>gb|ACG32116.1| protein kinase APK1B [Zea mays]
Length=419

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 83/120 (69%), Gaps = 5/120 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVIST--DGSGLGKSDSKNSPPQTP---KSEGEILQSPN  383
            MG C   RIK  SPHPG S     S+  DGS L    S+ S    P   K+E EILQS N
Sbjct  1    MGNCWGARIKDGSPHPGASGMFSKSSGKDGSRLSGCSSRASSASMPPSAKTECEILQSAN  60

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +K FTF +LK ATR+FR DSVLGEGGFG V+KGWID+N+LSP +PGTG+ +AVKRLNH G
Sbjct  61   VKIFTFNNLKAATRNFRPDSVLGEGGFGSVYKGWIDENTLSPCRPGTGIAVAVKRLNHEG  120



>ref|XP_009772470.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
 ref|XP_009772475.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
 ref|XP_009772479.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
Length=415

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 91/122 (75%), Gaps = 8/122 (7%)
 Frame = +3

Query  219  MGICLSVRIKAES----PHPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQS  377
            MGICLS +IK E+       GL S+   S +G+    S+SK S    P TP+SEGEILQS
Sbjct  1    MGICLSYQIKTETTFYTASSGLDSRNA-SGNGTETSNSNSKRSSASIPPTPRSEGEILQS  59

Query  378  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
             NL+S+TF++L+ ATR+FR DSV+GEGGFG VFKGW+D+++L+ +KPGTG+VIAVK+LN 
Sbjct  60   SNLRSYTFSELRAATRNFRPDSVVGEGGFGSVFKGWVDEHTLAASKPGTGIVIAVKKLNQ  119

Query  558  GG  563
             G
Sbjct  120  EG  121



>ref|XP_004487004.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Cicer arietinum]
 ref|XP_004487005.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X4 
[Cicer arietinum]
Length=428

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 79/102 (77%), Gaps = 3/102 (3%)
 Frame = +3

Query  267  GLSSKCV--ISTDGSGLGKS-DSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRL  437
            GL+SK    I  D S    S DS  S PQTP+SEGEILQS NLKS+T A+LK ATR+FR 
Sbjct  5    GLNSKSAGSIGNDLSSTNNSKDSAVSVPQTPRSEGEILQSSNLKSYTLAELKAATRNFRP  64

Query  438  DSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            DSVLGEGGFG VFKGWID+NSL+ TKPGTG+VIAVKRLN  G
Sbjct  65   DSVLGEGGFGSVFKGWIDENSLAATKPGTGIVIAVKRLNQDG  106



>ref|XP_009404596.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=414

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 86/119 (72%), Gaps = 4/119 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKC---VISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNL  386
            MG C   +IKAESP H   +S       S +G     S SK S P TP+SE EILQS N+
Sbjct  1    MGNCWGAKIKAESPSHSAFASGTNSKYGSREGKAFSSSSSKVSVPPTPRSEDEILQSSNV  60

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSFTF++LK ATR+FR DSVLGEGGFG VFKGW+D+++ +PTKPGTG+VIAVK+LN  G
Sbjct  61   KSFTFSELKTATRNFRPDSVLGEGGFGSVFKGWVDEHTFAPTKPGTGMVIAVKKLNQDG  119



>gb|AFK44181.1| unknown [Lotus japonicus]
Length=401

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 88/123 (72%), Gaps = 11/123 (9%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSK-------CVISTDGSGLGKSDSKNSPPQTPKSEGEILQ  374
            MG C S RIKAESP   GLSSK       C+   +G+      S  S P TP++EGEIL+
Sbjct  1    MGCCFSARIKAESPPRNGLSSKDGCRSEDCL---NGASSSSKVSIPSMPPTPRTEGEILK  57

Query  375  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  554
            S N+KSFTF +LK +TR+FR DS++GEGGFG V+KGWID+ SL+P +PGTG+VIAVKRLN
Sbjct  58   SSNMKSFTFGELKTSTRNFRPDSMVGEGGFGCVYKGWIDEQSLAPARPGTGMVIAVKRLN  117

Query  555  HGG  563
              G
Sbjct  118  QEG  120



>gb|KEH34697.1| tyrosine kinase family protein [Medicago truncatula]
Length=399

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 88/117 (75%), Gaps = 3/117 (3%)
 Frame = +3

Query  213  LMMGICLSVRIKAESP-HPGLSSKCVISTD--GSGLGKSDSKNSPPQTPKSEGEILQSPN  383
            +MMG C S ++KAESP H GL+SK V   +   SGL +  S +S   + ++EGEILQS  
Sbjct  1    MMMGCCFSAKVKAESPTHNGLNSKVVGREEDVSSGLSRRASSSSVLLSSRTEGEILQSNY  60

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  554
            LK FT  +++ ATR+FR DS++GEGGFG VFKGWID+++L+PTKPGTG VIAVKRLN
Sbjct  61   LKCFTINEVRAATRNFRPDSMIGEGGFGCVFKGWIDEHTLAPTKPGTGFVIAVKRLN  117



>gb|KDO51148.1| hypothetical protein CISIN_1g015909mg [Citrus sinensis]
Length=398

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 90/119 (76%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  386
            MG C S RIKAE+P H  ++SK   S D   L  S  K S    PQTP+SEGEILQS N+
Sbjct  1    MGACCSNRIKAETPSHTDVNSKYS-SRDAKSLSSSSGKASSFSLPQTPRSEGEILQSSNI  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            K+F+++DL+ ATR+FR DSVLGEGGFG VFKGW+D++SL+ T+PGTG++IAVKRLN  G
Sbjct  60   KNFSYSDLRTATRNFRPDSVLGEGGFGSVFKGWVDEHSLASTRPGTGMLIAVKRLNQEG  118



>gb|KEH34700.1| tyrosine kinase family protein [Medicago truncatula]
Length=407

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 88/117 (75%), Gaps = 3/117 (3%)
 Frame = +3

Query  213  LMMGICLSVRIKAESP-HPGLSSKCVISTD--GSGLGKSDSKNSPPQTPKSEGEILQSPN  383
            +MMG C S ++KAESP H GL+SK V   +   SGL +  S +S   + ++EGEILQS  
Sbjct  1    MMMGCCFSAKVKAESPTHNGLNSKVVGREEDVSSGLSRRASSSSVLLSSRTEGEILQSNY  60

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  554
            LK FT  +++ ATR+FR DS++GEGGFG VFKGWID+++L+PTKPGTG VIAVKRLN
Sbjct  61   LKCFTINEVRAATRNFRPDSMIGEGGFGCVFKGWIDEHTLAPTKPGTGFVIAVKRLN  117



>ref|XP_006429091.1| hypothetical protein CICLE_v10011895mg [Citrus clementina]
 ref|XP_006480830.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Citrus sinensis]
 gb|ESR42331.1| hypothetical protein CICLE_v10011895mg [Citrus clementina]
Length=398

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 89/119 (75%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTD---GSGLGKSDSKNSPPQTPKSEGEILQSPNL  386
            MG C S RIKAE+P H  ++SK   S D    S      S  S PQTP+SEGEILQS N+
Sbjct  1    MGACCSNRIKAETPSHTDVNSKYS-SRDVKSLSSSSGKASSFSLPQTPRSEGEILQSSNI  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            K+F+++DLK ATR+FR DSVLGEGGFG VFKGW+D++SL+ T+PGTG++IAVKRLN  G
Sbjct  60   KNFSYSDLKTATRNFRPDSVLGEGGFGSVFKGWVDEHSLTSTRPGTGMLIAVKRLNQEG  118



>gb|KJB20072.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
Length=400

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +3

Query  339  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  518
            P TP+SEGEILQSPNLKSF+FADLKMATR+FR DSVLGEGGFG VFKGW+D+NS + TKP
Sbjct  39   PLTPRSEGEILQSPNLKSFSFADLKMATRNFRPDSVLGEGGFGSVFKGWVDENSFTATKP  98

Query  519  GTGLVIAVKRLNHGG  563
            G+G+VIAVKRLN  G
Sbjct  99   GSGIVIAVKRLNQDG  113



>ref|NP_001145874.1| uncharacterized protein LOC100279389 [Zea mays]
 gb|ACL52773.1| unknown [Zea mays]
Length=419

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 83/120 (69%), Gaps = 5/120 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVIST--DGSGLGKSDSKNSPPQTP---KSEGEILQSPN  383
            MG C   RIK  SPHPG S     S+  DGS L    S+ S    P   K+E EIL+S N
Sbjct  1    MGNCWGARIKDGSPHPGASGMFSKSSGKDGSRLSGCSSRASSASMPPSAKTECEILRSAN  60

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +K FTF +LK ATR+FR DSVLGEGGFG V+KGWID+N+LSP +PGTG+ +AVKRLNH G
Sbjct  61   VKIFTFNNLKAATRNFRPDSVLGEGGFGSVYKGWIDENTLSPCRPGTGIAVAVKRLNHEG  120



>ref|XP_009588344.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
tomentosiformis]
Length=417

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 87/121 (72%), Gaps = 7/121 (6%)
 Frame = +3

Query  219  MGICLSVRIKAESPH---PGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSP  380
            MGICLS +IKAE+      G+ S+ V S DG+    S SK S    P TP+SEGEILQS 
Sbjct  1    MGICLSNQIKAETTFYTGTGIGSRNV-SGDGTETSNSYSKRSSGSVPPTPRSEGEILQSS  59

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            NL+SFTF +L+ ATR+FR DSV+GEGGFG VFKGW+D  +L  +KPG G+VIAVK+LN  
Sbjct  60   NLRSFTFNELRAATRNFRPDSVVGEGGFGSVFKGWVDDQTLVASKPGAGIVIAVKKLNQE  119

Query  561  G  563
            G
Sbjct  120  G  120



>ref|XP_010047712.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Eucalyptus 
grandis]
Length=398

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +3

Query  267  GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSV  446
            G+SSK V S DG+ L    S  S PQTP+S+GEILQS NLK+F+F++L+ ATR+FR DSV
Sbjct  9    GVSSKNV-SHDGNDLSSRISSASGPQTPRSQGEILQSSNLKNFSFSELRTATRNFRPDSV  67

Query  447  LGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            LGEGGFG VFKGWID+ +L+P +PGTG+++AVKRLN  G
Sbjct  68   LGEGGFGAVFKGWIDEQTLAPARPGTGMIVAVKRLNQEG  106



>ref|XP_010922319.1| PREDICTED: probable serine/threonine-protein kinase NAK [Elaeis 
guineensis]
Length=409

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 87/122 (71%), Gaps = 7/122 (6%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVIST----DGSGLGKSDSKNSP---PQTPKSEGEILQS  377
            MG C SVRIKAESP    S+  V S     DG+GL  S S+ S    P T +SE EILQ 
Sbjct  1    MGNCWSVRIKAESPFHSASASGVNSRNNGKDGNGLSGSSSRVSSSSVPLTCRSEDEILQC  60

Query  378  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
              L+ F F+DLK ATR+FR DSVLGEGGFG VFKGWID+++L+ +KPGTG+VIAVKRLNH
Sbjct  61   SKLRCFAFSDLKTATRNFRPDSVLGEGGFGSVFKGWIDEHALTASKPGTGMVIAVKRLNH  120

Query  558  GG  563
             G
Sbjct  121  DG  122



>gb|ACF87678.1| unknown [Zea mays]
 tpg|DAA52220.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=419

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 83/120 (69%), Gaps = 5/120 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVIST--DGSGLGKSDSKNSPPQTP---KSEGEILQSPN  383
            MG C   RIK  SPHPG S     S+  DGS L    S+ S    P   K+E EIL+S N
Sbjct  1    MGNCWGARIKDGSPHPGASGMFSKSSGKDGSRLSGCSSRASSASMPPSAKTECEILRSAN  60

