BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF021M03

Length=374
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS68501.1|  hypothetical protein M569_06265                         157   9e-43   Genlisea aurea
ref|XP_009759837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    156   2e-42   Nicotiana sylvestris
ref|XP_009624740.1|  PREDICTED: glutamate--glyoxylate aminotransf...    155   2e-42   Nicotiana tomentosiformis
ref|XP_011071137.1|  PREDICTED: glutamate--glyoxylate aminotransf...    155   3e-42   
ref|XP_006357614.1|  PREDICTED: glutamate--glyoxylate aminotransf...    155   3e-42   Solanum tuberosum [potatoes]
ref|XP_004239121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    155   4e-42   Solanum lycopersicum
ref|XP_011086618.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    155   4e-42   
ref|XP_009765091.1|  PREDICTED: glutamate--glyoxylate aminotransf...    155   5e-42   Nicotiana sylvestris
ref|XP_009623844.1|  PREDICTED: glutamate--glyoxylate aminotransf...    155   5e-42   Nicotiana tomentosiformis
emb|CDP13207.1|  unnamed protein product                                154   9e-42   Coffea canephora [robusta coffee]
ref|XP_004228555.1|  PREDICTED: glutamate--glyoxylate aminotransf...    154   9e-42   Solanum lycopersicum
gb|EYU28421.1|  hypothetical protein MIMGU_mgv1a005535mg                154   1e-41   Erythranthe guttata [common monkey flower]
ref|XP_010552672.1|  PREDICTED: glutamate--glyoxylate aminotransf...    154   1e-41   Tarenaya hassleriana [spider flower]
ref|XP_004955316.1|  PREDICTED: glutamate--glyoxylate aminotransf...    154   1e-41   
ref|XP_006348507.1|  PREDICTED: glutamate--glyoxylate aminotransf...    153   3e-41   
ref|XP_006658210.1|  PREDICTED: glutamate--glyoxylate aminotransf...    153   3e-41   
ref|XP_009115544.1|  PREDICTED: glutamate--glyoxylate aminotransf...    152   4e-41   Brassica rapa
ref|XP_006416098.1|  hypothetical protein EUTSA_v10007514mg             150   5e-41   
ref|XP_002887312.1|  alanine-2-oxoglutarate aminotransferase 2          152   6e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_002527918.1|  alanine aminotransferase, putative                 151   7e-41   
dbj|BAH20108.1|  AT1G70580                                              152   8e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177215.1|  glutamate--glyoxylate aminotransferase 2              152   8e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498838.1|  PREDICTED: glutamate--glyoxylate aminotransf...    152   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006378236.1|  hypothetical protein POPTR_0010s05530g             149   1e-40   
ref|NP_001031083.1|  glutamate:glyoxylate aminotransferase              151   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002312679.2|  alanine-2-oxoglutarate aminotransferase 1 fa...    151   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_008340115.1|  PREDICTED: glutamate--glyoxylate aminotransf...    151   1e-40   Malus domestica [apple tree]
ref|XP_004309987.1|  PREDICTED: glutamate--glyoxylate aminotransf...    151   1e-40   Fragaria vesca subsp. vesca
ref|XP_004955317.1|  PREDICTED: glutamate--glyoxylate aminotransf...    151   1e-40   Setaria italica
emb|CDY12474.1|  BnaC07g13140D                                          152   1e-40   Brassica napus [oilseed rape]
gb|AAK25905.1|AF360195_1  putative alanine aminotransferase             151   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682426.1|  PREDICTED: glutamate--glyoxylate aminotransf...    151   1e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001058716.1|  Os07g0108300                                       151   1e-40   
ref|XP_006307377.1|  hypothetical protein CARUB_v10009003mg             151   1e-40   Capsella rubella
ref|XP_006300456.1|  hypothetical protein CARUB_v10020212mg             151   1e-40   
ref|XP_010471056.1|  PREDICTED: glutamate--glyoxylate aminotransf...    151   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010427837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    151   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_002893277.1|  alanine-2-oxoglutarate aminotransferase 1          151   1e-40   
gb|AAO84040.1|  alanine aminotransferase                                151   1e-40   Oryza sativa Indica Group [Indian rice]
ref|NP_564192.2|  glutamate:glyoxylate aminotransferase                 151   1e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24255.1|  At1g23310/F26F24_4                                      151   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415743.1|  PREDICTED: glutamate--glyoxylate aminotransf...    151   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006390865.1|  hypothetical protein EUTSA_v10018474mg             151   2e-40   
ref|XP_002315675.1|  hypothetical protein POPTR_0010s05530g             151   2e-40   Populus trichocarpa [western balsam poplar]
gb|KDP26646.1|  hypothetical protein JCGZ_17804                         150   2e-40   Jatropha curcas
ref|XP_006416099.1|  hypothetical protein EUTSA_v10007514mg             150   3e-40   
ref|XP_010100388.1|  Glutamate--glyoxylate aminotransferase 2           150   3e-40   Morus notabilis
ref|XP_008446998.1|  PREDICTED: glutamate--glyoxylate aminotransf...    145   3e-40   
ref|XP_010023477.1|  PREDICTED: glutamate--glyoxylate aminotransf...    150   3e-40   Eucalyptus grandis [rose gum]
ref|XP_004489786.1|  PREDICTED: glutamate--glyoxylate aminotransf...    150   3e-40   
ref|XP_006840828.1|  hypothetical protein AMTR_s00083p00031040          150   3e-40   Amborella trichopoda
ref|XP_004489787.1|  PREDICTED: glutamate--glyoxylate aminotransf...    150   3e-40   Cicer arietinum [garbanzo]
ref|NP_001151209.1|  alanine aminotransferase 2                         150   3e-40   
ref|XP_003613139.1|  Alanine aminotransferase                           150   3e-40   Medicago truncatula
ref|XP_003557680.1|  PREDICTED: glutamate--glyoxylate aminotransf...    150   3e-40   Brachypodium distachyon [annual false brome]
ref|XP_008447004.1|  PREDICTED: glutamate--glyoxylate aminotransf...    147   4e-40   
ref|XP_003613140.1|  Alanine aminotransferase                           149   4e-40   
ref|XP_010477627.1|  PREDICTED: glutamate--glyoxylate aminotransf...    149   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009413361.1|  PREDICTED: glutamate--glyoxylate aminotransf...    149   5e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009359228.1|  PREDICTED: glutamate--glyoxylate aminotransf...    149   5e-40   Pyrus x bretschneideri [bai li]
ref|XP_010460118.1|  PREDICTED: glutamate--glyoxylate aminotransf...    149   5e-40   Camelina sativa [gold-of-pleasure]
gb|AAZ43368.1|  AlaT1                                                   149   5e-40   Vitis labrusca [Concord grape]
ref|NP_001183048.1|  uncharacterized protein LOC100501386               149   5e-40   Zea mays [maize]
emb|CAN62302.1|  hypothetical protein VITISV_023686                     149   6e-40   Vitis vinifera
emb|CBI23368.3|  unnamed protein product                                149   6e-40   Vitis vinifera
gb|KDO82251.1|  hypothetical protein CISIN_1g041151mg                   149   6e-40   Citrus sinensis [apfelsine]
ref|NP_001268094.1|  uncharacterized protein LOC100261274               149   6e-40   Vitis vinifera
ref|XP_010927963.1|  PREDICTED: glutamate--glyoxylate aminotransf...    149   6e-40   Elaeis guineensis
ref|XP_008221924.1|  PREDICTED: glutamate--glyoxylate aminotransf...    149   9e-40   Prunus mume [ume]
ref|XP_010251104.1|  PREDICTED: glutamate--glyoxylate aminotransf...    149   9e-40   Nelumbo nucifera [Indian lotus]
ref|XP_004135487.1|  PREDICTED: glutamate--glyoxylate aminotransf...    149   9e-40   
tpg|DAA42656.1|  TPA: hypothetical protein ZEAMMB73_648980              149   1e-39   
gb|KHG15331.1|  Glutamate--glyoxylate aminotransferase 2 -like pr...    149   1e-39   Gossypium arboreum [tree cotton]
emb|CDY61225.1|  BnaC06g43710D                                          149   1e-39   Brassica napus [oilseed rape]
emb|CDY66294.1|  BnaAnng22050D                                          149   1e-39   Brassica napus [oilseed rape]
gb|AAM61453.1|  putative alanine aminotransferase                       148   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006438274.1|  hypothetical protein CICLE_v10031381mg             148   1e-39   Citrus clementina [clementine]
ref|XP_011014669.1|  PREDICTED: glutamate--glyoxylate aminotransf...    148   1e-39   Populus euphratica
ref|XP_009105727.1|  PREDICTED: glutamate--glyoxylate aminotransf...    148   1e-39   Brassica rapa
ref|XP_008789746.1|  PREDICTED: glutamate--glyoxylate aminotransf...    148   2e-39   
ref|XP_006438273.1|  hypothetical protein CICLE_v10031381mg             147   2e-39   
tpg|DAA42658.1|  TPA: LOW QUALITY PROTEIN: alanine aminotransfera...    148   2e-39   
ref|XP_007222799.1|  hypothetical protein PRUPE_ppa005017mg             148   2e-39   Prunus persica
ref|XP_009105726.1|  PREDICTED: glutamate--glyoxylate aminotransf...    148   2e-39   Brassica rapa
ref|XP_009110107.1|  PREDICTED: glutamate--glyoxylate aminotransf...    147   2e-39   Brassica rapa
emb|CDY41452.1|  BnaA08g20540D                                          147   2e-39   Brassica napus [oilseed rape]
ref|XP_007044762.1|  Alanine-2-oxoglutarate aminotransferase 2 is...    147   3e-39   
ref|XP_004155366.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    147   3e-39   
gb|EMT29455.1|  Alanine aminotransferase 2                              148   3e-39   
gb|KGN51765.1|  hypothetical protein Csa_5G598730                       147   3e-39   Cucumis sativus [cucumbers]
ref|XP_009103182.1|  PREDICTED: glutamate--glyoxylate aminotransf...    147   3e-39   Brassica rapa
ref|XP_009406515.1|  PREDICTED: glutamate--glyoxylate aminotransf...    147   3e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008444367.1|  PREDICTED: glutamate--glyoxylate aminotransf...    147   3e-39   Cucumis melo [Oriental melon]
ref|XP_008389735.1|  PREDICTED: glutamate--glyoxylate aminotransf...    147   3e-39   
ref|XP_002968244.1|  hypothetical protein SELMODRAFT_145611             147   4e-39   Selaginella moellendorffii
gb|KGN51767.1|  hypothetical protein Csa_5G598750                       147   4e-39   Cucumis sativus [cucumbers]
ref|XP_003519649.1|  PREDICTED: glutamate--glyoxylate aminotransf...    147   5e-39   Glycine max [soybeans]
ref|NP_001237581.1|  alanine aminotransferase 3                         147   5e-39   Glycine max [soybeans]
ref|NP_001237567.1|  alanine aminotransferase 2                         147   5e-39   
gb|KHN14541.1|  Glutamate--glyoxylate aminotransferase 2                147   5e-39   Glycine soja [wild soybean]
gb|KJB31174.1|  hypothetical protein B456_005G179600                    145   8e-39   Gossypium raimondii
gb|EMS58349.1|  Alanine aminotransferase 2                              146   1e-38   Triticum urartu
ref|XP_010928898.1|  PREDICTED: glutamate--glyoxylate aminotransf...    145   1e-38   Elaeis guineensis
gb|KJB31170.1|  hypothetical protein B456_005G179600                    145   1e-38   Gossypium raimondii
gb|AET06145.1|  PLP-dependent aminotransferase                          144   4e-38   Papaver somniferum
ref|XP_007158412.1|  hypothetical protein PHAVU_002G150800g             144   5e-38   Phaseolus vulgaris [French bean]
ref|XP_004142968.1|  PREDICTED: glutamate--glyoxylate aminotransf...    142   3e-37   Cucumis sativus [cucumbers]
ref|XP_001782822.1|  predicted protein                                  141   5e-37   
ref|XP_001777071.1|  predicted protein                                  140   1e-36   
ref|XP_001763950.1|  predicted protein                                  139   2e-36   
gb|KJB31175.1|  hypothetical protein B456_005G179600                    138   6e-36   Gossypium raimondii
gb|ABK25444.1|  unknown                                                 136   3e-35   Picea sitchensis
gb|AFK37995.1|  unknown                                                 121   1e-32   Lotus japonicus
ref|XP_002947519.1|  alanine aminotransferase                           120   1e-29   Volvox carteri f. nagariensis
gb|AAB01685.1|  alanine aminotransferase                                117   4e-28   Chlamydomonas reinhardtii
emb|CDY25781.1|  BnaA07g10010D                                          108   4e-28   Brassica napus [oilseed rape]
ref|XP_001698518.1|  alanine aminotransferase                           115   1e-27   Chlamydomonas reinhardtii
gb|KIZ04988.1|  alanine transaminase                                    106   2e-25   Monoraphidium neglectum
emb|CBJ25743.1|  nicotinanamine aminotransferase A                      108   2e-25   Ectocarpus siliculosus
gb|KIY95165.1|  alanine transaminase                                    100   2e-23   Monoraphidium neglectum
ref|XP_005651940.1|  alanine aminotransferase                           103   4e-23   Coccomyxa subellipsoidea C-169
emb|CAO02585.1|  alanine amino-transferase                            95.1    6e-23   Medicago truncatula var. truncatula
gb|EWM24220.1|  alanine-2-oxoglutarate aminotransferase 2               102   1e-22   Nannochloropsis gaditana
gb|ACF86318.1|  unknown                                               89.4    2e-20   Zea mays [maize]
ref|XP_005847240.1|  hypothetical protein CHLNCDRAFT_57929            89.4    4e-18   Chlorella variabilis
ref|XP_001745052.1|  hypothetical protein                             88.2    1e-17   Monosiga brevicollis MX1
gb|KIZ07569.1|  alanine transaminase                                  87.4    3e-17   Monoraphidium neglectum
gb|KDD76740.1|  aminotransferase                                      86.7    3e-17   Helicosporidium sp. ATCC 50920
gb|EJK50290.1|  hypothetical protein THAOC_30762                      86.3    6e-17   Thalassiosira oceanica
ref|XP_004992298.1|  alanine aminotransferase                         84.3    2e-16   Salpingoeca rosetta
ref|XP_002176328.1|  predicted protein                                84.3    2e-16   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_009041360.1|  hypothetical protein AURANDRAFT_67623            84.3    5e-16   Aureococcus anophagefferens
gb|EJK48082.1|  hypothetical protein THAOC_33157                      82.4    2e-15   Thalassiosira oceanica
ref|WP_026853156.1|  aminotransferase class I/II                      81.3    2e-15   Geothrix fermentans
ref|XP_001622550.1|  hypothetical protein NEMVEDRAFT_v1g236165        80.1    9e-15   Nematostella vectensis
gb|KFV83100.1|  Alanine aminotransferase 2                            79.7    9e-15   Struthio camelus australis
ref|XP_002289904.1|  alanine aminotransferase                         79.3    1e-14   Thalassiosira pseudonana CCMP1335
ref|XP_008797360.1|  PREDICTED: alanine aminotransferase 2-like       79.0    2e-14   Phoenix dactylifera
ref|XP_010917381.1|  PREDICTED: alanine aminotransferase 2-like i...  78.2    3e-14   Elaeis guineensis
gb|KDR12685.1|  Alanine aminotransferase 2                            78.2    4e-14   Zootermopsis nevadensis
ref|XP_003724792.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  78.2    5e-14   
ref|XP_011398130.1|  putative alanine aminotransferase, mitochond...  77.8    5e-14   Auxenochlorella protothecoides
ref|XP_010917380.1|  PREDICTED: alanine aminotransferase 2-like i...  77.8    5e-14   Elaeis guineensis
ref|XP_010917379.1|  PREDICTED: alanine aminotransferase 2-like i...  77.8    5e-14   Elaeis guineensis
ref|XP_010917378.1|  PREDICTED: alanine aminotransferase 2-like i...  77.8    6e-14   Elaeis guineensis
emb|CDS30789.1|  gag pol polyprotein                                  77.4    6e-14   Hymenolepis microstoma
emb|CCW65758.1|  unnamed protein product                              77.0    9e-14   Phytomonas sp. isolate EM1
gb|AGT60040.1|  aminotransferase                                      76.6    1e-13   uncultured bacterium
ref|XP_004510570.1|  PREDICTED: alanine aminotransferase 2, mitoc...  76.6    1e-13   Cicer arietinum [garbanzo]
gb|ACJ85860.1|  unknown                                               76.6    1e-13   Medicago truncatula
ref|XP_003627448.1|  Alanine aminotransferase                         76.6    1e-13   Medicago truncatula
ref|XP_006342898.1|  PREDICTED: alanine aminotransferase 2, mitoc...  76.3    2e-13   Solanum tuberosum [potatoes]
ref|XP_003760591.1|  PREDICTED: alanine aminotransferase 1            76.3    2e-13   
ref|XP_001769989.1|  predicted protein                                76.3    2e-13   
ref|XP_011048627.1|  PREDICTED: alanine aminotransferase 2, mitoc...  76.3    2e-13   Populus euphratica
ref|XP_009051124.1|  hypothetical protein LOTGIDRAFT_114341           76.3    2e-13   Lottia gigantea
ref|XP_003646187.1|  hypothetical protein Ecym_4307                   76.3    2e-13   Eremothecium cymbalariae DBVPG#7215
gb|KFP06658.1|  Alanine aminotransferase 2                            76.3    2e-13   Calypte anna
ref|XP_010939848.1|  PREDICTED: alanine aminotransferase 2 isofor...  76.3    2e-13   Elaeis guineensis
ref|XP_010261672.1|  PREDICTED: alanine aminotransferase 2-like       75.9    2e-13   Nelumbo nucifera [Indian lotus]
gb|AGE89226.1|  cytosolic alanine aminotransferase                    73.2    2e-13   Dicentrarchus labrax [European sea bass]
ref|XP_005052721.1|  PREDICTED: alanine aminotransferase 2 isofor...  75.9    2e-13   Ficedula albicollis
ref|XP_005526439.1|  PREDICTED: alanine aminotransferase 2 isofor...  75.9    2e-13   Pseudopodoces humilis [Tibetan ground-jay]
gb|KFW64540.1|  Alanine aminotransferase 2                            75.9    3e-13   Pygoscelis adeliae
ref|XP_008499534.1|  PREDICTED: alanine aminotransferase 2            75.9    3e-13   Calypte anna
ref|XP_008637027.1|  PREDICTED: alanine aminotransferase 2            75.9    3e-13   Corvus brachyrhynchos
ref|XP_002194653.1|  PREDICTED: alanine aminotransferase 2            75.9    3e-13   Taeniopygia guttata
gb|KFQ95766.1|  Alanine aminotransferase 2                            75.9    3e-13   Nipponia nippon
gb|KFM05788.1|  Alanine aminotransferase 2                            75.9    3e-13   Aptenodytes forsteri
gb|KFO63157.1|  Alanine aminotransferase 2                            75.9    3e-13   Corvus brachyrhynchos
ref|XP_008305774.1|  PREDICTED: alanine aminotransferase 1            75.5    3e-13   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_002430266.1|  Alanine aminotransferase, putative               75.5    3e-13   Pediculus humanus corporis [human body lice]
ref|WP_005033524.1|  aminotransferase class I/II                      75.1    4e-13   Holophaga foetida
ref|XP_006121251.1|  PREDICTED: alanine aminotransferase 2            75.5    4e-13   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_007059708.1|  PREDICTED: alanine aminotransferase 2            75.5    4e-13   Chelonia mydas [green seaturtle]
ref|XP_005289905.1|  PREDICTED: alanine aminotransferase 2            75.1    4e-13   Chrysemys picta bellii
ref|XP_002175263.1|  alanine aminotransferase                         75.1    5e-13   Schizosaccharomyces japonicus yFS275
ref|XP_008783332.1|  PREDICTED: alanine aminotransferase 2            75.1    5e-13   Phoenix dactylifera
ref|XP_006657960.1|  PREDICTED: alanine aminotransferase 2-like i...  75.1    5e-13   Oryza brachyantha
ref|XP_011499275.1|  PREDICTED: alanine aminotransferase 2            75.1    5e-13   Ceratosolen solmsi marchali
gb|EEE67593.1|  hypothetical protein OsJ_25140                        75.1    5e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82447.1|  hypothetical protein OsI_26881                        75.1    5e-13   Oryza sativa Indica Group [Indian rice]
gb|KFO69634.1|  Alanine aminotransferase 2                            74.7    5e-13   Cuculus canorus
gb|AGG11473.1|  hypothetical protein                                  74.7    5e-13   Paratrypanosoma confusum
ref|XP_011140986.1|  PREDICTED: alanine aminotransferase 1 isofor...  75.1    6e-13   Harpegnathos saltator
ref|XP_003967921.1|  PREDICTED: alanine aminotransferase 2-like       74.3    6e-13   
ref|XP_010318453.1|  PREDICTED: alanine aminotransferase 2, mitoc...  74.7    6e-13   Solanum lycopersicum
ref|XP_008380735.1|  PREDICTED: alanine aminotransferase 2            74.7    6e-13   Malus domestica [apple tree]
ref|XP_006775215.1|  PREDICTED: alanine aminotransferase 1            73.2    6e-13   Myotis davidii
gb|AFK39904.1|  unknown                                               74.7    6e-13   Medicago truncatula
ref|WP_012096788.1|  aminotransferase class I/II                      74.3    6e-13   Anaeromyxobacter sp. Fw109-5
ref|XP_009380146.1|  PREDICTED: alanine aminotransferase 2-like       74.7    7e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008460349.1|  PREDICTED: alanine aminotransferase 1, mitoc...  74.3    7e-13   Cucumis melo [Oriental melon]
ref|XP_004235528.1|  PREDICTED: alanine aminotransferase 2, mitoc...  74.3    7e-13   
emb|CBN81871.1|  Alanine aminotransferase 2-like                      74.3    8e-13   Dicentrarchus labrax [European sea bass]
ref|XP_010318452.1|  PREDICTED: alanine aminotransferase 2, mitoc...  74.3    8e-13   Solanum lycopersicum
gb|KFV72169.1|  Alanine aminotransferase 2                            74.3    9e-13   Picoides pubescens
gb|KFH67262.1|  alanine transaminase                                  74.3    9e-13   Mortierella verticillata NRRL 6337
ref|XP_005865158.1|  PREDICTED: alanine aminotransferase 1            72.0    9e-13   Myotis brandtii
ref|XP_009904992.1|  PREDICTED: alanine aminotransferase 2            73.9    1e-12   Picoides pubescens
tpg|DAA63614.1|  TPA: hypothetical protein ZEAMMB73_898222            71.2    1e-12   
ref|XP_002304255.2|  hypothetical protein POPTR_0003s07020g           73.9    1e-12   
ref|XP_002532946.1|  alanine transaminase, putative                   71.2    1e-12   
ref|XP_007510961.1|  predicted protein                                73.9    1e-12   Bathycoccus prasinos
ref|XP_005648726.1|  alanine aminotransferase 2                       73.9    1e-12   Coccomyxa subellipsoidea C-169
emb|CDI98892.1|  alanine aminotransferase 2                           73.9    1e-12   
ref|XP_008460347.1|  PREDICTED: alanine aminotransferase 2-like i...  73.9    1e-12   Cucumis melo [Oriental melon]
ref|XP_008800517.1|  PREDICTED: alanine aminotransferase 2-like       73.9    1e-12   
ref|XP_004144444.1|  PREDICTED: alanine aminotransferase 2, mitoc...  73.9    1e-12   
gb|KGN58474.1|  hypothetical protein Csa_3G646610                     73.9    1e-12   Cucumis sativus [cucumbers]
ref|XP_010896061.1|  PREDICTED: alanine aminotransferase 2            73.9    1e-12   Esox lucius
ref|XP_008436808.1|  PREDICTED: alanine aminotransferase 1            73.6    1e-12   Poecilia reticulata
ref|XP_006794722.1|  PREDICTED: alanine aminotransferase 2-like       73.6    1e-12   Neolamprologus brichardi [lyretail cichlid]
ref|XP_011079322.1|  PREDICTED: alanine aminotransferase 2-like       73.6    1e-12   Sesamum indicum [beniseed]
ref|XP_010537653.1|  PREDICTED: alanine aminotransferase 2, mitoc...  73.6    2e-12   Tarenaya hassleriana [spider flower]
ref|XP_011304772.1|  PREDICTED: alanine aminotransferase 1            73.6    2e-12   Fopius arisanus
ref|XP_001219089.1|  alanine aminotransferase                         73.6    2e-12   Trypanosoma brucei brucei TREU927
ref|NP_001136246.1|  alanine aminotransferase 2-like                  73.2    2e-12   Danio rerio [leopard danio]
ref|XP_004600748.1|  PREDICTED: alanine aminotransferase 2            73.6    2e-12   Sorex araneus [Eurasian shrew]
ref|XP_003222977.1|  PREDICTED: alanine aminotransferase 2            73.6    2e-12   Anolis carolinensis [Carolina anole]
ref|XP_006559494.1|  PREDICTED: alanine aminotransferase 2-like       73.6    2e-12   Apis mellifera [bee]
dbj|GAA97564.1|  hypothetical protein E5Q_04242                       73.6    2e-12   Mixia osmundae IAM 14324
ref|XP_006641441.1|  PREDICTED: alanine aminotransferase 2-like       73.2    2e-12   Lepisosteus oculatus
ref|XP_011036545.1|  PREDICTED: alanine aminotransferase 2-like       73.2    2e-12   Populus euphratica
ref|XP_002265294.2|  PREDICTED: alanine aminotransferase 2            73.2    2e-12   Vitis vinifera
gb|ADB91976.1|  alanine aminotransferase                              73.2    2e-12   Branchiostoma belcheri
ref|XP_011169171.1|  PREDICTED: alanine aminotransferase 2-like i...  72.8    2e-12   Solenopsis invicta [imported red fire ant]