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +K FTF +LK ATR+FR DSVLGEGGFG V+KGWID+N+LSP +PGTG+ +AVKRLNH G
Sbjct  61   VKIFTFNNLKAATRNFRPDSVLGEGGFGSVYKGWIDENTLSPCRPGTGIAVAVKRLNHEG  120



>ref|XP_008240890.1| PREDICTED: probable serine/threonine-protein kinase NAK [Prunus 
mume]
Length=396

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 83/116 (72%), Gaps = 6/116 (5%)
 Frame = +3

Query  219  MGICLSVRIKAE-SPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG+C S +IKAE S H G +SK     +GS      S  S P TP+SEGEILQS  LKS 
Sbjct  1    MGVCWSNKIKAETSSHTGFNSK-----NGSASNSKASSGSMPVTPRSEGEILQSTKLKSI  55

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F++LK ATR+FR DSVLG+GGFG VFKGWID++SL  TK GTG+VIAVKRLN  G
Sbjct  56   GFSELKNATRNFRPDSVLGDGGFGSVFKGWIDESSLIATKAGTGMVIAVKRLNQDG  111



>ref|XP_010534501.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Tarenaya 
hassleriana]
Length=396

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 90/117 (77%), Gaps = 4/117 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTP--KSEGEILQSPNLKS  392
            MG CLS  I+A+SP P  ++    S+D  GL  S S+ SP  T   K+EGEILQS ++KS
Sbjct  1    MGSCLSCLIEAQSP-PRDANSSEKSSDLYGLSLS-SRKSPITTASHKTEGEILQSASVKS  58

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F+F +LK+ATR+FR DSV+GEGGFG VFKGWID+++L+PTKPGTGLVIAVKRLN  G
Sbjct  59   FSFNELKLATRNFRPDSVIGEGGFGSVFKGWIDESTLTPTKPGTGLVIAVKRLNQEG  115



>ref|XP_009140954.1| PREDICTED: protein kinase APK1B, chloroplastic [Brassica rapa]
Length=418

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 85/118 (72%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MGICLS +IKAESP + G S K + S   D   +G   S  S    P++EGEILQSPNLK
Sbjct  1    MGICLSAQIKAESPSNTGASPKYMSSEANDTQSMGSKGSSVSIRTNPRTEGEILQSPNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF+ A++K  TR+FR D VLGEGGFG VFKGWI + SL+ +KPGTG+VIAVKR+N  G
Sbjct  61   SFSVAEVKSETRNFRPDIVLGEGGFGCVFKGWIYEQSLTASKPGTGMVIAVKRINQDG  118



>ref|XP_011077648.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Sesamum 
indicum]
Length=417

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 90/123 (73%), Gaps = 8/123 (7%)
 Frame = +3

Query  219  MGICLSVRIKAESPHP-----GLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQ  374
            MGICLS +IKAES        G +S  V+S  G+ L  S SKNS    P TP+SEGEILQ
Sbjct  1    MGICLSNQIKAESSFHTGTDVGATSSKVVSGYGTELSNSSSKNSSISVPPTPRSEGEILQ  60

Query  375  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  554
            S NLKSFTF+DLK ATR+FR DSV+GEGGFG VFKGWID+ SL+ ++ G G+V+AVK+LN
Sbjct  61   SSNLKSFTFSDLKAATRNFRPDSVIGEGGFGSVFKGWIDEQSLAASRAGAGMVVAVKKLN  120

Query  555  HGG  563
              G
Sbjct  121  QEG  123



>ref|XP_006846202.1| hypothetical protein AMTR_s00012p00221000 [Amborella trichopoda]
 gb|ERN07877.1| hypothetical protein AMTR_s00012p00221000 [Amborella trichopoda]
Length=405

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 89/130 (68%), Gaps = 23/130 (18%)
 Frame = +3

Query  219  MGICLS----VRIKAESPHPGLSSKCVISTDGSGL-GKSDSK-----NSPPQ-----TPK  353
            MG C S     R+KAESP        + S   SGL  +S SK     NSPP      TPK
Sbjct  1    MGNCWSWNWSARVKAESP--------LHSVPASGLDSRSSSKDGVDPNSPPSGSVPPTPK  52

Query  354  SEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLV  533
            SEGEILQS N+KSF+FA+LK ATR+FR DSVLGEGGFG VFKGWID+++ +PTKPGTG+V
Sbjct  53   SEGEILQSSNVKSFSFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEHTFAPTKPGTGIV  112

Query  534  IAVKRLNHGG  563
            IAVKR N  G
Sbjct  113  IAVKRHNQDG  122



>ref|XP_007009313.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY18123.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=347

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG C S RIKAESP H   +S       G+G+  S S+ S     ++EGEILQS NLKSF
Sbjct  1    MGSCFSARIKAESPLHNEANSGHGGGKYGNGMSGSSSRISSVSVARTEGEILQSSNLKSF  60

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F++L+ ATR+FR DSVLGEGGFG VFKGW+D+NSL+  KPGTG+VIAVKRLN  G
Sbjct  61   SFSELRTATRNFRPDSVLGEGGFGCVFKGWVDENSLTAAKPGTGMVIAVKRLNQEG  116



>gb|KHN47889.1| Protein kinase APK1B, chloroplastic [Glycine soja]
Length=413

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 90/117 (77%), Gaps = 6/117 (5%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  386
            MG C S RIK+ SP + G +S+ V S DG  +  S+S+NS    P TP+SEGEILQS NL
Sbjct  1    MGACWSSRIKSVSPSNTGFTSRSV-SRDGYDI-HSNSRNSSASIPMTPRSEGEILQSSNL  58

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            KS+++ +LKMAT++F  DSVLGEGGFG VFKGWID++SL+ T+ GTG+V+AVK+LN 
Sbjct  59   KSYSYNELKMATKNFCPDSVLGEGGFGSVFKGWIDEHSLAVTRAGTGMVVAVKKLNQ  115



>ref|XP_003522100.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Glycine max]
Length=414

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 90/117 (77%), Gaps = 6/117 (5%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  386
            MG C S RIK+ SP + G +S+ V S DG  +  S+S+NS    P TP+SEGEILQS NL
Sbjct  1    MGACWSSRIKSVSPSNTGFTSRSV-SRDGYDI-HSNSRNSSASIPMTPRSEGEILQSSNL  58

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            KS+++ +LKMAT++F  DSVLGEGGFG VFKGWID++SL+ T+ GTG+V+AVK+LN 
Sbjct  59   KSYSYNELKMATKNFCPDSVLGEGGFGSVFKGWIDEHSLAVTRAGTGMVVAVKKLNQ  115



>ref|XP_007009312.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18122.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=410

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG C S RIKAESP H   +S       G+G+  S S+ S     ++EGEILQS NLKSF
Sbjct  1    MGSCFSARIKAESPLHNEANSGHGGGKYGNGMSGSSSRISSVSVARTEGEILQSSNLKSF  60

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F++L+ ATR+FR DSVLGEGGFG VFKGW+D+NSL+  KPGTG+VIAVKRLN  G
Sbjct  61   SFSELRTATRNFRPDSVLGEGGFGCVFKGWVDENSLTAAKPGTGMVIAVKRLNQEG  116



>ref|XP_011091519.1| PREDICTED: probable serine/threonine-protein kinase NAK [Sesamum 
indicum]
Length=397

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 85/117 (73%), Gaps = 3/117 (3%)
 Frame = +3

Query  219  MGICLSVRIKAE-SPH-PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MG C SVRI+A+ SP   GLSS+ V S DG       S +S P TP++EGEIL S NLKS
Sbjct  1    MGSCCSVRIRADHSPRRDGLSSRFV-SVDGKDTSSRRSSSSMPLTPRNEGEILDSSNLKS  59

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F F DL++ATR+FR DSVLGEGGFG VFKGWID+++    KPGTG VIAVKRLN  G
Sbjct  60   FGFNDLRIATRNFRPDSVLGEGGFGCVFKGWIDEHTFKAAKPGTGTVIAVKRLNQEG  116



>gb|KDP44953.1| hypothetical protein JCGZ_01453 [Jatropha curcas]
Length=415

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 82/118 (69%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKC--VISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MG C SVRIKAESP H G   K       + S      S  + P TP++EGEILQS NLK
Sbjct  1    MGSCFSVRIKAESPFHHGADPKYGGRAGHEVSRSSSKYSSATVPSTPRTEGEILQSSNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SFTF++L+ ATR+FR DS+LGEGGFG VFKGWID+ +L+  KPG G VIAVKRLN  G
Sbjct  61   SFTFSELRAATRNFRPDSMLGEGGFGSVFKGWIDEQTLTAAKPGMGTVIAVKRLNQDG  118



>ref|XP_009766459.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
Length=416

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 88/121 (73%), Gaps = 7/121 (6%)
 Frame = +3

Query  219  MGICLSVRIKAESP---HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSP  380
            MGICLS +IKAE+      G+ S+ V S +G+    S SK S    P TP+SEGEILQS 
Sbjct  1    MGICLSNQIKAETTIFTGTGIGSRNV-SGNGTETSNSYSKRSSGSVPPTPRSEGEILQSS  59

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            NL+SFTF +L+ ATR+FR DSV+GEGGFG VFKGW+D+ +L  +KPG G+VIAVK+LN  
Sbjct  60   NLRSFTFNELRAATRNFRPDSVVGEGGFGSVFKGWVDEQTLVASKPGAGIVIAVKKLNQE  119

Query  561  G  563
            G
Sbjct  120  G  120



>ref|XP_004239839.1| PREDICTED: probable serine/threonine-protein kinase NAK [Solanum 
lycopersicum]
Length=409

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 90/118 (76%), Gaps = 5/118 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPH---PGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MGICLS +IKAE+      GL S+ V S +G+ +  S+SK+SP  TP+SEGEILQS NL+
Sbjct  1    MGICLSNQIKAETTFYTVSGLDSRNV-SGNGTDISNSNSKHSPT-TPRSEGEILQSSNLR  58

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SFT ++L+ ATR+F  DSV+ EGGFG VFKGW+D+++L+ + PGTG+VIAVK L+  G
Sbjct  59   SFTLSELRSATRNFHRDSVVVEGGFGSVFKGWVDEHTLAASMPGTGIVIAVKNLDQEG  116



>ref|XP_008784589.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=415

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 83/121 (69%), Gaps = 6/121 (5%)
 Frame = +3

Query  219  MGICLSVRIKAESPH-----PGLSSKCVISTDGSGLGKSDSKNSP-PQTPKSEGEILQSP  380
            MG C   R+KAESP       G++SKC           S    +  P TP+SEGEILQS 
Sbjct  1    MGNCWGARVKAESPSHNGFASGMNSKCSSGDGKGSGSSSRVSAASVPPTPRSEGEILQSS  60

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            N+KSFTF +L+ ATR+FR DSVLGEGGFG VFKGWID+++ + TKPGTG+VIAVK+LN  
Sbjct  61   NVKSFTFNELRNATRNFRPDSVLGEGGFGSVFKGWIDEHTFAATKPGTGIVIAVKKLNQE  120

Query  561  G  563
            G
Sbjct  121  G  121



>ref|XP_010558327.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010558328.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Tarenaya hassleriana]
Length=392

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 84/115 (73%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S R+KA+       S   +S DGS   KS S  S    P+SEGEILQSPNLK+F+
Sbjct  1    MGACFSNRVKADISSSTWLSSRFLSRDGS---KSSSTTSFSHNPRSEGEILQSPNLKNFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F++LK ATR+FR DSV+GEGGFG VFKGWID+NS S +KPG+G+VIAVKRLN  G
Sbjct  58   FSELKSATRNFRPDSVVGEGGFGSVFKGWIDENSFSASKPGSGIVIAVKRLNQEG  112