ref|XP_006607395.1|  PREDICTED: alanine aminotransferase 2-like i...  73.2    2e-12   Apis dorsata [rock honeybee]
ref|XP_003291733.1|  alanine transaminase                             73.2    2e-12   Dictyostelium purpureum
ref|XP_004664888.1|  PREDICTED: alanine aminotransferase 2            73.2    2e-12   Jaculus jaculus
ref|XP_010029516.1|  PREDICTED: alanine aminotransferase 2-like       73.2    2e-12   Eucalyptus grandis [rose gum]
ref|XP_005105612.1|  PREDICTED: alanine aminotransferase 2-like       72.8    2e-12   Aplysia californica
ref|XP_003692587.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  73.2    2e-12   
gb|AAH61955.1|  Gpt2l protein                                         73.2    3e-12   Danio rerio [leopard danio]
ref|XP_004546617.1|  PREDICTED: alanine aminotransferase 2-like i...  72.8    3e-12   Maylandia zebra
ref|XP_005912152.1|  PREDICTED: alanine aminotransferase 2-like i...  72.8    3e-12   Haplochromis burtoni
ref|XP_005912151.1|  PREDICTED: alanine aminotransferase 2-like i...  72.8    3e-12   Haplochromis burtoni
ref|XP_004546618.1|  PREDICTED: alanine aminotransferase 2-like i...  72.8    3e-12   Maylandia zebra
ref|XP_003443544.1|  PREDICTED: alanine aminotransferase 2-like i...  72.8    3e-12   Oreochromis niloticus
ref|XP_005471814.1|  PREDICTED: alanine aminotransferase 2-like i...  72.8    3e-12   Oreochromis niloticus
sp|Q6NYL5.2|ALAT2_DANRE  RecName: Full=Alanine aminotransferase 2...  72.8    3e-12   Danio rerio [leopard danio]
gb|AIT69925.1|  alanine transaminase                                  72.8    3e-12   Saccharina sculpera
gb|AGE89227.1|  mitochondrial alanine aminotransferase                69.7    3e-12   Dicentrarchus labrax [European sea bass]
ref|XP_005526440.1|  PREDICTED: alanine aminotransferase 2 isofor...  72.4    3e-12   
ref|XP_008068165.1|  PREDICTED: alanine aminotransferase 1            72.8    3e-12   Carlito syrichta
emb|CBI35796.3|  unnamed protein product                              72.8    3e-12   Vitis vinifera
ref|XP_008302267.1|  PREDICTED: alanine aminotransferase 1            72.8    3e-12   Stegastes partitus
gb|AIT69927.1|  alanine transaminase                                  72.8    3e-12   Saccharina japonica
ref|XP_008682329.1|  PREDICTED: alanine aminotransferase 1            70.1    3e-12   Ursus maritimus [white bear]
ref|XP_009461778.1|  PREDICTED: alanine aminotransferase 2 isofor...  72.4    3e-12   Nipponia nippon
ref|XP_005722569.1|  PREDICTED: alanine aminotransferase 2-like       72.4    4e-12   Pundamilia nyererei
ref|XP_010733467.1|  PREDICTED: alanine aminotransferase 1            72.4    4e-12   
gb|KDP40629.1|  hypothetical protein JCGZ_24628                       72.4    4e-12   Jatropha curcas
ref|XP_007230448.1|  PREDICTED: alanine aminotransferase 2            72.4    4e-12   
gb|EWC46913.1|  hypothetical protein DRE_03925                        72.4    4e-12   Drechslerella stenobrocha 248
ref|XP_011072689.1|  PREDICTED: alanine aminotransferase 2            72.4    4e-12   Sesamum indicum [beniseed]
ref|XP_004303756.1|  PREDICTED: alanine aminotransferase 2            72.4    4e-12   Fragaria vesca subsp. vesca
ref|XP_010884157.1|  PREDICTED: alanine aminotransferase 1 isofor...  72.4    4e-12   Esox lucius
ref|XP_008653343.1|  PREDICTED: alanine aminotransferase 2            72.4    4e-12   Zea mays [maize]
ref|XP_002112002.1|  hypothetical protein TRIADDRAFT_50189            72.0    4e-12   Trichoplax adhaerens
emb|CBH09087.1|  alanine aminotransferase, putative                   72.4    4e-12   Trypanosoma brucei gambiense DAL972
emb|CDQ82436.1|  unnamed protein product                              72.4    4e-12   Oncorhynchus mykiss
ref|XP_007217248.1|  hypothetical protein PRUPE_ppa003850mg           72.4    5e-12   Prunus persica
emb|CDS24338.1|  alanine aminotransferase 2                           72.4    5e-12   Echinococcus granulosus
ref|XP_011337890.1|  PREDICTED: alanine aminotransferase 1 isofor...  72.4    5e-12   Ooceraea biroi
ref|XP_008432758.1|  PREDICTED: alanine aminotransferase 2-like       72.4    5e-12   Poecilia reticulata
ref|NP_001237553.1|  alanine aminotransferase 1                       72.0    5e-12   
ref|XP_011260421.1|  PREDICTED: alanine aminotransferase 1            72.0    5e-12   Camponotus floridanus
ref|XP_008228107.1|  PREDICTED: alanine aminotransferase 2, mitoc...  72.0    5e-12   Prunus mume [ume]
gb|EFN75006.1|  Alanine aminotransferase 2                            72.0    6e-12   Camponotus floridanus
ref|XP_007537771.1|  PREDICTED: alanine aminotransferase 2 isofor...  72.0    6e-12   Erinaceus europaeus [common hedgehog]
gb|KHN39571.1|  Alanine aminotransferase 2, mitochondrial             72.0    6e-12   Glycine soja [wild soybean]
gb|EUB57099.1|  Alanine aminotransferase 2                            72.0    6e-12   Echinococcus granulosus
ref|XP_004690373.1|  PREDICTED: alanine aminotransferase 2            72.0    6e-12   Condylura cristata
ref|XP_010273809.1|  PREDICTED: alanine aminotransferase 2-like       72.0    6e-12   Nelumbo nucifera [Indian lotus]
ref|XP_006014678.1|  PREDICTED: LOW QUALITY PROTEIN: glutamic pyr...  72.0    6e-12   
gb|AIT69915.1|  alanine transaminase                                  71.6    6e-12   Undaria pinnatifida
ref|XP_009013795.1|  hypothetical protein HELRODRAFT_185412           71.6    6e-12   Helobdella robusta
ref|XP_006426797.1|  hypothetical protein CICLE_v10025334mg           72.0    6e-12   
gb|AHW58022.1|  alanine aminotransferase 1                            72.0    6e-12   
ref|XP_008157904.1|  PREDICTED: alanine aminotransferase 1            71.6    6e-12   
ref|XP_009555221.1|  PREDICTED: alanine aminotransferase 2            71.6    6e-12   
ref|XP_009389580.1|  PREDICTED: alanine aminotransferase 2-like       71.6    6e-12   
ref|XP_003528736.1|  PREDICTED: alanine aminotransferase 2, mitoc...  72.0    6e-12   
ref|XP_011109633.1|  hypothetical protein H072_3664                   71.6    6e-12   
gb|KDO53768.1|  hypothetical protein CISIN_1g009517mg                 71.6    6e-12   
ref|XP_006416720.1|  hypothetical protein EUTSA_v10007290mg           72.0    7e-12   
gb|KEQ94204.1|  hypothetical protein AUEXF2481DRAFT_41383             71.6    7e-12   
ref|XP_004235527.1|  PREDICTED: alanine aminotransferase 2-like       72.0    7e-12   
ref|XP_006110043.1|  PREDICTED: LOW QUALITY PROTEIN: glutamic-pyr...  72.0    7e-12   
ref|XP_009798100.1|  PREDICTED: alanine aminotransferase 2-like       71.6    7e-12   
ref|XP_003489354.1|  PREDICTED: alanine aminotransferase 2-like       71.6    8e-12   
ref|XP_003429759.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  71.6    8e-12   
ref|XP_010937250.1|  PREDICTED: alanine aminotransferase 2            71.6    8e-12   
ref|XP_008332649.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  71.6    8e-12   
gb|AIT69919.1|  alanine transaminase                                  71.6    8e-12   
ref|XP_003403160.1|  PREDICTED: alanine aminotransferase 2-like       71.6    8e-12   
tpg|DAA46932.1|  TPA: hypothetical protein ZEAMMB73_135514            67.0    9e-12   
gb|AIT69916.1|  alanine transaminase                                  71.2    9e-12   
ref|XP_009382959.1|  PREDICTED: alanine aminotransferase 2            71.2    9e-12   
ref|XP_004959833.1|  PREDICTED: alanine aminotransferase 2, mitoc...  71.2    9e-12   
ref|XP_004704756.1|  PREDICTED: alanine aminotransferase 2            71.2    9e-12   
dbj|BAC79866.1|  putative alanine aminotransferase                    71.2    9e-12   
ref|XP_003055208.1|  predicted protein                                71.2    9e-12   
ref|XP_002931716.1|  PREDICTED: alanine aminotransferase 2-like       71.2    9e-12   
ref|XP_011127540.1|  hypothetical protein AOL_s00215g36               71.2    1e-11   
ref|XP_004479735.1|  PREDICTED: alanine aminotransferase 2 isoform 1  71.2    1e-11   
ref|XP_002946490.1|  hypothetical protein VOLCADRAFT_120326           71.6    1e-11   
gb|KDO53767.1|  hypothetical protein CISIN_1g009517mg                 71.2    1e-11   
ref|XP_006426798.1|  hypothetical protein CICLE_v10025334mg           71.2    1e-11   
ref|XP_004618719.1|  PREDICTED: alanine aminotransferase 1            71.2    1e-11   
ref|XP_004155894.1|  PREDICTED: alanine aminotransferase 2, mitoc...  71.2    1e-11   
ref|XP_004141733.1|  PREDICTED: alanine aminotransferase 2, mitoc...  71.2    1e-11   
ref|XP_006465804.1|  PREDICTED: alanine aminotransferase 2, mitoc...  71.2    1e-11   
gb|ELK11760.1|  Alanine aminotransferase 1                            71.2    1e-11   
gb|KJB57088.1|  hypothetical protein B456_009G147700                  71.2    1e-11   
gb|KEQ74308.1|  PLP-dependent transferase                             71.2    1e-11   
ref|XP_005141728.1|  PREDICTED: alanine aminotransferase 2            70.9    1e-11   
ref|XP_008180133.1|  PREDICTED: alanine aminotransferase 2 isofor...  70.9    1e-11   
emb|CDO97792.1|  unnamed protein product                              70.9    1e-11   
ref|XP_006872626.1|  PREDICTED: alanine aminotransferase 2            71.2    1e-11   
ref|XP_010948490.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  71.2    1e-11   
ref|XP_006828619.1|  hypothetical protein AMTR_s00129p00079480        68.2    1e-11   
pdb|3TCM|A  Chain A, Crystal Structure Of Alanine Aminotransferas...  70.9    1e-11   
gb|KJB57090.1|  hypothetical protein B456_009G147700                  71.2    1e-11   
gb|KJB57091.1|  hypothetical protein B456_009G147700                  71.2    1e-11   
ref|XP_011485336.1|  PREDICTED: alanine aminotransferase 2-like i...  70.9    1e-11   
ref|XP_003230304.2|  PREDICTED: alanine aminotransferase 2-like       70.5    1e-11   
ref|XP_004079476.1|  PREDICTED: alanine aminotransferase 2-like i...  71.2    1e-11   
emb|CDQ76371.1|  unnamed protein product                              70.9    1e-11   
ref|XP_001948711.2|  PREDICTED: alanine aminotransferase 1 isofor...  70.9    1e-11   
gb|ENN78579.1|  hypothetical protein YQE_04947                        70.9    1e-11   
emb|CCC89394.1|  putative alanine aminotransferase                    70.9    1e-11   
ref|XP_004479736.1|  PREDICTED: alanine aminotransferase 2 isoform 2  70.9    1e-11   
sp|P52894.1|ALA2_HORVU  RecName: Full=Alanine aminotransferase 2;...  70.9    1e-11   
ref|XP_005800011.1|  PREDICTED: alanine aminotransferase 2-like i...  70.9    1e-11   
ref|XP_006357426.1|  PREDICTED: alanine aminotransferase 2, mitoc...  70.9    1e-11   
ref|XP_005664519.1|  PREDICTED: alanine aminotransferase 2 isofor...  70.9    1e-11   
ref|XP_003127043.1|  PREDICTED: alanine aminotransferase 2 isofor...  70.9    1e-11   
ref|XP_010685211.1|  PREDICTED: alanine aminotransferase 2            70.9    1e-11   
ref|XP_009783410.1|  PREDICTED: alanine aminotransferase 2, mitoc...  70.9    2e-11   
emb|CDX81815.1|  BnaC08g37860D                                        70.9    2e-11   
dbj|GAM23260.1|  hypothetical protein SAMD00019534_064350             70.9    2e-11   
ref|XP_003702497.1|  PREDICTED: alanine aminotransferase 2-like       70.9    2e-11   
ref|XP_004081051.1|  PREDICTED: alanine aminotransferase 2-like       70.5    2e-11   
gb|AIT69926.1|  alanine transaminase                                  70.5    2e-11   
gb|AAP42512.1|  mitochondrial alanine aminotransferase                70.9    2e-11   
ref|XP_005800010.1|  PREDICTED: alanine aminotransferase 2-like i...  70.9    2e-11   
ref|XP_008462239.1|  PREDICTED: alanine aminotransferase 1, mitoc...  70.5    2e-11   
ref|XP_003228933.1|  PREDICTED: alanine aminotransferase 1-like       70.5    2e-11   
gb|KFK43924.1|  hypothetical protein AALP_AA1G191800                  70.9    2e-11   
ref|XP_007547926.1|  PREDICTED: alanine aminotransferase 1            70.5    2e-11   
ref|XP_006634237.1|  PREDICTED: alanine aminotransferase 2-like       70.5    2e-11   
ref|XP_010980943.1|  PREDICTED: alanine aminotransferase 2            70.9    2e-11   
gb|AIT69921.1|  alanine transaminase                                  70.5    2e-11   
ref|XP_009117710.1|  PREDICTED: alanine aminotransferase 1, mitoc...  70.5    2e-11   
gb|EYE95145.1|  PLP-dependent transferase                             70.5    2e-11   
ref|NP_001132269.1|  uncharacterized protein LOC100193705             67.8    2e-11   
gb|AIT69923.1|  alanine transaminase                                  70.5    2e-11   
gb|AAF82782.1|AF275372_1  alanine aminotransferase                    70.5    2e-11   
ref|NP_173173.3|  alanine aminotransferase                            70.5    2e-11   
emb|CEF68484.1|  Alanine aminotransferase 1                           70.5    2e-11   
gb|AAP42511.1|  cytosolic alanine aminotransferase                    70.5    2e-11   
ref|XP_002890217.1|  alanine aminotransferase                         70.5    2e-11   
gb|AAK64147.2|  putative alanine aminotransferase                     70.5    2e-11   
emb|CDY21752.1|  BnaA09g45030D                                        70.5    2e-11   
gb|ABC59812.1|  cytosolic alanine aminotransferase 2                  70.5    2e-11   
ref|XP_009110415.1|  PREDICTED: alanine aminotransferase 1, mitoc...  70.5    2e-11   
gb|AIT69931.1|  alanine transaminase                                  70.5    2e-11   
gb|AIT69930.1|  alanine transaminase                                  70.5    2e-11   
ref|XP_002463187.1|  hypothetical protein SORBIDRAFT_02g039340        70.5    2e-11   
ref|XP_003425526.1|  PREDICTED: alanine aminotransferase 2            70.5    2e-11   
ref|XP_637993.1|  alanine transaminase                                70.5    2e-11   
emb|CDX96776.1|  BnaA08g23190D                                        70.5    2e-11   
emb|CDX83914.1|  BnaC08g17310D                                        70.5    2e-11   
ref|XP_007091606.1|  PREDICTED: alanine aminotransferase 1            68.9    2e-11   
ref|XP_004241856.1|  PREDICTED: alanine aminotransferase 2-like       70.5    2e-11   
ref|XP_009627254.1|  PREDICTED: alanine aminotransferase 2-like       70.5    2e-11   
ref|XP_006913061.1|  PREDICTED: alanine aminotransferase 1 isofor...  70.1    2e-11   
ref|XP_011373236.1|  PREDICTED: alanine aminotransferase 1            70.1    2e-11   
gb|EPS60556.1|  hypothetical protein M569_14246                       70.1    2e-11   
ref|XP_006913060.1|  PREDICTED: alanine aminotransferase 1 isofor...  70.1    2e-11   
ref|XP_002075264.1|  GK17070                                          70.5    2e-11   
gb|AIT69922.1|  alanine transaminase                                  70.1    2e-11   
gb|EYU21272.1|  hypothetical protein MIMGU_mgv1a003837mg              70.5    2e-11   
ref|XP_008120969.1|  PREDICTED: alanine aminotransferase 1-like       70.1    2e-11   
ref|XP_006369083.1|  alanine aminotransferas family protein           70.1    2e-11   
gb|KJB70038.1|  hypothetical protein B456_011G0552002                 66.6    2e-11   
ref|XP_001563113.2|  alanine aminotransferase                         70.1    2e-11   
gb|AGT02519.1|  alanine transaminase                                  70.1    2e-11   
ref|XP_010697044.1|  alanine aminotransferase                         70.1    2e-11   
ref|XP_009149177.1|  PREDICTED: alanine aminotransferase 1, mitoc...  70.1    2e-11   
ref|XP_007441690.1|  PREDICTED: alanine aminotransferase 2-like i...  70.1    2e-11   
ref|XP_007488862.1|  PREDICTED: alanine aminotransferase 1 isofor...  70.1    3e-11   
gb|KDO53769.1|  hypothetical protein CISIN_1g009517mg                 69.3    3e-11   
ref|XP_008460348.1|  PREDICTED: alanine aminotransferase 2, mitoc...  70.1    3e-11   
ref|XP_001267930.1|  alanine aminotransferase, putative               70.1    3e-11   
ref|XP_007024768.1|  Alanine aminotransferase 2                       70.1    3e-11   
emb|CDY48485.1|  BnaC05g13450D                                        70.1    3e-11   
ref|XP_007441689.1|  PREDICTED: alanine aminotransferase 2-like i...  70.1    3e-11   
emb|CDQ55986.1|  unnamed protein product                              68.9    3e-11   
ref|XP_001372290.1|  PREDICTED: alanine aminotransferase 1 isofor...  69.7    3e-11   
ref|XP_010727539.1|  PREDICTED: alanine aminotransferase 2-like i...  70.1    3e-11   
emb|CDY26256.1|  BnaA06g11610D                                        70.1    3e-11   
ref|XP_005766369.1|  hypothetical protein EMIHUDRAFT_256711           67.0    3e-11   
ref|XP_006744841.1|  PREDICTED: alanine aminotransferase 1-like       67.8    3e-11   
ref|XP_007441688.1|  PREDICTED: alanine aminotransferase 2-like i...  69.7    3e-11   
ref|XP_006342897.1|  PREDICTED: alanine aminotransferase 2, mitoc...  69.7    3e-11   
ref|XP_003757274.1|  PREDICTED: alanine aminotransferase 2            69.7    3e-11   
gb|AGT02697.1|  alanine transaminase                                  69.7    3e-11   
emb|CDO96247.1|  unnamed protein product                              69.7    3e-11   
gb|AIT69918.1|  alanine transaminase                                  69.7    3e-11   
ref|XP_010727540.1|  PREDICTED: alanine aminotransferase 2-like i...  69.7    3e-11   
ref|XP_001919896.1|  PREDICTED: alanine aminotransferase 1            69.7    3e-11   
ref|XP_003682412.1|  hypothetical protein TDEL_0F03900                69.7    3e-11   
ref|XP_002133684.1|  GA22670                                          69.7    4e-11   
gb|AET06148.1|  PLP-dependent aminotransferase                        69.7    4e-11   
ref|XP_002430215.1|  Alanine aminotransferase, putative               69.7    4e-11   
ref|XP_005367071.1|  PREDICTED: alanine aminotransferase 2            69.7    4e-11   
ref|XP_005897946.1|  PREDICTED: alanine aminotransferase 1-like       67.0    4e-11   
ref|XP_005912582.1|  PREDICTED: alanine aminotransferase 2-like i...  69.3    4e-11   
ref|XP_003975367.1|  PREDICTED: alanine aminotransferase 2-like       69.7    4e-11   
ref|XP_011430941.1|  PREDICTED: alanine aminotransferase 1-like       69.3    4e-11   
gb|AAH34219.1|  Glutamic pyruvate transaminase (alanine aminotran...  69.3    4e-11   
ref|XP_010727537.1|  PREDICTED: alanine aminotransferase 2-like i...  69.7    4e-11   
dbj|BAC36035.1|  unnamed protein product                              69.3    4e-11   
ref|XP_004583879.1|  PREDICTED: alanine aminotransferase 2 isofor...  69.3    4e-11   
gb|EFZ12113.1|  hypothetical protein SINV_03790                       69.3    4e-11   
ref|NP_001012057.1|  alanine aminotransferase 2                       69.3    4e-11   
ref|XP_006971817.1|  PREDICTED: alanine aminotransferase 2 isofor...  69.3    4e-11   
ref|NP_776291.1|  alanine aminotransferase 2                          69.3    4e-11   
ref|XP_455940.1|  hypothetical protein                                69.3    4e-11   
ref|XP_007548658.1|  PREDICTED: alanine aminotransferase 2-like i...  69.3    4e-11   
dbj|BAQ21243.1|  hypothetical protein                                 65.5    5e-11   
ref|XP_007185570.1|  PREDICTED: alanine aminotransferase 1            67.0    5e-11   
ref|XP_008524431.1|  PREDICTED: alanine aminotransferase 1            69.3    5e-11   
gb|EMT05433.1|  Alanine aminotransferase 2                            69.3    5e-11   
ref|XP_005613478.1|  PREDICTED: alanine aminotransferase 1            68.9    5e-11   
ref|XP_009315638.1|  alanine aminotransferase                         69.3    5e-11   
ref|XP_007548657.1|  PREDICTED: alanine aminotransferase 2-like i...  69.3    5e-11   
ref|XP_007629626.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  69.3    5e-11   
ref|XP_008827852.1|  PREDICTED: alanine aminotransferase 2 isofor...  69.3    5e-11   
ref|XP_414111.3|  PREDICTED: alanine aminotransferase 2 isoform X2    69.3    5e-11   
gb|EDL11016.1|  glutamic pyruvate transaminase (alanine aminotran...  69.3    5e-11   
ref|XP_004227217.1|  PREDICTED: alanine aminotransferase 2            69.3    5e-11   
ref|XP_008569975.1|  PREDICTED: alanine aminotransferase 1            67.4    5e-11   
dbj|BAO40163.1|  probable alanine aminotransferase                    69.3    5e-11   
ref|XP_006307188.1|  hypothetical protein CARUB_v10008780mg           69.3    5e-11   
ref|XP_008283495.1|  PREDICTED: alanine aminotransferase 2-like i...  69.3    5e-11   
ref|XP_007893251.1|  PREDICTED: alanine aminotransferase 1            69.3    5e-11   
ref|XP_005912580.1|  PREDICTED: alanine aminotransferase 2-like i...  69.3    5e-11   
ref|XP_004542941.1|  PREDICTED: alanine aminotransferase 2-like i...  69.3    5e-11   
dbj|BAP71656.1|  probable alanine aminotransferase                    69.3    5e-11   
ref|XP_006971818.1|  PREDICTED: alanine aminotransferase 2 isofor...  69.3    5e-11   
gb|ERE78378.1|  alanine aminotransferase 2-like protein               69.3    5e-11   
ref|XP_005476522.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    5e-11   
ref|XP_005079251.1|  PREDICTED: alanine aminotransferase 2            68.9    6e-11   
ref|XP_003438124.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    6e-11   
ref|XP_005476523.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    6e-11   
ref|XP_009606549.1|  PREDICTED: alanine aminotransferase 2            69.3    6e-11   
gb|EKC33627.1|  Alanine aminotransferase 2                            68.9    6e-11   
ref|XP_006792190.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    6e-11   
ref|XP_005742616.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    6e-11   
ref|XP_006792192.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    6e-11   
ref|XP_005912581.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    6e-11   
ref|XP_005742617.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    6e-11   
ref|XP_004542942.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    6e-11   
ref|XP_004924185.1|  PREDICTED: alanine aminotransferase 2-like       68.9    6e-11   
ref|XP_007537772.1|  PREDICTED: alanine aminotransferase 2 isofor...  68.9    6e-11   
dbj|BAG64738.1|  unnamed protein product                              66.2    6e-11   
ref|XP_008283494.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    6e-11   
ref|XP_006792191.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    6e-11   
ref|XP_011289880.1|  PREDICTED: alanine aminotransferase 1            68.6    6e-11   
ref|XP_005181202.1|  PREDICTED: alanine aminotransferase 1            69.3    6e-11   
gb|KEQ80043.1|  PLP-dependent transferase                             68.9    6e-11   
ref|XP_007474882.1|  PREDICTED: alanine aminotransferase 2 isofor...  68.9    6e-11   
ref|XP_003422988.1|  PREDICTED: alanine aminotransferase 1            68.6    6e-11   
ref|XP_008283496.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    6e-11   
ref|XP_005809903.1|  PREDICTED: alanine aminotransferase 2-like       68.9    6e-11   
ref|XP_003438123.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    6e-11   
ref|XP_001113757.2|  PREDICTED: alanine aminotransferase 2-like i...  68.9    6e-11   
ref|XP_001363190.1|  PREDICTED: alanine aminotransferase 2 isofor...  68.9    7e-11   
ref|XP_002557770.1|  Pc12g09430                                       68.9    7e-11   
ref|XP_005912579.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    7e-11   
ref|XP_004542940.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    7e-11   
ref|XP_005591895.1|  PREDICTED: alanine aminotransferase 2 isofor...  68.9    7e-11   
ref|XP_003717056.1|  hypothetical protein MGG_06503                   68.9    7e-11   
ref|XP_004328046.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...  67.0    7e-11   
ref|XP_007990329.1|  PREDICTED: alanine aminotransferase 2 isofor...  68.9    7e-11   
ref|XP_006792189.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    7e-11   
ref|XP_005742615.1|  PREDICTED: alanine aminotransferase 2-like i...  68.9    7e-11   
ref|XP_010476874.1|  PREDICTED: alanine aminotransferase 1, mitoc...  68.9    7e-11   
ref|XP_006903602.1|  PREDICTED: alanine aminotransferase 1-like       68.2    7e-11   
ref|NP_595176.1|  alanine aminotransferase (predicted)                68.6    7e-11   
gb|KHG05613.1|  Alanine aminotransferase 2, mitochondrial -like p...  68.6    7e-11   
ref|XP_003802370.1|  PREDICTED: alanine aminotransferase 1            68.6    7e-11   
gb|KIH88204.1|  alanine transaminase                                  68.6    7e-11   
gb|ERT01918.1|  hypothetical protein HMPREF1624_00213                 68.6    7e-11   
gb|AAV64237.1|  putative alanine aminotransferase                     68.6    7e-11   
gb|KHN77825.1|  Alanine aminotransferase 1                            68.9    7e-11   