>ref|XP_010030960.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW50195.1| hypothetical protein EUGRSUZ_J00006 [Eucalyptus grandis]
Length=409

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNL  386
            MG CLS +I AESP H G++       DG+    + S+ S    PQTP++EGEILQS NL
Sbjct  1    MGSCLSSQIIAESPLHKGVN--FFNRGDGNDSSDASSRASSLSVPQTPRTEGEILQSSNL  58

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KSF F DLK ATR+FR DSVLGEGGFG VFKGWID+ + +  +PGTGLVIAVKRLN  G
Sbjct  59   KSFAFNDLKTATRNFRPDSVLGEGGFGCVFKGWIDEQTFTAARPGTGLVIAVKRLNQEG  117



>ref|XP_004981243.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Setaria 
italica]
Length=416

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 82/120 (68%), Gaps = 5/120 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTP---KSEGEILQSPN  383
            MG C   RIK  SPHPG S     S   DGS L    S+ S    P   K+E EILQS N
Sbjct  1    MGNCWGARIKDGSPHPGASGMFSKSGGKDGSRLSGCSSRASSASMPPNAKTECEILQSAN  60

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +K F+F++LK ATR+FR DSVLGEGGFG V+KGWID+N+L+P +PGTG+ +AVKRLN  G
Sbjct  61   VKVFSFSNLKSATRNFRPDSVLGEGGFGSVYKGWIDENTLAPCRPGTGIAVAVKRLNQEG  120



>ref|XP_011027201.1| PREDICTED: protein kinase APK1A, chloroplastic [Populus euphratica]
Length=415

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 3/116 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCV--ISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MG C S RIKAESP   G+++K       D SG     S ++ P TP+++GEILQS NLK
Sbjct  1    MGSCFSARIKAESPPRNGVNTKYAGKSGNDKSGSSSKVSSSTVPSTPRTQGEILQSSNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            SF+F++LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGTG VIAVKRLN 
Sbjct  61   SFSFSELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGTGTVIAVKRLNQ  116



>ref|XP_010920578.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Elaeis guineensis]
Length=420

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 88/129 (68%), Gaps = 15/129 (12%)
 Frame = +3

Query  219  MGICLSVRIKAESPHP------------GLSSKCVISTDGSGLGKSDSKNSP--PQTPKS  356
            MG C   ++KAESP              G++SKC  S DG G   S   ++   P TP+S
Sbjct  1    MGNCWGAQVKAESPSNNVSASDIMFGCLGVNSKCS-SRDGKGSVSSSRVSAASVPPTPRS  59

Query  357  EGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVI  536
            EGEILQS N+KSFTF +L+ ATR+FR DSVLGEGGFG VFKGWID+++ + TKPGTG+VI
Sbjct  60   EGEILQSSNVKSFTFNELRNATRNFRPDSVLGEGGFGSVFKGWIDEHTFAATKPGTGIVI  119

Query  537  AVKRLNHGG  563
            AVK+LN  G
Sbjct  120  AVKKLNQEG  128



>ref|XP_007027015.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY07517.1| Kinase superfamily protein [Theobroma cacao]
Length=398

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 84/118 (71%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLK  389
            MG C S RIK+ SP     +    S +G+ L  S S+ S    PQ P+SEGEILQS NLK
Sbjct  1    MGACWSNRIKSVSPSTTGVNSTSASRNGNNLSGSSSRVSSASVPQAPRSEGEILQSSNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             FTF++L+ ATR+FR DSVLGEGGFG VFKGWID++SL+ TKPGTG+VIA KRL   G
Sbjct  61   VFTFSELRTATRNFRPDSVLGEGGFGSVFKGWIDEHSLTATKPGTGIVIAAKRLKQEG  118



>ref|XP_009414323.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=417

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 85/122 (70%), Gaps = 7/122 (6%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGK-------SDSKNSPPQTPKSEGEILQS  377
            MG C   ++KAESP  G  +  + S   S  GK         S  S P TP+SEGEILQS
Sbjct  1    MGNCWGAQVKAESPSDGFFASGLHSKSSSRDGKKLSGSSSKVSAASVPPTPRSEGEILQS  60

Query  378  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
             N+KSFTF +L++ATR+FR DSV+GEGGFG VFKGWID+++L+  KPGTG+VIAVK+LN 
Sbjct  61   VNVKSFTFTELRIATRNFRPDSVVGEGGFGSVFKGWIDEHTLAAAKPGTGVVIAVKKLNQ  120

Query  558  GG  563
             G
Sbjct  121  EG  122



>ref|XP_010111458.1| putative serine/threonine-protein kinase NAK [Morus notabilis]
 gb|EXC30981.1| putative serine/threonine-protein kinase NAK [Morus notabilis]
Length=394

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 84/116 (72%), Gaps = 7/116 (6%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG C S RIKAESP H G +SK   S+         S  S P TP+SE +IL+SPN+KSF
Sbjct  1    MGACWSNRIKAESPYHTGFNSKSTNSS------GKSSSFSAPLTPRSEDDILRSPNIKSF  54

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F++LK ATR+FR DSVLGEGGFG VFKGWID+  L+  KPGTG+VIAVKRLN  G
Sbjct  55   SFSELKTATRNFRPDSVLGEGGFGSVFKGWIDEQLLTAAKPGTGIVIAVKRLNQEG  110



>ref|XP_002316286.1| hypothetical protein POPTR_0010s21090g [Populus trichocarpa]
 gb|EEF02457.1| hypothetical protein POPTR_0010s21090g [Populus trichocarpa]
Length=415

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 85/121 (70%), Gaps = 13/121 (11%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQ--------TPKSEGEILQ  374
            MG C S RIKAESP     S+   +T  +G G +D   S  +        TP+++GEILQ
Sbjct  1    MGSCFSARIKAESP-----SRNGGNTKYAGKGGNDKSGSSSKVSSSTVPSTPRTQGEILQ  55

Query  375  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  554
            S NLKSF+F++LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGTG VIAVKRLN
Sbjct  56   SSNLKSFSFSELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGTGTVIAVKRLN  115

Query  555  H  557
             
Sbjct  116  Q  116



>ref|XP_009143298.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Brassica 
rapa]
 emb|CDX74847.1| BnaA05g05930D [Brassica napus]
Length=382

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S R+KAE+P     S  +      GL  S  K++     K+EGEIL+S  +K+FT
Sbjct  1    MGSCFSSRVKAENPFNDGKSSVLY-----GLSMSSRKSTVAAAQKTEGEILESTPVKNFT  55

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+ SL+PTKPGTGLVIAVK+LN  G
Sbjct  56   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDETSLTPTKPGTGLVIAVKKLNREG  110



>gb|KHG15912.1| Protein kinase APK1A, chloroplastic [Gossypium arboreum]
Length=386

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 81/117 (69%), Gaps = 16/117 (14%)
 Frame = +3

Query  219  MGICLSVRIKA-ESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MG C S RIKA ESP H G++                SK SP   P++EG+ILQ+ NLKS
Sbjct  1    MGSCFSSRIKAAESPLHHGVNL--------------SSKMSPVSVPRTEGDILQASNLKS  46

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F F DL+ ATR+FR DSVLGEGGFG VFKGWID+N+ + +KPGTG+VIAVKRLN  G
Sbjct  47   FNFNDLRTATRNFRPDSVLGEGGFGCVFKGWIDENTFTASKPGTGMVIAVKRLNQEG  103



>ref|XP_010490647.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
 ref|XP_010490648.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
Length=400

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 81/115 (70%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGGCFSNRIKTDIASSTWLSSKFLSRDGS---KGSSNTSFSHMPRTEGEILQNANLKNFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             ++LK ATR+FR DSV+GEGGFG VFKGWID+ SL+P+KPGTG+VIAVKRLN  G
Sbjct  58   LSELKSATRNFRPDSVVGEGGFGCVFKGWIDEASLAPSKPGTGIVIAVKRLNQEG  112



>ref|XP_006573305.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Glycine 
max]
 gb|KHN19150.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=413

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 87/116 (75%), Gaps = 4/116 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP--PQTPKSEGEILQSPNLK  389
            MG C S RIKA SP + G +S+ V S DG  +  S   +S   P TP+SEGEILQ  NLK
Sbjct  1    MGACWSSRIKAVSPSNTGFTSRSV-SRDGHDIQSSSRNSSASIPMTPRSEGEILQFSNLK  59

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            S+++ +LKMAT++F  DSVLGEGGFG VFKGWID++SL+ T+PGTG+VIAVK+LN 
Sbjct  60   SYSYNELKMATKNFCPDSVLGEGGFGSVFKGWIDEHSLAVTRPGTGMVIAVKKLNQ  115



>ref|XP_011030315.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Populus 
euphratica]
Length=415

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 86/116 (74%), Gaps = 3/116 (3%)
 Frame = +3

Query  219  MGICLSVRIKAES-PHPGLSSKCV--ISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MG C S R+KAES P  G+++K       D SG     S ++ P TP+++GEILQS NLK
Sbjct  1    MGSCFSARVKAESLPCNGVNTKYAGRSGNDRSGSSSKVSSSTVPSTPRTQGEILQSSNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            SF+F +LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGTG+VIAVKRLN 
Sbjct  61   SFSFNELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGTGIVIAVKRLNQ  116



>gb|AAA18853.1| protein kinase [Arabidopsis thaliana]
Length=389

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 82/115 (71%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGGCFSNRIKTDIASSTWLSSKFLSRDGS---KGSSTASFSYMPRTEGEILQNANLKNFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             ++LK ATR+FR DSV+GEGGFG VFKGWID++SL+P+KPGTG+VIAVKRLN  G
Sbjct  58   LSELKSATRNFRPDSVVGEGGFGCVFKGWIDESSLAPSKPGTGIVIAVKRLNQEG  112



>ref|NP_195849.1| putative serine/threonine-protein kinase NAK [Arabidopsis thaliana]
 ref|NP_850755.1| putative serine/threonine-protein kinase NAK [Arabidopsis thaliana]
 sp|P43293.2|NAK_ARATH RecName: Full=Probable serine/threonine-protein kinase NAK [Arabidopsis 
thaliana]
 emb|CAB85534.1| serine/threonine-specific protein kinase NAK [Arabidopsis thaliana]
 gb|AAM63816.1| serine/threonine-specific protein kinase NAK [Arabidopsis thaliana]
 dbj|BAF00769.1| serine/threonine-specific protein kinase NAK [Arabidopsis thaliana]
 gb|AED90455.1| putative serine/threonine-protein kinase NAK [Arabidopsis thaliana]
 gb|AED90456.1| putative serine/threonine-protein kinase NAK [Arabidopsis thaliana]
Length=389

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 82/115 (71%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGGCFSNRIKTDIASSTWLSSKFLSRDGS---KGSSTASFSYMPRTEGEILQNANLKNFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             ++LK ATR+FR DSV+GEGGFG VFKGWID++SL+P+KPGTG+VIAVKRLN  G
Sbjct  58   LSELKSATRNFRPDSVVGEGGFGCVFKGWIDESSLAPSKPGTGIVIAVKRLNQEG  112



>ref|XP_010531641.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Tarenaya 
hassleriana]
Length=366

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 85/115 (74%), Gaps = 4/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG CLS RIKAESP    ++    S+D  GL  S  K+      K+EGEILQS ++KSF+
Sbjct  1    MGSCLSSRIKAESPPRNEANSSEKSSDLYGLSLSSQKS----LVKTEGEILQSASVKSFS  56

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F +LK+ATR+F  DSV+GEGGFGPVF+G ID+++L+PTKPGTGL IAVKRL+  G
Sbjct  57   FNELKLATRNFGTDSVVGEGGFGPVFRGCIDEDTLTPTKPGTGLAIAVKRLSREG  111