>gb|EPS68501.1| hypothetical protein M569_06265, partial [Genlisea aurea]
Length=481

 Score =   157 bits (396),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/75 (99%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  3    PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  62

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  63   LCQAPFLLDDPNVGL  77



>ref|XP_009759837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
sylvestris]
Length=473

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/75 (99%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|XP_009624740.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625366.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/75 (99%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|XP_011071137.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Sesamum 
indicum]
Length=481

 Score =   155 bits (393),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 71/73 (97%), Positives = 73/73 (100%), Gaps = 0/73 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVG  370
            CQAPFL+DDPNVG
Sbjct  66   CQAPFLMDDPNVG  78



>ref|XP_006357614.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=481

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/74 (100%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|XP_004239121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Solanum 
lycopersicum]
Length=481

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/74 (100%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|XP_011086618.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Sesamum indicum]
Length=478

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/74 (99%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|XP_009765091.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
sylvestris]
Length=481

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDY+NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYDNLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVG 
Sbjct  65   LCQAPFLLDDPNVGF  79



>ref|XP_009623844.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
tomentosiformis]
Length=481

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDY+NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYDNLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVG 
Sbjct  65   LCQAPFLLDDPNVGF  79



>emb|CDP13207.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/75 (97%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYENLN+NVK+CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNKNVKECQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|XP_004228555.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
lycopersicum]
Length=473

 Score =   154 bits (389),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/74 (99%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  329  LCQAPFLLDDPNVG  370
            LCQAPFLLDDPNVG
Sbjct  65   LCQAPFLLDDPNVG  78



>gb|EYU28421.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
 gb|EYU28422.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
Length=480

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/74 (96%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            +DYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  5    MDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  64

Query  332  CQAPFLLDDPNVGL  373
            CQAPF+LDDPNVGL
Sbjct  65   CQAPFMLDDPNVGL  78



>ref|XP_010552672.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Tarenaya 
hassleriana]
Length=481

 Score =   154 bits (389),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 71/74 (96%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGM  79



>ref|XP_004955316.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X1 [Setaria italica]
Length=539

 Score =   154 bits (390),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 72/75 (96%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|XP_006348507.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=476

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/74 (97%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYENLNENVKKCQYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYENLNENVKKCQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  329  LCQAPFLLDDPNVG  370
            LCQAPF LDDPNVG
Sbjct  65   LCQAPFFLDDPNVG  78



>ref|XP_006658210.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Oryza 
brachyantha]
Length=494

 Score =   153 bits (386),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 72/75 (96%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  15   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  74

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  75   LCQAPFLLDDPNVGL  89



>ref|XP_009115544.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
 emb|CDY44130.1| BnaA09g31220D [Brassica napus]
 emb|CDY04729.1| BnaC05g18600D [Brassica napus]
Length=478

 Score =   152 bits (385),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 70/74 (95%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            L+YE+LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYESLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  63   CQAPFLLDDPNVGM  76



>ref|XP_006416098.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34451.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=357

 Score =   150 bits (379),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LDYDALNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  63   CQAPFLLDDPNVGM  76



>ref|XP_002887312.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63571.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=482

 Score =   152 bits (384),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPN+G+
Sbjct  66   CQAPFLLDDPNIGM  79



>ref|XP_002527918.1| alanine aminotransferase, putative [Ricinus communis]
 gb|EEF34475.1| alanine aminotransferase, putative [Ricinus communis]
Length=452

 Score =   151 bits (382),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>dbj|BAH20108.1| AT1G70580 [Arabidopsis thaliana]
Length=481

 Score =   152 bits (383),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV++L
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVSL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGM  79



>ref|NP_177215.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_974122.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031262.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031263.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9S7E9.1|GGT2_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 2; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT2; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT2; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis 
thaliana]
 gb|AAG52344.1|AC011663_23 putative alanine aminotransferase; 91367-88744 [Arabidopsis thaliana]
 gb|AAG52480.1|AC010796_19 putative alanine aminotransferase; 63135-65758 [Arabidopsis thaliana]
 gb|AAN62333.1|AF479640_1 glutamate:glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AAK59635.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AAL34156.1| putative alanine aminotransferase [Arabidopsis thaliana]
 dbj|BAH19506.1| AT1G70580 [Arabidopsis thaliana]
 gb|AEE35082.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35083.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35084.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35085.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
Length=481

 Score =   152 bits (383),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV++L
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVSL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGM  79



>ref|XP_010498838.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498839.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498840.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   152 bits (383),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 69/74 (93%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLL+DPNVG+
Sbjct  66   CQAPFLLEDPNVGM  79



>ref|XP_006378236.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|ERP56033.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=335

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/74 (96%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|NP_001031083.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19579.1| AT1G23310 [Arabidopsis thaliana]
 gb|AEE30371.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=441

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGM  79



>ref|XP_002312679.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
 gb|EEE90046.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
Length=481

 Score =   151 bits (382),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 71/74 (96%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|XP_008340115.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
 ref|XP_008340116.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
Length=481

 Score =   151 bits (382),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 71/74 (96%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|XP_004309987.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457416.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   151 bits (382),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 71/74 (96%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|XP_004955317.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X2 [Setaria italica]
Length=478

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>emb|CDY12474.1| BnaC07g13140D [Brassica napus]
Length=537

 Score =   152 bits (383),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 69/74 (93%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            L+Y++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  68   LEYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  127

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  128  CQAPFLLDDPNVGM  141



>gb|AAK25905.1|AF360195_1 putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGM  79



>ref|XP_010682426.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682427.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/74 (97%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYELLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|NP_001058716.1| Os07g0108300 [Oryza sativa Japonica Group]
 dbj|BAD30627.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF20630.1| Os07g0108300 [Oryza sativa Japonica Group]
 gb|EAZ02507.1| hypothetical protein OsI_24612 [Oryza sativa Indica Group]
 gb|EAZ38438.1| hypothetical protein OsJ_22816 [Oryza sativa Japonica Group]
 dbj|BAG90568.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  12   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  71

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  72   LCQAPFLLDDPNVGL  86



>ref|XP_006307377.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
 gb|EOA40275.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
Length=481

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGM  79



>ref|XP_006300456.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
 gb|EOA33354.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
Length=481

 Score =   151 bits (381),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGM  79



>ref|XP_010471056.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   151 bits (381),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGM  79



>ref|XP_010427837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Camelina 
sativa]
Length=479

 Score =   151 bits (381),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGM  79