>ref|XP_008784588.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=422

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 85/128 (66%), Gaps = 13/128 (10%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDG------------SGLGKSDSKNSPPQTPKSE  359
            MG C   R+KAESP H G +S  +    G            SG     S  S P TP+SE
Sbjct  1    MGNCWGARVKAESPSHNGFASDIMFGCLGMNSKCSSGDGKGSGSSSRVSAASVPPTPRSE  60

Query  360  GEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIA  539
            GEILQS N+KSFTF +L+ ATR+FR DSVLGEGGFG VFKGWID+++ + TKPGTG+VIA
Sbjct  61   GEILQSSNVKSFTFNELRNATRNFRPDSVLGEGGFGSVFKGWIDEHTFAATKPGTGIVIA  120

Query  540  VKRLNHGG  563
            VK+LN  G
Sbjct  121  VKKLNQEG  128



>ref|NP_001274846.1| protein kinase APK1B, chloroplastic-like [Solanum tuberosum]
 gb|ABN69037.1| protein kinase [Solanum tuberosum]
Length=416

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 87/121 (72%), Gaps = 7/121 (6%)
 Frame = +3

Query  219  MGICLSVRIKAESP---HPGLSSKCVISTDGSGLGKSDSK---NSPPQTPKSEGEILQSP  380
            MGICLS  IKAE+      G+ S+ V S +G+    S+SK    S P TP+SEGEILQS 
Sbjct  1    MGICLSNEIKAETTIFTGTGVGSRNV-SGNGTETSNSNSKVSSGSVPPTPRSEGEILQSS  59

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            NL+SFTF +L+ +TR+FR DSVLG GGFG VFKGWID+ +L  +KPG G+VIAVK+LN  
Sbjct  60   NLRSFTFNELRASTRNFRPDSVLGGGGFGSVFKGWIDEQTLLASKPGAGIVIAVKKLNQE  119

Query  561  G  563
            G
Sbjct  120  G  120



>emb|CDY55560.1| BnaA03g54910D [Brassica napus]
Length=391

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 81/115 (70%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLKSFT
Sbjct  1    MGACFSNRIKTDIASSTWLSSRFLSRDGS---KGSSSTSFSHVPRTEGEILQNANLKSFT  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             ++LK ATR+FRLDS++GEGGFG VFKGWID+ SL+P KPGTGLVIAVK+LN  G
Sbjct  58   LSELKSATRNFRLDSMVGEGGFGRVFKGWIDETSLAPCKPGTGLVIAVKKLNQEG  112



>ref|XP_009130691.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=391

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 81/115 (70%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLKSFT
Sbjct  1    MGACFSNRIKTDIASSTWLSSRFLSRDGS---KGSSSTSFSHVPRTEGEILQNANLKSFT  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             ++LK ATR+FRLDS++GEGGFG VFKGWID+ SL+P KPGTGLVIAVK+LN  G
Sbjct  58   LSELKSATRNFRLDSMVGEGGFGRVFKGWIDETSLAPCKPGTGLVIAVKKLNQEG  112



>ref|XP_010937617.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Elaeis guineensis]
Length=415

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 82/125 (66%), Gaps = 14/125 (11%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSK----------NSPPQTPKSEGEI  368
            MG C   ++KAES     S     S   S   K D K           S P TP+SEGEI
Sbjct  1    MGNCWGAQVKAESS----SHSVFASGANSRYSKRDGKLSGSSSRVSAASVPPTPRSEGEI  56

Query  369  LQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKR  548
            LQ+ N+KSFTF +LK ATR+FR DSVLGEGGFG VFKGWID++SL+ TKPGTG+VIAVK+
Sbjct  57   LQASNVKSFTFNELKNATRNFRPDSVLGEGGFGSVFKGWIDEHSLAATKPGTGIVIAVKK  116

Query  549  LNHGG  563
            LN  G
Sbjct  117  LNQEG  121



>gb|KJB73944.1| hypothetical protein B456_011G261900 [Gossypium raimondii]
Length=386

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 80/117 (68%), Gaps = 16/117 (14%)
 Frame = +3

Query  219  MGICLSVRIKA-ESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MG C S RIKA ESP H G++                SK SP   P +EGEILQ+ NLKS
Sbjct  1    MGSCFSSRIKAAESPLHHGVNL--------------SSKMSPVSVPITEGEILQASNLKS  46

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F F DL+ ATR+FR DSVLGEGGFG VFKGWID+N+ + +KPGTG+VIAVKRLN  G
Sbjct  47   FNFNDLRTATRNFRPDSVLGEGGFGCVFKGWIDENTFTASKPGTGMVIAVKRLNQEG  103



>ref|XP_002873046.1| hypothetical protein ARALYDRAFT_487008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49305.1| hypothetical protein ARALYDRAFT_487008 [Arabidopsis lyrata subsp. 
lyrata]
Length=389

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 81/115 (70%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGGCFSNRIKTDIASSTWLSSKFLSRDGS---KGSSTTSFSYMPRTEGEILQNANLKNFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             ++LK ATR+FR DSV+GEGGFG VFKGWID+ SL+P+KPGTG+VIAVKRLN  G
Sbjct  58   LSELKSATRNFRPDSVVGEGGFGCVFKGWIDEASLTPSKPGTGIVIAVKRLNQEG  112



>ref|XP_008371735.1| PREDICTED: probable serine/threonine-protein kinase NAK [Malus 
domestica]
 ref|XP_008371743.1| PREDICTED: probable serine/threonine-protein kinase NAK [Malus 
domestica]
Length=402

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 81/116 (70%), Gaps = 12/116 (10%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG CLS RIKA+SP H GL S               S  S P TP++EGEILQS NLK+F
Sbjct  1    MGSCLSSRIKADSPLHNGLHSN-----------SKVSSVSVPSTPRTEGEILQSSNLKNF  49

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F +LK ATR+FR DSV+GEGGFG VFKGW+D+NSL+  KPGTGLVIA KRLN  G
Sbjct  50   CFNELKNATRNFRPDSVVGEGGFGCVFKGWVDENSLTAAKPGTGLVIAAKRLNQEG  105



>ref|NP_001288898.1| protein kinase APK1B, chloroplastic-like [Brassica rapa]
 gb|ABP01775.1| MLPK isoform 2 [Brassica rapa]
Length=410

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 80/118 (68%), Gaps = 9/118 (8%)
 Frame = +3

Query  210  SLMMGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            + + G+C+    K  S           + D   +G   S  S   +P++EGEILQSPNLK
Sbjct  16   NYLFGVCIGASPKYMSSE---------ANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLK  66

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F+FA+LK ATR+FRLDSVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G
Sbjct  67   CFSFAELKAATRNFRLDSVLGEGGFGCVFKGWIDEESLTASKPGTGMVIAVKRLNIEG  124



>ref|XP_010470021.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Camelina sativa]
 ref|XP_010470022.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Camelina sativa]
 ref|XP_010470023.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Camelina sativa]
Length=394

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  291  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  470
            + D   +G   S  S    P++EGEILQSPNLKSFTFA+LK ATR+FR DSVLGEGGFG 
Sbjct  5    ANDSQSMGSKGSSVSIRTNPRTEGEILQSPNLKSFTFAELKAATRNFRPDSVLGEGGFGS  64

Query  471  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            VFKGWID+ +LS +KPGTG+VIAVK+LN  G
Sbjct  65   VFKGWIDEQTLSASKPGTGVVIAVKKLNQDG  95



>ref|XP_010507635.1| PREDICTED: serine/threonine-protein kinase BIK1-like, partial 
[Camelina sativa]
Length=183

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 80/115 (70%), Gaps = 4/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S R+KA+  H G SS       G  L    S ++     K+EGEIL S  +KSFT
Sbjct  1    MGSCFSSRVKADLFHSGKSSDLF----GLSLSSRKSSSTVAAAQKTEGEILSSTPVKSFT  56

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+ +L+PTKPGTGLVIAVKRLN  G
Sbjct  57   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDETTLTPTKPGTGLVIAVKRLNKEG  111



>ref|XP_009357737.1| PREDICTED: probable serine/threonine-protein kinase NAK [Pyrus 
x bretschneideri]
Length=402

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 81/116 (70%), Gaps = 12/116 (10%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG CLS RIKA+SP H GL S               S  S P TP++EGEILQS NLK+F
Sbjct  1    MGSCLSSRIKADSPLHNGLHSN-----------SRVSSVSVPSTPRTEGEILQSSNLKNF  49

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F +LK ATR+FR DSV+GEGGFG VFKGW+D+NSL+  KPGTGLVIA KRLN  G
Sbjct  50   CFNELKNATRNFRPDSVVGEGGFGCVFKGWVDENSLTAAKPGTGLVIAAKRLNQEG  105



>ref|XP_006379595.1| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
 gb|ERP57392.1| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
Length=413

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 86/116 (74%), Gaps = 3/116 (3%)
 Frame = +3

Query  219  MGICLSVRIKAES-PHPGLSSKCV--ISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MG C S R+KAES P  GL++K       D SG     S ++ P TP+++GEILQS NLK
Sbjct  1    MGSCFSARVKAESLPCNGLNTKYAGRSGNDRSGSSSKVSSSTVPSTPRTQGEILQSSNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            SF+F +LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGTG+VIAVKRL+ 
Sbjct  61   SFSFNELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGTGIVIAVKRLSQ  116



>ref|XP_002311169.2| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
 gb|EEE88536.2| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
Length=413

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 86/116 (74%), Gaps = 3/116 (3%)
 Frame = +3

Query  219  MGICLSVRIKAES-PHPGLSSKCV--ISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
            MG C S R+KAES P  GL++K       D SG     S ++ P TP+++GEILQS NLK
Sbjct  1    MGSCFSARVKAESLPCNGLNTKYAGRSGNDRSGSSSKVSSSTVPSTPRTQGEILQSSNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            SF+F +LK ATR+FR DSVLGEGGFG VFKGWID++SL+  KPGTG+VIAVKRL+ 
Sbjct  61   SFSFNELKAATRNFRPDSVLGEGGFGCVFKGWIDEHSLTAAKPGTGIVIAVKRLSQ  116



>ref|XP_003567536.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brachypodium 
distachyon]
Length=401

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 82/115 (71%), Gaps = 9/115 (8%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C   RI ++SP+     +   ++  SG    D+K++  + P+SEGEILQS  +KSF 
Sbjct  1    MGNCFGTRISSDSPY-----RSSAASPSSG----DAKSAELRAPRSEGEILQSAKVKSFA  51

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F +L+ ATR+FR DSVLGEGGFG VFKGWID+N+ +P +PGTG+VIAVK+LN  G
Sbjct  52   FTELRTATRNFRPDSVLGEGGFGSVFKGWIDENTFAPARPGTGVVIAVKKLNQDG  106



>emb|CDY20465.1| BnaC04g05790D [Brassica napus]
Length=386

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S R+KAE+P     S  +      GL  S  K++     K+EGEIL+S  +K+FT
Sbjct  1    MGSCFSSRVKAENPFNDGKSSVLY-----GLSMSSGKSTVAAAQKTEGEILESTPVKNFT  55

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+ +L+PTKPGTGLVIAVK+LN  G
Sbjct  56   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDETNLTPTKPGTGLVIAVKKLNREG  110



>emb|CDX80814.1| BnaC03g00680D [Brassica napus]
Length=391

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLKSFT
Sbjct  1    MGACFSNRIKTDIASSTWLSSRFLSRDGS---KGSSSTSFSHVPRTEGEILQNANLKSFT  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             ++LK ATR FRLDS++GEGGFG VFKGWID+ SL+P KPGTGLVIAVK+LN  G
Sbjct  58   LSELKSATRSFRLDSMVGEGGFGRVFKGWIDETSLAPCKPGTGLVIAVKKLNQEG  112



>ref|XP_010452061.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
 ref|XP_010452062.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
Length=398

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGGCFSNRIKTDIASSTWLSSKFLSRDGS---KGSSNTSFSHMPRTEGEILQNANLKNFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             ++LK ATR+FR DSV+GEGGFG VFKGWID+ SL+P+KPG G+VIAVKRLN  G
Sbjct  58   LSELKSATRNFRPDSVVGEGGFGCVFKGWIDEASLAPSKPGAGIVIAVKRLNQEG  112



>ref|XP_002283701.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X1 [Vitis 
vinifera]
 emb|CBI31685.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 86/120 (72%), Gaps = 6/120 (5%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP----PQTPKSEGEILQSPN  383
            MG CLS +IKAE+  + G+ S+C  S DG  L  S S        P TP+++GEILQS N
Sbjct  1    MGGCLSSQIKAENLLYIGIKSRCG-SNDGKYLSGSSSSKVSSASVPTTPRTDGEILQSSN  59

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            LKSF F++L+ ATR+FR DSVLGEGGFG VFKGWID+ + +  KPGTG+VIAVK+LN  G
Sbjct  60   LKSFFFSELRTATRNFRPDSVLGEGGFGCVFKGWIDEKAFTAAKPGTGMVIAVKKLNQEG  119



>ref|XP_007140532.1| hypothetical protein PHAVU_008G120600g [Phaseolus vulgaris]
 gb|ESW12526.1| hypothetical protein PHAVU_008G120600g [Phaseolus vulgaris]
Length=410

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP--PQTPKSEGEILQSPNLK  389
            MG C S RIKA SP + G++S+ V S  G  +  +   +S     T +SEGEILQS NLK
Sbjct  1    MGACWSNRIKAVSPSNTGITSRSV-SRSGHDISSTSRNSSASVSVTSRSEGEILQSSNLK  59

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF++++L++ATR+FR DSVLGEGGFG VFKGWID++SL+ TKPG G+++AVKRLN  G
Sbjct  60   SFSYSELRVATRNFRPDSVLGEGGFGSVFKGWIDEHSLTATKPGIGMIVAVKRLNQEG  117



>ref|XP_004142067.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
[Cucumis sativus]
 gb|KGN54255.1| hypothetical protein Csa_4G296090 [Cucumis sativus]
Length=384

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 83/118 (70%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLK  389
            MG+C S R K+ SP  GL+       DG     S SK S    P TP+SE EILQ  NLK
Sbjct  1    MGVCWSDRSKSLSPPKGLTRFKSKRGDGEHSHISSSKVSSASIPVTPRSEDEILQCSNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F+F +LK ATR+FR DSV+GEGGFG VFKGWID++SL+PTK GTGLVIAVKRLN  G
Sbjct  61   NFSFNELKTATRNFRPDSVVGEGGFGSVFKGWIDEHSLTPTKAGTGLVIAVKRLNREG  118



>ref|XP_009343547.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Pyrus x 
bretschneideri]
Length=402

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 79/115 (69%), Gaps = 10/115 (9%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG CLS RIKA+SPH           +G       S  S   TP++E EILQS NLKSF 
Sbjct  1    MGSCLSSRIKADSPH----------HNGLHSNSKVSSVSVTSTPRTEDEILQSCNLKSFA  50

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F +LK ATR+FR DS++GEGGFG V+KGW+D+NSL+  KPGTG+VIAVKRLN  G
Sbjct  51   FNELKTATRNFRPDSMVGEGGFGSVYKGWVDENSLTAAKPGTGMVIAVKRLNQEG  105



>ref|XP_008447952.1| PREDICTED: probable serine/threonine-protein kinase NAK [Cucumis 
melo]
Length=384

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 83/118 (70%), Gaps = 3/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLK  389
            MGIC S R K+ SP  GL+       DG     S SK S    P TP+SE EILQ  NLK
Sbjct  1    MGICWSDRSKSLSPPKGLTRFKSKRGDGEHSHISSSKVSSASIPVTPRSEDEILQCSNLK  60

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            +F+F +L+ ATR+FR DSV+GEGGFG VFKGWID++SL+PTK GTGLVIAVKRLN  G
Sbjct  61   NFSFNELRTATRNFRPDSVVGEGGFGSVFKGWIDEHSLTPTKAGTGLVIAVKRLNRDG  118



>gb|EYU26593.1| hypothetical protein MIMGU_mgv1a007265mg [Erythranthe guttata]
Length=413

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 87/123 (71%), Gaps = 8/123 (7%)
 Frame = +3

Query  219  MGICLSVRIKAES-----PHPGLSSKCVISTDGSGLGKSDSKNSP---PQTPKSEGEILQ  374
            MGIC S +IKAES        G +S  ++S DG+ L  S SK S    P TP+SEGEIL 
Sbjct  1    MGICWSNQIKAESNFLSGTDVGATSSKMVSGDGTELSNSSSKTSSASIPPTPRSEGEILN  60

Query  375  SPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  554
            S N+KSF   DLK ATR+FR DSV+GEGGFG VFKGWID++SL+ ++ G+G+VIAVKRLN
Sbjct  61   SSNMKSFQLFDLKAATRNFRPDSVIGEGGFGSVFKGWIDEHSLAASRAGSGIVIAVKRLN  120

Query  555  HGG  563
              G
Sbjct  121  QDG  123



>ref|XP_002466186.1| hypothetical protein SORBIDRAFT_01g003130 [Sorghum bicolor]
 gb|EER93184.1| hypothetical protein SORBIDRAFT_01g003130 [Sorghum bicolor]
Length=418

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 79/114 (69%), Gaps = 5/114 (4%)
 Frame = +3

Query  228  CLSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSP---PQTPKSEGEILQSPNLKS  392
            C   RIK  SPHPG S     S   DGS L    S+ S    P + K+E EILQS N+K 
Sbjct  6    CWGARIKDGSPHPGTSGMFSKSGGKDGSRLSGCSSRASSASMPTSAKTECEILQSANVKV  65

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLN  554
            FTF +LK ATR+FR DSVLGEGGFG V+KGWID+N+LSP +PGTG+ +AVK+LN
Sbjct  66   FTFNNLKAATRNFRPDSVLGEGGFGSVYKGWIDENTLSPCRPGTGIAVAVKKLN  119



>gb|KHG15911.1| Protein kinase APK1A, chloroplastic [Gossypium arboreum]
Length=596

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 81/117 (69%), Gaps = 16/117 (14%)
 Frame = +3

Query  219  MGICLSVRIKA-ESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKS  392
            MG C S RIKA ESP H G++                SK SP   P++EG+ILQ+ NLKS
Sbjct  1    MGSCFSSRIKAAESPLHHGVNLS--------------SKMSPVSVPRTEGDILQASNLKS  46

Query  393  FTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F F DL+ ATR+FR DSVLGEGGFG VFKGWID+N+ + +KPGTG+VIAVKRLN  G
Sbjct  47   FNFNDLRTATRNFRPDSVLGEGGFGCVFKGWIDENTFTASKPGTGMVIAVKRLNQEG  103



>ref|XP_010937616.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Elaeis guineensis]
Length=423

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 85/129 (66%), Gaps = 14/129 (11%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVIST---DGSGLGKSDSK----------NSPPQTPKS  356
            MG C   ++KAES  H   +S  +I       S   K D K           S P TP+S
Sbjct  1    MGNCWGAQVKAESSSHSVFASVHIIFGCIGANSRYSKRDGKLSGSSSRVSAASVPPTPRS  60

Query  357  EGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVI  536
            EGEILQ+ N+KSFTF +LK ATR+FR DSVLGEGGFG VFKGWID++SL+ TKPGTG+VI
Sbjct  61   EGEILQASNVKSFTFNELKNATRNFRPDSVLGEGGFGSVFKGWIDEHSLAATKPGTGIVI  120

Query  537  AVKRLNHGG  563
            AVK+LN  G
Sbjct  121  AVKKLNQEG  129



>ref|XP_002534306.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF28074.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=389

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +3

Query  339  PQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKP  518
            PQTP+SEGEILQS NLK+F+FA+L+ ATR+FR DSVLGEGGFG VFKGWID+ SL+ TKP
Sbjct  41   PQTPRSEGEILQSSNLKNFSFAELRNATRNFRPDSVLGEGGFGSVFKGWIDEQSLTATKP  100

Query  519  GTGLVIAVKRLNHGG  563
            G+G+VIAVKRLN  G
Sbjct  101  GSGVVIAVKRLNQEG  115



>ref|XP_009124366.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X1 [Brassica 
rapa]
Length=419

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 75/101 (74%), Gaps = 2/101 (2%)
 Frame = +3

Query  267  GLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLD  440
            G+SSK + S   D   +G   S  S    P++EGEILQSPNLKSF+  +LK ATR+FR D
Sbjct  24   GVSSKYMSSEANDSQSMGSKCSSASIRTNPRTEGEILQSPNLKSFSLDELKSATRNFRQD  83

Query  441  SVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SVLGEGGFG VFKGWID+ SL+ +KPGTG+VIAVKRLN  G
Sbjct  84   SVLGEGGFGCVFKGWIDEQSLAASKPGTGMVIAVKRLNQDG  124



>ref|XP_010067409.1| PREDICTED: probable serine/threonine-protein kinase NAK [Eucalyptus 
grandis]
 gb|KCW65537.1| hypothetical protein EUGRSUZ_G02935 [Eucalyptus grandis]
Length=392

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 80/120 (67%), Gaps = 15/120 (13%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGS-----GLGKSDSKNSPPQTPKSEGEILQSPN  383
            MG CLS RI          +  +  T G      GL    S  S PQTP++E EILQS N
Sbjct  1    MGCCLSARI----------TDNLFRTGGRPNVSGGLSGRVSSYSGPQTPRTEDEILQSTN  50

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            LKSF++ +L++ATR+FR DSVLGEGGFG V+KGW+D+ + + TKPGTG+VIAVKRLN  G
Sbjct  51   LKSFSYTELRVATRNFRPDSVLGEGGFGSVYKGWVDEQTFAATKPGTGIVIAVKRLNQEG  110



>ref|XP_009414322.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=424

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 88/129 (68%), Gaps = 14/129 (11%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSK-----CV------ISTDGSGLGKSDSKNSP---PQTPKS  356
            MG C   ++KAESP  G  +      C+       S DG  L  S SK S    P TP+S
Sbjct  1    MGNCWGAQVKAESPSDGFFASGDVFSCLGLHSKSSSRDGKKLSGSSSKVSAASVPPTPRS  60

Query  357  EGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVI  536
            EGEILQS N+KSFTF +L++ATR+FR DSV+GEGGFG VFKGWID+++L+  KPGTG+VI
Sbjct  61   EGEILQSVNVKSFTFTELRIATRNFRPDSVVGEGGFGSVFKGWIDEHTLAAAKPGTGVVI  120

Query  537  AVKRLNHGG  563
            AVK+LN  G
Sbjct  121  AVKKLNQEG  129



>gb|EEC78387.1| hypothetical protein OsI_18165 [Oryza sativa Indica Group]
Length=395

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C   +I +ESP    SS    ++  +      + + PP TP+SEGEIL++ N+K+F 
Sbjct  1    MGNCWGAKISSESPCRSASSPSGGTSKYASNSSVSAASVPP-TPRSEGEILEAANVKAFA  59

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F +L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+PTKPGTG+VIAVK+LN  G
Sbjct  60   FNELRTATRNFRPDSVLGEGGFGSVFKGWIDEKTLAPTKPGTGMVIAVKKLNQEG  114



>emb|CDY10453.1| BnaCnng03540D [Brassica napus]
Length=390

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 2/115 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S +IK +       S   +S +GS    S S  S   TP++EGEIL++ NLKSFT
Sbjct  1    MGACFSNQIKTDIASSSWLSSKFLSREGSK--GSASATSFSHTPRTEGEILKNANLKSFT  58