>ref|XP_002893277.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69536.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=481

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGM  79



>gb|AAO84040.1| alanine aminotransferase [Oryza sativa Indica Group]
Length=484

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  11   PLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  70

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  71   LCQAPFLLDDPNVGL  85



>ref|NP_564192.2| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q9LR30.1|GGT1_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 1; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT1; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT1; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis 
thaliana]
 gb|AAF87015.1|AC005292_24 F26F24.16 [Arabidopsis thaliana]
 gb|AAN62332.1|AF479639_1 glutamate:glyoxylate aminotransferase 1 [Arabidopsis thaliana]
 gb|AAL08235.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAN12918.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AEE30370.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGM  79



>gb|AAL24255.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAO11559.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
Length=481

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGM  79



>ref|XP_010415743.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   151 bits (381),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY++LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGM  79



>ref|XP_006390865.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390866.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390867.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390868.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28151.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28152.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28153.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28154.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
Length=481

 Score =   151 bits (381),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLD+PNVG+
Sbjct  66   CQAPFLLDNPNVGM  79



>ref|XP_002315675.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|EEF01846.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=481

 Score =   151 bits (381),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 71/74 (96%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>gb|KDP26646.1| hypothetical protein JCGZ_17804 [Jatropha curcas]
Length=481

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/75 (95%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE+LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|XP_006416099.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416100.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416101.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34452.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34453.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34454.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=478

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LDYDALNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  63   CQAPFLLDDPNVGM  76



>ref|XP_010100388.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
 gb|EXB82522.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
Length=481

 Score =   150 bits (379),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINENVKKTQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|XP_008446998.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
melo]
Length=234

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE++NE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINETVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLL+DPNVGL
Sbjct  66   CQAPFLLEDPNVGL  79



>ref|XP_010023477.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
 ref|XP_010023478.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
Length=481

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/74 (97%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|XP_004489786.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|XP_006840828.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
 gb|ERN02503.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
Length=481

 Score =   150 bits (379),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 71/75 (95%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKSVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|XP_004489787.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Cicer arietinum]
Length=481

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|NP_001151209.1| alanine aminotransferase 2 [Zea mays]
 gb|ACG41981.1| alanine aminotransferase 2 [Zea mays]
Length=478

 Score =   150 bits (379),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 70/75 (93%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE LNENVK+ QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYEELNENVKRVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDP+VGL
Sbjct  65   LCQAPFLLDDPHVGL  79



>ref|XP_003613139.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96097.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=481

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|XP_003557680.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Brachypodium 
distachyon]
Length=479

 Score =   150 bits (378),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 70/74 (95%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVAL  66

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  67   CQAPFLLDDPNVGL  80



>ref|XP_008447004.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=334

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLL+DPNVGL
Sbjct  66   CQAPFLLEDPNVGL  79



>ref|XP_003613140.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96098.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=474

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE++NENVKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|XP_010477627.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Camelina 
sativa]
Length=481

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLL+DPNVG+
Sbjct  66   CQAPFLLEDPNVGM  79



>ref|XP_009413361.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413362.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/75 (96%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|XP_009359228.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Pyrus x 
bretschneideri]
Length=481

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/74 (96%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|XP_010460118.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLL+DPNVG+
Sbjct  66   CQAPFLLEDPNVGM  79



>gb|AAZ43368.1| AlaT1 [Vitis labrusca]
Length=477

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/74 (96%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|NP_001183048.1| uncharacterized protein LOC100501386 [Zea mays]
 gb|ACR35540.1| unknown [Zea mays]
Length=479

 Score =   149 bits (377),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 70/75 (93%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            P+DYE LNE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  65

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  66   LCQAPFLLDDPNVGL  80



>emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera]
Length=481

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/74 (96%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>emb|CBI23368.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/74 (96%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>gb|KDO82251.1| hypothetical protein CISIN_1g041151mg [Citrus sinensis]
Length=463

 Score =   149 bits (376),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+AL
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGI  79



>ref|NP_001268094.1| uncharacterized protein LOC100261274 [Vitis vinifera]
 gb|AAZ43369.1| AlaT1 [Vitis vinifera]
Length=484

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/74 (96%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|XP_010927963.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Elaeis guineensis]
Length=481

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/75 (95%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|XP_008221924.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221925.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221927.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
Length=481

 Score =   149 bits (375),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKK+IFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKVIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|XP_010251104.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251105.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251106.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
Length=481

 Score =   149 bits (375),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE++NENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESINENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|XP_004135487.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
Length=460

 Score =   149 bits (375),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLL+DPNVGL
Sbjct  66   CQAPFLLEDPNVGL  79



>tpg|DAA42656.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
 tpg|DAA42657.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
Length=483

 Score =   149 bits (375),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 69/75 (92%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            P+DYE LNE VKK QYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  65

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  66   LCQAPFLLDDPNVGL  80



>gb|KHG15331.1| Glutamate--glyoxylate aminotransferase 2 -like protein [Gossypium 
arboreum]
Length=481

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>emb|CDY61225.1| BnaC06g43710D [Brassica napus]
Length=481

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLD+PNVG+
Sbjct  66   CQAPFLLDNPNVGM  79



>emb|CDY66294.1| BnaAnng22050D [Brassica napus]
Length=481

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLD+PNVG+
Sbjct  66   CQAPFLLDNPNVGM  79



>gb|AAM61453.1| putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   148 bits (374),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVK CQYAVRGELYLRASELQKE KKIIFTNVGNPHALGQKPLTFPRQV++L
Sbjct  6    LDYESLNENVKNCQYAVRGELYLRASELQKECKKIIFTNVGNPHALGQKPLTFPRQVVSL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGM  79



>ref|XP_006438274.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438275.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438276.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438277.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438278.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006483938.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483939.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483940.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X3 [Citrus sinensis]
 gb|ESR51514.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51515.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51516.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51517.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51518.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=481

 Score =   148 bits (374),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+AL
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGI  79



>ref|XP_011014669.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Populus euphratica]
 ref|XP_011014670.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Populus euphratica]
Length=481

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG 
Sbjct  66   CQAPFLLDDPNVGF  79



>ref|XP_009105727.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Brassica rapa]
Length=481

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLD+PNVG+
Sbjct  66   CQAPFLLDNPNVGM  79



>ref|XP_008789746.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
 ref|XP_008789747.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
Length=481

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE+LNENVKK  YAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRAAELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|XP_006438273.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51513.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=398

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+AL
Sbjct  6    LDYESMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  66   CQAPFLLDDPNVGI  79



>tpg|DAA42658.1| TPA: LOW QUALITY PROTEIN: alanine aminotransferase 2 [Zea mays]
Length=479

 Score =   148 bits (373),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 69/75 (92%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            P+DYE LNE VKK QYAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  6    PMDYEELNEKVKKAQYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  65

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  66   LCQAPFLLDDPNVGL  80



>ref|XP_007222799.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
 gb|EMJ23998.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
Length=481

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+AL
Sbjct  6    LDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|XP_009105726.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Brassica rapa]
Length=509

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE LNENVK CQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYETLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLD+PNVG+
Sbjct  66   CQAPFLLDNPNVGM  79



>ref|XP_009110107.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Brassica 
rapa]
Length=478

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            L+Y+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYDLLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  63   CQAPFLLDDPNVGM  76



>emb|CDY41452.1| BnaA08g20540D [Brassica napus]
Length=478

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            L+Y+ LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYDLLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVG+
Sbjct  63   CQAPFLLDDPNVGM  76



>ref|XP_007044762.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044763.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044764.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00594.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00595.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00596.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
Length=481

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LD+E+LNENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDHESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|XP_004155366.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Cucumis sativus]
Length=481

 Score =   147 bits (372),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLL+DPNVGL
Sbjct  66   CQAPFLLEDPNVGL  79



>gb|EMT29455.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=523

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>gb|KGN51765.1| hypothetical protein Csa_5G598730 [Cucumis sativus]
Length=481

 Score =   147 bits (372),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDY+++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYDSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLL+DPNVGL
Sbjct  66   CQAPFLLEDPNVGL  79



>ref|XP_009103182.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
Length=478

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            L+Y++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  3    LEYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  62

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLD+PNVG+
Sbjct  63   CQAPFLLDNPNVGM  76



>ref|XP_009406515.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406516.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE+LNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDP+VG+
Sbjct  65   LCQAPFLLDDPHVGI  79



>ref|XP_008444367.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=473

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE++NEN+KK +YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA
Sbjct  5    PLDYESINENMKKVEYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  64

Query  329  LCQAPFLLDDPNVG  370
            LCQAPFLLDDPNVG
Sbjct  65   LCQAPFLLDDPNVG  78



>ref|XP_008389735.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Malus 
domestica]
Length=481

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE+LNE VKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESLNEKVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>ref|XP_002968244.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
 ref|XP_002976136.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ23041.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ30498.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
Length=481

 Score =   147 bits (371),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LD +N+NENVKKC YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDPDNINENVKKCVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFL+DDPNVGL
Sbjct  66   CQAPFLMDDPNVGL  79



>gb|KGN51767.1| hypothetical protein Csa_5G598750 [Cucumis sativus]
Length=474

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYESINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLL+DPNVGL
Sbjct  66   CQAPFLLEDPNVGL  79



>ref|XP_003519649.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
2 [Glycine max]
 gb|KHN00386.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|NP_001237581.1| alanine aminotransferase 3 [Glycine max]
 gb|ABW17198.1| alanine aminotransferase 3 [Glycine max]
Length=480

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|NP_001237567.1| alanine aminotransferase 2 [Glycine max]
 gb|ABW17197.1| alanine aminotransferase 2 [Glycine max]
Length=481

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>gb|KHN14541.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYGSINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>gb|KJB31174.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=395

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNP ALGQKPLTFPRQV+AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>gb|EMS58349.1| Alanine aminotransferase 2 [Triticum urartu]
Length=478

 Score =   146 bits (368),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE LNENVKK QYAVRGELYLRASELQKEGK+IIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  6    LDYEELNENVKKVQYAVRGELYLRASELQKEGKRIIFTNVGNPHALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPN  L
Sbjct  66   CQAPFLLDDPNAAL  79



>ref|XP_010928898.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
 ref|XP_010928907.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
Length=481

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/75 (91%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE+LNENVKK  YAVRGELY RASELQKEGKKIIFT+VGNPHALGQKPL+FPRQV+A
Sbjct  5    PLDYESLNENVKKVAYAVRGELYFRASELQKEGKKIIFTDVGNPHALGQKPLSFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>gb|KJB31170.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31171.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31172.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31173.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=481

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNP ALGQKPLTFPRQV+AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQKPLTFPRQVVAL  65

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  66   CQAPFLLDDPNVGL  79



>gb|AET06145.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=480

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LD+E LNENVK  QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPL+FPRQV+AL
Sbjct  5    LDHETLNENVKNVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVAL  64

Query  332  CQAPFLLDDPNVGL  373
            CQAPFLLDDPNVGL
Sbjct  65   CQAPFLLDDPNVGL  78



>ref|XP_007158412.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
 gb|ESW30406.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
Length=481

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/75 (91%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLD+  +NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ+PLTFPRQV+A
Sbjct  5    PLDHALINENVKKSQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQRPLTFPRQVVA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAPFLLDDPNVGL
Sbjct  65   LCQAPFLLDDPNVGL  79



>ref|XP_004142968.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 ref|XP_004161062.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 gb|KGN62316.1| hypothetical protein Csa_2G349020 [Cucumis sativus]
Length=473

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            LDYE++NEN+KK +YAVRGELYLRAS+LQKEGKKIIFTNVGNPHALGQ PLTFPRQVIAL
Sbjct  6    LDYESINENMKKVEYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQMPLTFPRQVIAL  65

Query  332  CQAPFLLDDPNVG  370
            CQAPFLLDDPNVG
Sbjct  66   CQAPFLLDDPNVG  78



>ref|XP_001782822.1| predicted protein [Physcomitrella patens]
 gb|EDQ52399.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            +D ENLNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    MDPENLNENVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  66

Query  332  CQAPFLLDDPNVGL  373
            CQAPFL+DDP+VGL
Sbjct  67   CQAPFLMDDPHVGL  80



>ref|XP_001777071.1| predicted protein [Physcomitrella patens]
 gb|EDQ58064.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            +D +NLNENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    MDPDNLNENVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  66

Query  332  CQAPFLLDDPNVGL  373
            CQAPFL+DDP+VGL
Sbjct  67   CQAPFLMDDPHVGL  80



>ref|XP_001763950.1| predicted protein [Physcomitrella patens]
 gb|EDQ71354.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   139 bits (351),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            +D ENLN NVKK  YAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+AL
Sbjct  7    MDPENLNLNVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMAL  66

Query  332  CQAPFLLDDPNVGL  373
            CQAPFL+DDP+VGL
Sbjct  67   CQAPFLMDDPHVGL  80



>gb|KJB31175.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=495

 Score =   138 bits (348),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 69/88 (78%), Positives = 71/88 (81%), Gaps = 14/88 (16%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------------IIFTNVGNPHAL  289
            LDYE +NENVKK QYAVRGELYLRASELQKEGKK              IIFTNVGNP AL
Sbjct  6    LDYETMNENVKKVQYAVRGELYLRASELQKEGKKYMKSTVCWGSMHFHIIFTNVGNPQAL  65

Query  290  GQKPLTFPRQVIALCQAPFLLDDPNVGL  373
            GQKPLTFPRQV+ALCQAPFLLDDPNVGL
Sbjct  66   GQKPLTFPRQVVALCQAPFLLDDPNVGL  93



>gb|ABK25444.1| unknown [Picea sitchensis]
 gb|ABR16321.1| unknown [Picea sitchensis]
 gb|ABR17158.1| unknown [Picea sitchensis]
 gb|ACN40300.1| unknown [Picea sitchensis]
Length=480

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDYE +NENVKK  YAVRGELYLRASELQKEGKKIIFTNVGNP ALGQ+PLTFPRQV+A
Sbjct  5    PLDYECINENVKKVAYAVRGELYLRASELQKEGKKIIFTNVGNPQALGQRPLTFPRQVMA  64

Query  329  LCQAPFLLDDPNVGL  373
            LCQAP L+DDPNV +
Sbjct  65   LCQAPMLMDDPNVSI  79



>gb|AFK37995.1| unknown [Lotus japonicus]
Length=83

 Score =   121 bits (303),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIA  328
            PLDY ++NENVKK QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV+A
Sbjct  5    PLDYVSINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVA  64

Query  329  LCQ  337
            LC 
Sbjct  65   LCH  67



>ref|XP_002947519.1| alanine aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ51567.1| alanine aminotransferase [Volvox carteri f. nagariensis]
Length=522

 Score =   120 bits (302),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 56/67 (84%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  346
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTFPRQV+ALC APF
Sbjct  60   LNENVMKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFPRQVLALCAAPF  119

Query  347  LLDDPNV  367
            LLD P V
Sbjct  120  LLDHPRV  126



>gb|AAB01685.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   117 bits (292),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 55/67 (82%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  346
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTF RQV+ALC APF
Sbjct  59   LNENVVKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFTRQVLALCAAPF  118

Query  347  LLDDPNV  367
            LLD P V
Sbjct  119  LLDHPKV  125



>emb|CDY25781.1| BnaA07g10010D [Brassica napus]
Length=58

 Score =   108 bits (271),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  316
            L+Y++LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFP 
Sbjct  3    LEYDSLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPH  57



>ref|XP_001698518.1| alanine aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP08011.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  346
            LNENV K QYAVRGELYLRA +L+KEGK+IIFTNVGNPHALG KPLTF RQV+ALC APF
Sbjct  59   LNENVVKTQYAVRGELYLRAEQLRKEGKEIIFTNVGNPHALGAKPLTFTRQVLALCAAPF  118

Query  347  LLDDPNV  367
            LLD P V
Sbjct  119  LLDHPKV  125



>gb|KIZ04988.1| alanine transaminase [Monoraphidium neglectum]
Length=242

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  346
            LNEN++K QYAVRGELYL+A EL+  GK IIFTNVGNPH LG KP+TF RQVIALC APF
Sbjct  58   LNENMRKTQYAVRGELYLKAEELKNAGKPIIFTNVGNPHNLGAKPITFTRQVIALCAAPF  117

Query  347  LLDDPNV  367
            LL  P V
Sbjct  118  LLQHPKV  124



>emb|CBJ25743.1| nicotinanamine aminotransferase A [Ectocarpus siliculosus]
Length=490

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            L Y+ + E VK CQYAVRGE+YL A+E  K GK++IFTNVGNPH LGQKPLTF RQV+AL
Sbjct  9    LTYDTIAECVKDCQYAVRGEIYLAATERIKAGKEVIFTNVGNPHGLGQKPLTFLRQVMAL  68

Query  332  CQAPFLLDDPNV  367
              APFLL+DP V
Sbjct  69   VMAPFLLEDPRV  80



>gb|KIY95165.1| alanine transaminase [Monoraphidium neglectum]
Length=227

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  346
            +N N+ K QYAVRGELYLRA ++++EG+ IIFTN+GNPH LG +P TF RQ++ALC AP+
Sbjct  77   INPNILKTQYAVRGELYLRADKMRREGRDIIFTNIGNPHNLGAQPKTFTRQLVALCAAPW  136

Query  347  LLDDPNVG  370
            LLDDP   
Sbjct  137  LLDDPRAA  144



>ref|XP_005651940.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE27396.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
Length=523

 Score =   103 bits (257),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  346
            LNEN+ + +YAVRGELYLR  EL+K+GK+IIFTNVGNPH LGQKPLTF RQV++L  +P 
Sbjct  62   LNENLVRAEYAVRGELYLRGEELRKQGKEIIFTNVGNPHVLGQKPLTFNRQVLSLIASPA  121

Query  347  LLDDPNVG  370
            LL+ P VG
Sbjct  122  LLEHPEVG  129



>emb|CAO02585.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02586.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02587.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02588.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02589.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02590.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02591.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02592.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02593.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02594.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02595.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02596.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02597.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02598.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02599.1| alanine amino-transferase, partial [Medicago truncatula var. 
longiaculeata]
 emb|CAO02600.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02601.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02602.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02603.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02604.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02605.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02606.1| alanine amino-transferase [Medicago truncatula var. truncatula]
 emb|CAO02607.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02608.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02609.1| alanine amino-transferase [Medicago tornata]
 emb|CAO02610.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02611.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02612.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02613.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02614.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
 emb|CAO02615.1| alanine amino-transferase, partial [Medicago truncatula var. 
truncatula]
Length=48

 Score = 95.1 bits (235),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +2

Query  173  ENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR  316
            E VKK QYAVRGELYLRA+ELQKEGKKIIFTNVGNPHALGQKPLTFPR
Sbjct  1    EXVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPR  48



>gb|EWM24220.1| alanine-2-oxoglutarate aminotransferase 2 [Nannochloropsis gaditana]
Length=593

 Score =   102 bits (254),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            L+Y++L ++VK C+YAVRGELY  A+E    GK++IFTNVGNPH LGQKP+TF RQV AL
Sbjct  52   LNYDSLPDHVKHCEYAVRGELYRAATERVAAGKEVIFTNVGNPHGLGQKPITFIRQVFAL  111

Query  332  CQAPFLLDDPNV  367
              APFLL+ P+V
Sbjct  112  VSAPFLLEHPDV  123



>gb|ACF86318.1| unknown [Zea mays]
Length=72

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  369  PTFGSSSKNGAWQRAITWRGKVRGFCPRAWGLPTFVKMIFFPSF*SSEARRYSSPLTAY  193
            PT+GSS +NGAW  A TWRGKV GF PRA GLPT VKMIF PSF SSEARRYSSP TAY
Sbjct  3    PTWGSSRRNGAWHSATTWRGKVSGFWPRACGLPTLVKMIFLPSFCSSEARRYSSPRTAY  61



>ref|XP_005847240.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
 gb|EFN55138.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
Length=529

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  346
            LNE++ K +YAVRGELY +A ELQK+G+++IFTNVGNP  LGQ+P+TF R V +L  APF
Sbjct  67   LNEDLLKAEYAVRGELYNKAMELQKQGRELIFTNVGNPQQLGQQPITFNRMVTSLVAAPF  126

Query  347  LLDDPN  364
            L+  P+
Sbjct  127  LMGHPS  132



>ref|XP_001745052.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90285.1| predicted protein [Monosiga brevicollis MX1]
Length=480

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  346
            +N NV    YAVRG++Y  A + + EGKK+I TNVGNPH+LGQ  +TFPRQV+AL   P 
Sbjct  13   INANVLAATYAVRGKIYEMAMQRKAEGKKVILTNVGNPHSLGQPAITFPRQVLALMNYPA  72

Query  347  LLDDPNVG  370
            LLD PNVG
Sbjct  73   LLDAPNVG  80



>gb|KIZ07569.1| alanine transaminase [Monoraphidium neglectum]
Length=621

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 52/79 (66%), Gaps = 14/79 (18%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQ---------  319
            +N N+ K QYAVRGELYL+A E+++ G+ +IFTN+GNPH LG KP TF RQ         
Sbjct  116  VNPNIIKTQYAVRGELYLKAEEMRRAGRDVIFTNIGNPHNLGAKPKTFTRQAGRGPPRPG  175

Query  320  -----VIALCQAPFLLDDP  361
                 VIALC AP LLD P
Sbjct  176  PLGRVVIALCAAPDLLDSP  194



>gb|KDD76740.1| aminotransferase [Helicosporidium sp. ATCC 50920]
Length=485

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  346
            +N  + K +YAVRGELY RA EL  +G++II+TNVGNPH LG KPLTF R+VI+L  +P+
Sbjct  24   MNPAILKAEYAVRGELYNRAMELAAQGREIIYTNVGNPHQLGGKPLTFNREVISLMLSPW  83

Query  347  LLDDP  361
            LLD P
Sbjct  84   LLDLP  88



>gb|EJK50290.1| hypothetical protein THAOC_30762 [Thalassiosira oceanica]
Length=570

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAP  343
            +++N+++ QYAVRGE+ ++A  + K+GKKII+TN+GNPHA+GQKP+T+ RQVI+LC  P
Sbjct  118  MSQNLRRMQYAVRGEVVIKADAMAKKGKKIIYTNIGNPHAVGQKPITYYRQVISLCDLP  176



>ref|XP_004992298.1| alanine aminotransferase [Salpingoeca rosetta]
 gb|EGD75245.1| alanine aminotransferase [Salpingoeca rosetta]
Length=481

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  346
            +N+ V    YAVRG +Y+ A + +  GK++IFTN+GNP +LGQKP+TFPRQVI+L   P 
Sbjct  16   INQFVIASHYAVRGTIYIEAQKRKASGKEVIFTNIGNPQSLGQKPITFPRQVISLVTCPQ  75

Query  347  LLDDPNVG  370
            LL+ P+VG
Sbjct  76   LLEHPDVG  83



>ref|XP_002176328.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC42720.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=464

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 54/68 (79%), Gaps = 2/68 (3%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  346
            +++++++ QYAVRGE+ L+A +L  EG+KI +TNVGNPHA+GQ+P+TF RQV+ALC  P 
Sbjct  1    MSQSLRRMQYAVRGEVVLKADKLAAEGRKITYTNVGNPHAVGQQPITFYRQVLALCDLPA  60

Query  347  L--LDDPN  364
               +D PN
Sbjct  61   SCGVDHPN  68



>ref|XP_009041360.1| hypothetical protein AURANDRAFT_67623 [Aureococcus anophagefferens]
 gb|EGB03935.1| hypothetical protein AURANDRAFT_67623 [Aureococcus anophagefferens]
Length=1156

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 58/77 (75%), Gaps = 6/77 (8%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEG----KKIIFTNVGNPHALGQKPLTFPRQ  319
            ++  N+++ ++K QYAVRGE+ ++A  L++EG    K+I++TNVGNPH++GQKPLTF RQ
Sbjct  146  INASNMSQALRKMQYAVRGEVVMKADALEQEGREQRKEILYTNVGNPHSVGQKPLTFFRQ  205