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
              +LK ATR FR DS++GEGGFG VFKGWID+ SL+P+KPGTG+VIAVKRLN  G
Sbjct  59   LGELKSATRSFRPDSMVGEGGFGCVFKGWIDETSLAPSKPGTGIVIAVKRLNQEG  113



>ref|XP_009133858.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Brassica rapa]
Length=381

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  291  STDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGP  470
            + D   +G   S  S   +P++EGEILQSPNLK F+FA+LK ATR+FRL SVLGEGGFG 
Sbjct  5    ANDTQSMGSKCSSVSVRTSPRTEGEILQSPNLKCFSFAELKAATRNFRLYSVLGEGGFGC  64

Query  471  VFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            VFKGWID+ SL+ +KPGTG+VIAVKRLN  G
Sbjct  65   VFKGWIDEESLTASKPGTGMVIAVKRLNIEG  95



>ref|XP_004246420.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Solanum lycopersicum]
Length=416

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 84/120 (70%), Gaps = 5/120 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESPH---PGLSSKCVIS--TDGSGLGKSDSKNSPPQTPKSEGEILQSPN  383
            MGICLS  IKAE+      G+ S+ V    T+ S      S  S P TP+SEGEILQS N
Sbjct  1    MGICLSNEIKAETTIFTGTGVGSRNVSGNGTENSNSNSKVSSGSVPPTPRSEGEILQSSN  60

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            L+SFTF +L+ +TR+FR DSVLGEGGFG VFKGW+D+ +L  +KPG G+VIAVK+LN  G
Sbjct  61   LRSFTFNELRASTRNFRPDSVLGEGGFGSVFKGWVDEQTLLASKPGAGIVIAVKKLNQEG  120



>ref|XP_008810614.1| PREDICTED: protein kinase APK1A, chloroplastic [Phoenix dactylifera]
Length=415

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 82/121 (68%), Gaps = 6/121 (5%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSP------PQTPKSEGEILQSP  380
            MG C S ++KAES      +  V S   +  GK    +S       P TP+SEGEILQ+ 
Sbjct  1    MGNCCSAQVKAESTSYSAFASGVNSKYSNRDGKGSGSSSRVSAASVPPTPRSEGEILQAS  60

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            N+KSF F +LK ATR+FR DSVLGEGGFG VFKGWID++S + TKPGTG+VIAVK+LN  
Sbjct  61   NVKSFAFNELKSATRNFRPDSVLGEGGFGSVFKGWIDEHSFAATKPGTGIVIAVKKLNQE  120

Query  561  G  563
            G
Sbjct  121  G  121



>ref|NP_001241128.1| probable serine/threonine-protein kinase NAK-like [Glycine max]
 ref|XP_006601852.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X1 [Glycine max]
 ref|XP_006601853.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X2 [Glycine max]
 gb|ACM89535.1| protein kinase [Glycine max]
 gb|KHN13986.1| Putative serine/threonine-protein kinase NAK [Glycine soja]
Length=410

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 86/118 (73%), Gaps = 4/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSP--PQTPKSEGEILQSPNLK  389
            MG C S RIKA SP + G++S+ V S  G  +  +   +S   P T +SEGEILQS NLK
Sbjct  1    MGACWSNRIKAVSPSNTGITSRSV-SRSGHDISSNSRSSSASIPVTSRSEGEILQSSNLK  59

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            SF++ +L+ ATR+FR DSVLGEGGFG VFKGWID++SL+ TKPG G ++AVK+LN  G
Sbjct  60   SFSYHELRAATRNFRPDSVLGEGGFGSVFKGWIDEHSLAATKPGIGKIVAVKKLNQDG  117



>emb|CDY04848.1| BnaAnng00300D [Brassica napus]
Length=388

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S +I+ +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGACFSNQIRTDIASSTWLSSKFLSRDGS---KGSSTTSFSHMPRTEGEILQNANLKNFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             ++LK ATR+FR DS++GEGGFG VFKGWID+ SL+P+KPG G+VIAVKRLN  G
Sbjct  58   LSELKSATRNFRPDSMVGEGGFGRVFKGWIDETSLAPSKPGNGIVIAVKRLNQEG  112



>gb|EYU18976.1| hypothetical protein MIMGU_mgv1a007452mg [Erythranthe guttata]
Length=407

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHP-GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MGIC S RIK+++P P GL+S+   S          SK S   T ++EGEILQS NLK F
Sbjct  1    MGICFSGRIKSQTPPPTGLNSQYASSNGNENSYVISSKVS--STLRTEGEILQSSNLKDF  58

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            TF+DLK ATR+FR DSVLG GGFG VFKGW+D+NS    KPGTG+++AVK+L+ 
Sbjct  59   TFSDLKNATRNFRPDSVLGGGGFGSVFKGWVDENSFIAAKPGTGMIVAVKKLHQ  112



>emb|CDY48100.1| BnaC02g03570D [Brassica napus]
Length=388

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S +I+ +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGACFSNQIRTDIASSTWLSSKFLSRDGS---KGSSTTSFSHMPRTEGEILQNANLKNFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             ++LK ATR+FR DS++GEGGFG VFKGWID+ SL+P+KPG G+VIAVKRLN  G
Sbjct  58   LSELKSATRNFRPDSMVGEGGFGRVFKGWIDETSLAPSKPGNGIVIAVKRLNQEG  112



>ref|XP_008233629.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Prunus mume]
Length=401

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 80/116 (69%), Gaps = 12/116 (10%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG C S RIKA+S  H GL S               S  S P TP++EGEILQS NLKSF
Sbjct  1    MGSCFSSRIKADSHLHNGLHSN-----------SKVSSVSVPSTPRTEGEILQSSNLKSF  49

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F +LK ATR+FR DS++GEGGFG VFKGW+D+NSL+  KPGTG+VIAVKRLN  G
Sbjct  50   AFNELKTATRNFRPDSMVGEGGFGCVFKGWVDENSLTAAKPGTGMVIAVKRLNQEG  105



>ref|XP_009125442.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=388

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S +I+ +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGACFSNQIRTDIASSTWLSSKFLSRDGS---KGSSTTSFSHMPRTEGEILQNANLKNFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             ++LK ATR+FR DS++GEGGFG VFKGWID+ SL+P+KPG G+VIAVKRLN  G
Sbjct  58   LSELKSATRNFRPDSMVGEGGFGRVFKGWIDETSLAPSKPGNGIVIAVKRLNQEG  112



>ref|XP_010423878.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
 ref|XP_010423879.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
Length=398

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S RIK +       S   +S DGS   K  S  S     ++EGEILQ+ NLK+++
Sbjct  1    MGGCFSNRIKTDIASSTWLSSKFLSRDGS---KGSSNTSFSHMSRTEGEILQNANLKNYS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             ++LK ATR+FR DSV+GEGGFG VFKGWID+ SL+P+KPGTG+VIAVKRLN  G
Sbjct  58   LSELKSATRNFRPDSVVGEGGFGCVFKGWIDEASLAPSKPGTGIVIAVKRLNQEG  112



>emb|CDY40347.1| BnaA10g27210D [Brassica napus]
Length=390

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 2/115 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S +IK +       S   +S +GS    S S  S   TP++EGEIL++ NLKSFT
Sbjct  1    MGACFSNQIKTDIASSTWLSSKFMSREGSK--GSASATSFSHTPRTEGEILKNANLKSFT  58

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
              +LK ATR FR DS++GEGGFG VFKGWID+ SLSP+KPGTG+VIAVK+LN  G
Sbjct  59   LGELKSATRSFRPDSMVGEGGFGCVFKGWIDETSLSPSKPGTGIVIAVKKLNQEG  113



>ref|XP_009122790.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=389

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 2/115 (2%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S +IK +       S   +S +GS    S S  S   TP++EGEIL++ NLKSFT
Sbjct  1    MGACFSNQIKTDIASSTWLSSKFMSREGSK--GSASATSFSHTPRTEGEILKNANLKSFT  58

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
              +LK ATR FR DS++GEGGFG VFKGWID+ SLSP+KPGTG+VIAVK+LN  G
Sbjct  59   LGELKSATRSFRPDSMVGEGGFGCVFKGWIDETSLSPSKPGTGIVIAVKKLNQEG  113



>gb|EPS63220.1| protein kinase 1b, partial [Genlisea aurea]
Length=346

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 79/114 (69%), Gaps = 12/114 (11%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MGIC S  IK +SP H G+      +T G         +S     ++EGEILQSPNL+SF
Sbjct  1    MGICWSSNIKDQSPVHTGMYD----ATHGE-------VSSAAIVSRTEGEILQSPNLRSF  49

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            +F+DLK ATR+FRLDS LG GGFG V+KGWID NS +P KPG+GLV+AVK+LN 
Sbjct  50   SFSDLKAATRNFRLDSNLGGGGFGTVYKGWIDANSSAPAKPGSGLVVAVKKLNQ  103



>ref|NP_001184929.1| protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28145.1| protein kinase APK1A [Arabidopsis thaliana]
Length=424

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +3

Query  297  DGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVF  476
            D   LG   S  S   +P++EGEILQSPNLKSF+FA+LK ATR+FR DSVLGEGGFG VF
Sbjct  38   DIGSLGSKASSVSVRPSPRTEGEILQSPNLKSFSFAELKSATRNFRPDSVLGEGGFGCVF  97

Query  477  KGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            KGWID+ SL+ ++PGTGLVIAVK+LN  G
Sbjct  98   KGWIDEKSLTASRPGTGLVIAVKKLNQDG  126



>ref|XP_006650809.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Oryza brachyantha]
Length=423

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 80/120 (67%), Gaps = 7/120 (6%)
 Frame = +3

Query  219  MGICLS--VRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSPPQTP---KSEGEILQS  377
            MG C     RIK  SPHPG S     S   DGS L    S+ S    P   K+E EILQS
Sbjct  1    MGNCWGWGARIKDGSPHPGASGMFSRSGAKDGSRLSGCSSRASSASMPPMGKTECEILQS  60

Query  378  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
             N+K F+F DL++ATR+FR DSVLGEGGFG V+KGWID+N+LS  KPGTG+ +AVKRLN 
Sbjct  61   ANVKIFSFTDLRVATRNFRPDSVLGEGGFGSVYKGWIDENTLSACKPGTGIAVAVKRLNQ  120



>ref|XP_010517317.1| PREDICTED: serine/threonine-protein kinase BIK1 [Camelina sativa]
Length=394

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 80/115 (70%), Gaps = 4/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S R+KA+  H G SS       G  L    S ++     K+EGEIL S  +KSFT
Sbjct  1    MGSCFSSRVKADLFHSGKSSDLF----GLSLSSRKSSSTVAAAQKTEGEILSSTPVKSFT  56

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+ +L+PTKPGTGLVIAVKRLN  G
Sbjct  57   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDETTLTPTKPGTGLVIAVKRLNKEG  111



>ref|XP_007133997.1| hypothetical protein PHAVU_010G010300g [Phaseolus vulgaris]
 gb|ESW05991.1| hypothetical protein PHAVU_010G010300g [Phaseolus vulgaris]
Length=413

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 85/118 (72%), Gaps = 4/118 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPH-PGLSSKCVISTDGSGLGKSDSKNSP--PQTPKSEGEILQSPNLK  389
            MG C S R KA SP   G +S+ V S +G  +  S   +S   P TP+SEGEILQS NLK
Sbjct  1    MGSCWSSRTKAVSPSSAGFTSRSV-SREGYDIHSSSRNSSSSMPMTPRSEGEILQSSNLK  59

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            S+++ +L++AT+ F  D+VLGEGGFG VFKGWID++SLS TKPG G+V+AVKRLN  G
Sbjct  60   SYSYNELRIATKHFSPDNVLGEGGFGSVFKGWIDEHSLSVTKPGIGMVVAVKRLNQEG  117



>ref|XP_009414410.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=416

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 89/121 (74%), Gaps = 6/121 (5%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCV----ISTDGSGLGKSDSKNSP--PQTPKSEGEILQSP  380
            MG C S R+KAESP    S+  V    +S D +G   S S++S   P TP++E +ILQS 
Sbjct  1    MGSCWSSRVKAESPFNSASASEVNCRSVSRDRNGSSGSSSRSSASVPLTPRTEVDILQSS  60

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            NLKSF+F++L+ ATR+FR DSV+GEGGFG VFKGWID+ +L+ +KPG+G+V+AVKRLN  
Sbjct  61   NLKSFSFSELRAATRNFRPDSVVGEGGFGSVFKGWIDERTLTASKPGSGIVVAVKRLNQE  120

Query  561  G  563
            G
Sbjct  121  G  121



>ref|XP_007218038.1| hypothetical protein PRUPE_ppa006035mg [Prunus persica]
 gb|EMJ19237.1| hypothetical protein PRUPE_ppa006035mg [Prunus persica]
Length=431

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 80/116 (69%), Gaps = 12/116 (10%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSF  395
            MG C S RIKA+S  H GL S               S  S P TP++EGEILQS NLKSF
Sbjct  1    MGSCFSSRIKADSHLHNGLHSN-----------SKVSSVSVPSTPRTEGEILQSSNLKSF  49

Query  396  TFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             F +LK ATR+FR DS++GEGGFG VFKGW+D+NSL+  KPGTG+VIAVKRLN  G
Sbjct  50   AFNELKTATRNFRPDSMVGEGGFGCVFKGWVDENSLTAAKPGTGMVIAVKRLNQEG  105



>ref|XP_010508995.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Camelina 
sativa]
Length=394

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 80/115 (70%), Gaps = 4/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S R+KA+  H G SS       G  L    S ++     K+EGEIL S  +KSFT
Sbjct  1    MGSCFSSRVKADLFHSGKSSDLF----GLSLSSRKSSSTVAAAQKTEGEILSSTPVKSFT  56

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+ +L+PTKPGTGLVIAVKRLN  G
Sbjct  57   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDETTLTPTKPGTGLVIAVKRLNKEG  111



>gb|AAO18450.1| putative protein kinase [Oryza sativa Japonica Group]
Length=416

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 81/120 (68%), Gaps = 7/120 (6%)
 Frame = +3

Query  219  MGIC--LSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSP---PQTPKSEGEILQS  377
            MG C     RIK  SP PG S     S   DGS L    S+ S    P T K+E EILQS
Sbjct  1    MGNCCGWGARIKDGSPQPGASGMFSRSGAKDGSRLSGCSSRASSASMPPTAKTECEILQS  60

Query  378  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
             N+K F+F+DL++ATR+FR DSVLGEGGFG V+KGWID+N+LS  KPGTG+ +AVKRLN 
Sbjct  61   ANVKIFSFSDLRIATRNFRPDSVLGEGGFGSVYKGWIDENTLSACKPGTGIAVAVKRLNQ  120



>ref|NP_001051730.1| Os03g0821900 [Oryza sativa Japonica Group]
 gb|ABF99600.1| Protein kinase APK1B, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13644.1| Os03g0821900 [Oryza sativa Japonica Group]
 dbj|BAG92171.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76429.1| hypothetical protein OsI_14109 [Oryza sativa Indica Group]
 gb|EEE60197.1| hypothetical protein OsJ_13155 [Oryza sativa Japonica Group]
Length=424

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 81/120 (68%), Gaps = 7/120 (6%)
 Frame = +3

Query  219  MGIC--LSVRIKAESPHPGLSSKCVIS--TDGSGLGKSDSKNSP---PQTPKSEGEILQS  377
            MG C     RIK  SP PG S     S   DGS L    S+ S    P T K+E EILQS
Sbjct  1    MGNCCGWGARIKDGSPQPGASGMFSRSGAKDGSRLSGCSSRASSASMPPTAKTECEILQS  60

Query  378  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
             N+K F+F+DL++ATR+FR DSVLGEGGFG V+KGWID+N+LS  KPGTG+ +AVKRLN 
Sbjct  61   ANVKIFSFSDLRIATRNFRPDSVLGEGGFGSVYKGWIDENTLSACKPGTGIAVAVKRLNQ  120



>gb|EPS69141.1| hypothetical protein M569_05623, partial [Genlisea aurea]
Length=365

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 84/121 (69%), Gaps = 6/121 (5%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HP-----GLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSP  380
            MG C S RI+A++P H       L SK  ++ D +    S   +S  ++P SE EIL+S 
Sbjct  1    MGSCFSARIRADAPPHRDGSLISLCSKNGVAVDTATESSSRRSSSGARSPVSEAEILESA  60

Query  381  NLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHG  560
            +LKSFTF DLK++TR+FR DS+LGEGGFG VFKGWID+++    KPGTGLVIAVKRLN  
Sbjct  61   SLKSFTFIDLKVSTRNFRPDSLLGEGGFGCVFKGWIDEHTFKAAKPGTGLVIAVKRLNQE  120

Query  561  G  563
            G
Sbjct  121  G  121



>ref|XP_006294362.1| hypothetical protein CARUB_v10023379mg [Capsella rubella]
 gb|EOA27260.1| hypothetical protein CARUB_v10023379mg [Capsella rubella]
Length=393

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 4/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S R+KA+  H G SS       G  L    S ++     K+EGEIL S  +KSFT
Sbjct  1    MGSCFSSRVKADLFHSGKSSDLF----GLSLSSRKSSSTVAAAQKTEGEILSSTPVKSFT  56

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+ +L+PT+PGTGLVIAVKRLN  G
Sbjct  57   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDETTLTPTRPGTGLVIAVKRLNKEG  111



>ref|XP_004503146.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cicer arietinum]
Length=420

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 86/118 (73%), Gaps = 3/118 (3%)
 Frame = +3

Query  213  LMMGICLSVRIKAESP-HPGLSSKCVISTDG--SGLGKSDSKNSPPQTPKSEGEILQSPN  383
            + MG C S ++KAESP H G++SK     +   SGL    S +S   T +SEGEILQS +
Sbjct  1    MFMGCCFSAKVKAESPTHNGMNSKVGRKEEDVSSGLSSKLSSSSMLLTSRSEGEILQSNS  60

Query  384  LKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            LK FTF +++ ATR+FR DSV+GEGGFG VFKGWID+ +L+PTKPGTG VIAVKRLN 
Sbjct  61   LKCFTFNEVRTATRNFRPDSVVGEGGFGSVFKGWIDERTLAPTKPGTGFVIAVKRLNQ  118



>ref|XP_009384873.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=412

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 83/122 (68%), Gaps = 7/122 (6%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSP-------PQTPKSEGEILQS  377
            MG C   ++KAE+P   + +    S  GS  G   S +S        P TP+SEGEIL S
Sbjct  1    MGNCWGAKVKAENPSHDVFASGEDSPHGSRKGNVLSSSSSRVSASSVPPTPRSEGEILTS  60

Query  378  PNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
             NLKSFTF +L+ ATR+FR DSVLGEGGFG VFKGWI++++L+  KPGTG+VIAVK+LN 
Sbjct  61   SNLKSFTFNELRTATRNFRPDSVLGEGGFGSVFKGWINEHTLAAAKPGTGMVIAVKKLNQ  120

Query  558  GG  563
             G
Sbjct  121  EG  122



>ref|NP_181496.1| serine/threonine-protein kinase BIK1 [Arabidopsis thaliana]
 sp|O48814.1|BIK1_ARATH RecName: Full=Serine/threonine-protein kinase BIK1; AltName: 
Full=Protein BOTRYTIS-INDUCED KINASE 1 [Arabidopsis thaliana]
 gb|AAK17154.1|AF325086_1 putative protein kinase [Arabidopsis thaliana]
 gb|AAB97121.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAL32571.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAL57667.1| At2g39660/F12L6.32 [Arabidopsis thaliana]
 gb|AAM14921.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM13277.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM16258.1| At2g39660/F12L6.32 [Arabidopsis thaliana]
 gb|AEC09703.1| serine/threonine-protein kinase BIK1 [Arabidopsis thaliana]
Length=395

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 81/115 (70%), Gaps = 4/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S R+KA+  H G SS       G  L    S ++     K+EGEIL S  +KSFT
Sbjct  1    MGSCFSSRVKADIFHNGKSSDLY----GLSLSSRKSSSTVAAAQKTEGEILSSTPVKSFT  56

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+++L+PTKPGTGLVIAVK+LN  G
Sbjct  57   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDESTLTPTKPGTGLVIAVKKLNQEG  111



>ref|NP_001054444.1| Os05g0110900 [Oryza sativa Japonica Group]
 gb|AAK73157.1|AC079022_30 putative protein kinase [Oryza sativa]
 gb|AAU44204.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16358.1| Os05g0110900 [Oryza sativa Japonica Group]
 dbj|BAG93323.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62074.1| hypothetical protein OsJ_16858 [Oryza sativa Japonica Group]
Length=395

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C   +I +ESP    SS    ++  +      + + PP TP+SE EIL++ N+K+F 
Sbjct  1    MGNCWGAKISSESPCRSASSPSGGTSKYASNSSVSAASVPP-TPRSEDEILEAANVKAFA  59

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F +L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+PTKPGTG+VIAVK+LN  G
Sbjct  60   FNELRTATRNFRPDSVLGEGGFGSVFKGWIDEKTLAPTKPGTGMVIAVKKLNQEG  114



>ref|NP_180459.2| protein kinase APK1B [Arabidopsis thaliana]
 gb|ABM06025.1| At2g28930 [Arabidopsis thaliana]
 gb|AEC08189.1| protein kinase APK1B [Arabidopsis thaliana]
Length=423

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  348  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  527
            P++EGEILQSPNLKSFTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ +KPGTG
Sbjct  53   PRTEGEILQSPNLKSFTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTG  112

Query  528  LVIAVKRLNHGG  563
            +VIAVK+LN  G
Sbjct  113  VVIAVKKLNQDG  124



>ref|XP_002879808.1| botrytis-induced kinase1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56067.1| botrytis-induced kinase1 [Arabidopsis lyrata subsp. lyrata]
Length=394

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 4/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S R+KA+  H G SS       G  L    S ++     K+EGEIL S  +KSFT
Sbjct  1    MGSCFSSRVKADIFHNGKSSDLY----GLSLSSRKSSSTVAAAQKTEGEILSSTPVKSFT  56

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            F +LK+ATR+FR DSV+GEGGFG VFKGW+D+ +L+PTKPGTGLVIAVK+LN  G
Sbjct  57   FNELKLATRNFRPDSVIGEGGFGCVFKGWLDETTLTPTKPGTGLVIAVKKLNQEG  111



>ref|XP_002879189.1| hypothetical protein ARALYDRAFT_481810 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55448.1| hypothetical protein ARALYDRAFT_481810 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  348  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  527
            P++EGEILQSPNLKSFTFA+LK ATR+FR DSVLGEGGFG VFKGWID+ +L+ +KPGTG
Sbjct  55   PRTEGEILQSPNLKSFTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTG  114

Query  528  LVIAVKRLNHGG  563
            +VIAVK+LN  G
Sbjct  115  VVIAVKKLNQDG  126



>ref|XP_006654906.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Oryza brachyantha]
Length=419

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = +3

Query  288  ISTDGSGLGKSD-SKNSPPQTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGF  464
            +S +G+ L  S  S  S P TP+SEGEIL++ N+K+F F +L+ ATR+FR DSVLGEGGF
Sbjct  46   LSKNGAALSNSSVSTASVPPTPRSEGEILEAANVKAFAFNELRTATRNFRPDSVLGEGGF  105

Query  465  GPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            G VFKGWID+ +L+PT+PGTG+VIAVK+LN  G
Sbjct  106  GSVFKGWIDEKTLAPTRPGTGMVIAVKKLNQEG  138



>ref|XP_004505862.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Cicer arietinum]
 ref|XP_004505863.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X4 
[Cicer arietinum]
Length=418

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 88/131 (67%), Gaps = 16/131 (12%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSK-------------CVISTD-GSGLGK-SDSKNSPPQTP  350
            MG+CL  +IK E+P + GLSSK             C +S D  S +G+ S +  S  QTP
Sbjct  9    MGVCLGNQIKVENPFNSGLSSKSVNGNTEDLSIPCCKVSDDHSSSIGEVSATSVSVTQTP  68

Query  351  KSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGL  530
            +S GEILQS NLKSFT  +L+ ATR+FR+DSVLG+ GFG VFKGWID+++ S  KPG G+
Sbjct  69   RSVGEILQSSNLKSFTSTELQAATRNFRVDSVLGDSGFGSVFKGWIDEHTPSAAKPGEGI  128

Query  531  VIAVKRLNHGG  563
            V+AVKR+   G
Sbjct  129  VVAVKRVYQDG  139



>ref|XP_007163407.1| hypothetical protein PHAVU_001G232300g [Phaseolus vulgaris]
 gb|ESW35401.1| hypothetical protein PHAVU_001G232300g [Phaseolus vulgaris]
Length=390

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (71%), Gaps = 4/117 (3%)
 Frame = +3

Query  219  MGICLS--VRIKAESP-HPGLSSK-CVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNL  386
            MG C S  ++IKAESP   GL         D SGL    S +S   TP+SE EIL++ NL
Sbjct  1    MGCCFSAPLKIKAESPPRNGLKIDGSKEENDPSGLSGKVSSSSMLLTPQSEDEILEATNL  60

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNH  557
            K+FTF +L+ ATR+FR DS +GEGGFG VFKGWID+++L+PTK GTG+VIAVKRLN 
Sbjct  61   KNFTFNELRTATRNFRPDSRVGEGGFGSVFKGWIDEHTLAPTKAGTGMVIAVKRLNQ  117



>ref|NP_001141912.1| uncharacterized LOC100274061 [Zea mays]
 gb|ACF87298.1| unknown [Zea mays]
 gb|AFW67139.1| putative protein kinase superfamily protein [Zea mays]
Length=418

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 80/119 (67%), Gaps = 5/119 (4%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTP---KSEGEILQSPNL  386
            MG C   RIK  S    G+ SK     DGS L    S+ S    P   K+E EILQS N+
Sbjct  1    MGNCWGARIKDGSAGASGMFSKSG-GKDGSRLSGCSSRASSASMPPSVKTECEILQSANV  59

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            K FTF +LK ATR+FR DSVLGEGGFG V+KGW+D+N+LSP +PGTG+ +AVKRLNH G
Sbjct  60   KIFTFNNLKAATRNFRPDSVLGEGGFGSVYKGWVDENTLSPCRPGTGIAVAVKRLNHEG  118



>ref|XP_008369907.1| PREDICTED: probable serine/threonine-protein kinase NAK [Malus 
domestica]
Length=441

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 86/118 (73%), Gaps = 6/118 (5%)
 Frame = +3

Query  213  LMMGICLSVRIKAESP-HPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLK  389
             +MG C S +IKAESP + G +SK      GSG    +S  S P TP+SEGEILQS  LK
Sbjct  46   FLMGACWSNKIKAESPLNTGFNSK-----QGSGSSGRNSSTSMPVTPRSEGEILQSTTLK  100

Query  390  SFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            S +F++LK ATR+FR DSVLG+GGFG VFKGWID++SL  +K GTG+VIAVK+LN  G
Sbjct  101  SISFSELKTATRNFRPDSVLGDGGFGSVFKGWIDESSLIASKAGTGMVIAVKKLNQDG  158



>ref|XP_009384872.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=419

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 85/129 (66%), Gaps = 14/129 (11%)
 Frame = +3

Query  219  MGICLSVRIKAESP-HPGLSSKCVI------STDGSGLGKSDSKNSP-------PQTPKS  356
            MG C   ++KAE+P H   +S  V       S  GS  G   S +S        P TP+S
Sbjct  1    MGNCWGAKVKAENPSHDVFASDTVFECLGEDSPHGSRKGNVLSSSSSRVSASSVPPTPRS  60

Query  357  EGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVI  536
            EGEIL S NLKSFTF +L+ ATR+FR DSVLGEGGFG VFKGWI++++L+  KPGTG+VI
Sbjct  61   EGEILTSSNLKSFTFNELRTATRNFRPDSVLGEGGFGSVFKGWINEHTLAAAKPGTGMVI  120

Query  537  AVKRLNHGG  563
            AVK+LN  G
Sbjct  121  AVKKLNQEG  129



>ref|XP_002440455.1| hypothetical protein SORBIDRAFT_09g001190 [Sorghum bicolor]
 gb|EES18885.1| hypothetical protein SORBIDRAFT_09g001190 [Sorghum bicolor]
Length=405

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 83/124 (67%), Gaps = 9/124 (7%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGL-----SSKCVISTDG----SGLGKSDSKNSPPQTPKSEGEIL  371
            MG C   +I ++SP  G      ++    S +G    SG     S  S   TP+SE EIL
Sbjct  1    MGNCWGAKISSDSPSRGAISPSGATSKFTSRNGAAALSGCSSHASSASMLPTPRSEDEIL  60

Query  372  QSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRL  551
            +S N+K+FTF +L+ ATR+FR DSVLGEGGFG VFKGWID+ +L+PT+PGTG+VIAVK+L
Sbjct  61   ESANVKAFTFNELRTATRNFRPDSVLGEGGFGSVFKGWIDEKTLAPTRPGTGMVIAVKKL  120

Query  552  NHGG  563
            N  G
Sbjct  121  NQEG  124



>gb|KJB76054.1| hypothetical protein B456_012G070600 [Gossypium raimondii]
Length=397

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  348  PKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTG  527
            P++EGEILQS NLKSF F++L+ ATR+FR DSVLGEGGFG VFKGWID+NSL+  KPGTG
Sbjct  30   PRTEGEILQSSNLKSFNFSELRTATRNFRPDSVLGEGGFGCVFKGWIDENSLTAAKPGTG  89

Query  528  LVIAVKRLNHGG  563
            LVIAVKRLN  G
Sbjct  90   LVIAVKRLNQEG  101



>gb|KFK24748.1| hypothetical protein AALP_AA8G019600 [Arabis alpina]
Length=389

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 78/115 (68%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S RIK +       S   +S DGS   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGACFSNRIKTDIASSTWLSSKFLSRDGS---KGSSTTSFSHMPRTEGEILQNANLKNFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             ++LK ATR FR DS++GEGGFG VFKGWID+ + +P+K GTG+VIAVKRLN  G
Sbjct  58   LSELKSATRSFRPDSMVGEGGFGCVFKGWIDETTFAPSKRGTGIVIAVKRLNLEG  112



>ref|XP_006398693.1| hypothetical protein EUTSA_v10013737mg [Eutrema salsugineum]
 gb|ESQ40146.1| hypothetical protein EUTSA_v10013737mg [Eutrema salsugineum]
Length=396

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 3/115 (3%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGLGKSDSKNSPPQTPKSEGEILQSPNLKSFT  398
            MG C S +I+ +       S   +S D S   K  S  S    P++EGEILQ+ NLK+F+
Sbjct  1    MGACFSNQIRTDIASSTWLSSKFLSRDTS---KGSSNTSFSHMPRTEGEILQNANLKNFS  57

Query  399  FADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
             ++LK +TR+FR DSV+GEGGFG VFKGWID+ + +P+KPGTG+VIAVKRLN  G
Sbjct  58   LSELKSSTRNFRPDSVVGEGGFGCVFKGWIDETTFAPSKPGTGIVIAVKRLNQEG  112



>ref|XP_004505860.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Cicer arietinum]
 ref|XP_004505861.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=420

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 87/133 (65%), Gaps = 18/133 (14%)
 Frame = +3

Query  219  MGICLSVRIKAESPH---PGLSSK-------------CVISTD-GSGLGK-SDSKNSPPQ  344
            MG+CL  +IK E+P     GLSSK             C +S D  S +G+ S +  S  Q
Sbjct  9    MGVCLGNQIKVENPFNSVSGLSSKSVNGNTEDLSIPCCKVSDDHSSSIGEVSATSVSVTQ  68

Query  345  TPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGT  524
            TP+S GEILQS NLKSFT  +L+ ATR+FR+DSVLG+ GFG VFKGWID+++ S  KPG 
Sbjct  69   TPRSVGEILQSSNLKSFTSTELQAATRNFRVDSVLGDSGFGSVFKGWIDEHTPSAAKPGE  128

Query  525  GLVIAVKRLNHGG  563
            G+V+AVKR+   G
Sbjct  129  GIVVAVKRVYQDG  141



>ref|XP_006827147.1| hypothetical protein AMTR_s00010p00251410 [Amborella trichopoda]
 gb|ERM94384.1| hypothetical protein AMTR_s00010p00251410 [Amborella trichopoda]
Length=409

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 83/121 (69%), Gaps = 12/121 (10%)
 Frame = +3

Query  219  MGICLSVRIKAESPH------PGLSSKCVI----STDGSGLGKSDSKNSPPQTPKSEGEI  368
            MG C      A++ H      P  SS   +     T GS  GKS+ +N P  TP++EGEI
Sbjct  1    MGNCFDKGGSAQTAHNSEISRPSNSSALTVPPSMQTSGSDSGKSNIENPP--TPRTEGEI  58

Query  369  LQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKR  548
            L SPNLK+FTF +LK ATR+FR DS++GEGGFG VFKGWID+ SLS +KPG+G+V+AVK+
Sbjct  59   LSSPNLKAFTFNELKNATRNFRPDSLIGEGGFGYVFKGWIDQQSLSASKPGSGMVVAVKK  118

Query  549  L  551
            L
Sbjct  119  L  119



>ref|XP_010558329.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Tarenaya hassleriana]
Length=345

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  342  QTPKSEGEILQSPNLKSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPG  521
              P+SEGEILQSPNLK+F+F++LK ATR+FR DSV+GEGGFG VFKGWID+NS S +KPG
Sbjct  53   HNPRSEGEILQSPNLKNFSFSELKSATRNFRPDSVVGEGGFGSVFKGWIDENSFSASKPG  112

Query  522  TGLVIAVKRLNHGG  563
            +G+VIAVKRLN  G
Sbjct  113  SGIVIAVKRLNQEG  126



>ref|XP_010690630.1| PREDICTED: probable serine/threonine-protein kinase NAK [Beta 
vulgaris subsp. vulgaris]
Length=408

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 78/119 (66%), Gaps = 18/119 (15%)
 Frame = +3

Query  219  MGICLSVRIKAESPHPGLSSKCVISTDGSGL----GKSDSKNSPPQTPKSEGEILQSPNL  386
            MG CLS+                +  DGS +    G SD   SP    +SEGEILQS NL
Sbjct  1    MGCCLSI--------------LQLKADGSPVHQNSGDSDRIQSPGLNQRSEGEILQSSNL  46

Query  387  KSFTFADLKMATRDFRLDSVLGEGGFGPVFKGWIDKNSLSPTKPGTGLVIAVKRLNHGG  563
            K+F++ DL  ATR+FR DSVLGEGGFG V+KGWID+++ +P KPG+G++IAVKRLNH G
Sbjct  47   KNFSYNDLCTATRNFRPDSVLGEGGFGCVYKGWIDEHTFAPAKPGSGMIIAVKRLNHEG  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880