Query  320  VIALCQAP--FLLDDPN  364
            V+ALC  P    +D PN
Sbjct  206  VLALCDLPAEHGVDHPN  222



>gb|EJK48082.1| hypothetical protein THAOC_33157 [Thalassiosira oceanica]
Length=613

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  161  ENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQA  340
            + +++++++ QYAVRGE+ + A EL+ EG++IIFTNVGNPHA+GQK +T+ RQV+ALC  
Sbjct  127  DTMSQSLRRMQYAVRGEVVMLAEELKAEGREIIFTNVGNPHAVGQKCITYYRQVLALCDL  186

Query  341  P  343
            P
Sbjct  187  P  187



>ref|WP_026853156.1| aminotransferase class I/II [Geothrix fermentans]
Length=451

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  164  NLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAP  343
            +L + V + +YAVRG +  RA+EL+K+G++II+ N+GNP +LGQKPLT+ RQ++ALC+ P
Sbjct  7    DLGKAVLETEYAVRGPIVARAAELEKQGREIIYCNIGNPQSLGQKPLTWNRQILALCEYP  66

Query  344  FLLD  355
             L+D
Sbjct  67   DLMD  70



>ref|XP_001622550.1| hypothetical protein NEMVEDRAFT_v1g236165 [Nematostella vectensis]
 gb|EDO30450.1| predicted protein [Nematostella vectensis]
Length=496

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 8/75 (11%)
 Frame = +2

Query  164  NLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLTFPRQ  319
            ++N  VK+ +YAVRG + +RASEL+KE         K+++  N+G+ HALG KPL FPRQ
Sbjct  24   SMNPYVKQIEYAVRGAIVIRASELEKELQQGHEKPFKEVVKANIGDAHALGMKPLKFPRQ  83

Query  320  VIALCQAPFLLDDPN  364
            V+ALC  P LLDDP+
Sbjct  84   VLALCVNPALLDDPS  98



>gb|KFV83100.1| Alanine aminotransferase 2, partial [Struthio camelus australis]
Length=501

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 5/76 (7%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFT-----NVGNPHALGQKPLTFPR  316
            L  E++N  VK  +YAVRG + L+A E++KEG K  FT     N+G+ HA+GQ+P+TF R
Sbjct  29   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKEGIKKPFTEVIKANIGDAHAMGQRPITFLR  88

Query  317  QVIALCQAPFLLDDPN  364
            QV+ALC  P LLD P+
Sbjct  89   QVVALCTYPNLLDSPS  104



>ref|XP_002289904.1| alanine aminotransferase [Thalassiosira pseudonana CCMP1335]
 gb|EED93441.1| alanine aminotransferase [Thalassiosira pseudonana CCMP1335]
Length=444

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  191  QYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAP  343
            QYAVRGE+ +RA  +  EG+KII+TN+GNPHA+GQKP+T+ RQV++LC  P
Sbjct  2    QYAVRGEVVIRADAMAAEGRKIIYTNIGNPHAVGQKPITYYRQVLSLCDLP  52



>ref|XP_008797360.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+  E +N  VKKC+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PITVETINPKVKKCEYAVRGEIVSHAQRLQQELQTKPRSHPFEEILYCNIGNPQALGQQP  111

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P LLD
Sbjct  112  ITFFREVLALCNYPALLD  129



>ref|XP_010917381.1| PREDICTED: alanine aminotransferase 2-like isoform X4 [Elaeis 
guineensis]
Length=470

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P LLD
Sbjct  112  ITFFREVLALCDYPALLD  129



>gb|KDR12685.1| Alanine aminotransferase 2 [Zootermopsis nevadensis]
Length=538

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 8/75 (11%)
 Frame = +2

Query  161  ENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLTFPR  316
            EN+N  +K+ +YAVRG L +RASE++KE ++        +I  N+G+ HA+GQKPLTF R
Sbjct  68   ENMNPCLKRMEYAVRGPLVIRASEIEKELQEGVKKPFSEVIKANIGDCHAMGQKPLTFIR  127

Query  317  QVIALCQAPFLLDDP  361
            QV+AL   P LLDDP
Sbjct  128  QVLALVSYPALLDDP  142



>ref|XP_003724792.1| PREDICTED: LOW QUALITY PROTEIN: alanine aminotransferase 2-like 
[Strongylocentrotus purpuratus]
Length=552

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E +N +++  +YAVRG +  RA+++QKE +K        +I  N+G+ HA+GQKP+T
Sbjct  55   LSLETMNPHIRVMEYAVRGPIVQRATQIQKELEKGVSKPFPSVIKCNIGDAHAMGQKPMT  114

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQVIALC  P LLDD N
Sbjct  115  FLRQVIALCTYPALLDDSN  133



>ref|XP_011398130.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25238.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
Length=487

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQAPF  346
            LN+N+ K QYAVRGELY RA EL K G ++I+TN+GNP  LGQ+PL F RQV+AL  APF
Sbjct  24   LNDNILKTQYAVRGELYTRAQELAKSGGEVIYTNIGNPQQLGQEPLVFNRQVLALLLAPF  83

Query  347  LLDDPN  364
            LLD P+
Sbjct  84   LLDHPS  89



>ref|XP_010917380.1| PREDICTED: alanine aminotransferase 2-like isoform X3 [Elaeis 
guineensis]
Length=488

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P LLD
Sbjct  112  ITFFREVLALCDYPALLD  129



>ref|XP_010917379.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Elaeis 
guineensis]
Length=516

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P LLD
Sbjct  112  ITFFREVLALCDYPALLD  129



>ref|XP_010917378.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Elaeis 
guineensis]
Length=534

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+  E +N  VK+C+YAVRGE+   A  LQ+E +         +I++ N+GNP ALGQ+P
Sbjct  52   PVTVETINPKVKRCEYAVRGEIVSHAQRLQQELQTKPGSHPFDEILYCNIGNPQALGQQP  111

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P LLD
Sbjct  112  ITFFREVLALCDYPALLD  129



>emb|CDS30789.1| gag pol polyprotein [Hymenolepis microstoma]
Length=485

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKE---GKK-----IIFTNVGNPHALGQKPLT  307
            L    +N NV + QYAVRG + +R+ EL+KE   G+K     ++  N+G+ HA GQKP+T
Sbjct  8    LTLATINPNVVQMQYAVRGPIVIRSQELEKELKDGQKKKFEHVVKCNIGDCHATGQKPIT  67

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQVIALC  P LLDDPN
Sbjct  68   FLRQVIALCSYPTLLDDPN  86



>emb|CCW65758.1| unnamed protein product [Phytomonas sp. isolate EM1]
Length=499

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 40/77 (52%), Positives = 51/77 (66%), Gaps = 9/77 (12%)
 Frame = +2

Query  164  NLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPLTFPR  316
            ++N  V K QYAVRG +  RA E+QKE           ++++ N+GNP AL QKPLTFPR
Sbjct  18   HVNPRVVKAQYAVRGLIPTRAKEIQKEIMDGSTKYPFSELVWCNIGNPQALSQKPLTFPR  77

Query  317  QVIALCQAPFLLDDPNV  367
            QV++L  APFLLD P V
Sbjct  78   QVMSLFDAPFLLDIPAV  94



>gb|AGT60040.1| aminotransferase [uncultured bacterium]
Length=462

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            + + NLN+ +   +YAVRG++  RA EL+K GKKI + N+GNPHA  QKPL++ R+V++L
Sbjct  2    ITFNNLNQKLIDAEYAVRGKIVTRAQELEKTGKKITYCNIGNPHAFAQKPLSYVREVLSL  61

Query  332  CQAPFLLD  355
             + P LL+
Sbjct  62   LEFPDLLE  69



>ref|XP_004510570.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cicer 
arietinum]
Length=531

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+  +N+N  V +CQYAVRGE+   A  LQK+ +         +II+ N+GNP +LGQ+P
Sbjct  53   PVTAQNINPQVLQCQYAVRGEIVTLAQNLQKDLQANPGSHSFDEIIYCNIGNPQSLGQQP  112

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P LLD
Sbjct  113  ITFFREVLALCDYPALLD  130



>gb|ACJ85860.1| unknown [Medicago truncatula]
Length=524

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+  +N+N  V KCQYAVRGE+   A  LQK  +         +II+ N+GNP +LGQ+P
Sbjct  46   PVTAQNINPQVLKCQYAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQP  105

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P LLD
Sbjct  106  ITFFREVLALCDYPALLD  123



>ref|XP_003627448.1| Alanine aminotransferase [Medicago truncatula]
 gb|AET01924.1| alanine aminotransferase [Medicago truncatula]
Length=524

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+  +N+N  V KCQYAVRGE+   A  LQK  +         +II+ N+GNP +LGQ+P
Sbjct  46   PVTAQNINPQVLKCQYAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQP  105

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P LLD
Sbjct  106  ITFFREVLALCDYPALLD  123



>ref|XP_006342898.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Solanum 
tuberosum]
Length=487

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  301
            P+   +LN  V KC YA+RGE+   A  LQ++           +I++ N+GNPH+LGQKP
Sbjct  9    PITLNDLNPKVLKCAYAIRGEIVTHAQTLQQDLTENPGSHPFNEILYCNIGNPHSLGQKP  68

Query  302  LTFPRQVIALCQAPFLLD  355
            ++F R+V+ALC  P LLD
Sbjct  69   ISFFREVLALCDHPLLLD  86



>ref|XP_003760591.1| PREDICTED: alanine aminotransferase 1 [Sarcophilus harrisii]
Length=507

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKE---GKK-----IIFTNVGNPHALGQKPLT  307
            L  + +N++VK  +YAVRG + LRA EL+KE   G K     II  N+G+ HA+GQ+P+T
Sbjct  32   LTMDTMNQSVKNIEYAVRGPILLRALELEKELQQGAKKPFTEIIRANIGDAHAMGQRPIT  91

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALCQ P LL  P+
Sbjct  92   FMRQVLALCQYPDLLSSPS  110



>ref|XP_001769989.1| predicted protein [Physcomitrella patens]
 gb|EDQ65165.1| predicted protein [Physcomitrella patens]
Length=484

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 9/80 (11%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+  +++N  V   +YAVRGE+ +RA  L +E K         +II+ N+GNP +LGQKP
Sbjct  6    PVSIQSINPKVLNAEYAVRGEIVIRAQALAEELKSNPGSHPFDEIIYCNIGNPQSLGQKP  65

Query  302  LTFPRQVIALCQAPFLLDDP  361
            +TF R+V+ALC  P LLD P
Sbjct  66   ITFFREVVALCDHPSLLDKP  85



>ref|XP_011048627.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Populus 
euphratica]
Length=481

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+  + +N  V KCQYAVRGE+   A  +Q+E K         +I++ N+GNP +LGQ+P
Sbjct  3    PVSLDTINPKVLKCQYAVRGEIVTLAQAVQEELKSKPGSRPFDEILYCNIGNPQSLGQQP  62

Query  302  LTFPRQVIALCQAPFLLD  355
            LTF R+V+ALC  PF+LD
Sbjct  63   LTFFREVLALCDHPFILD  80



>ref|XP_009051124.1| hypothetical protein LOTGIDRAFT_114341 [Lottia gigantea]
 gb|ESO98440.1| hypothetical protein LOTGIDRAFT_114341 [Lottia gigantea]
Length=482

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 52/79 (66%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  EN+N ++KK +YAVRG + +RA E++ E +K        +I  N+G+ HA GQ+PLT
Sbjct  8    LSVENMNPHIKKMEYAVRGPIVIRAGEIEAELQKGEKKPFPDVIRANIGDCHATGQQPLT  67

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV A+C  P LL DPN
Sbjct  68   FIRQVSAICAYPELLKDPN  86



>ref|XP_003646187.1| hypothetical protein Ecym_4307 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET39370.1| hypothetical protein Ecym_4307 [Eremothecium cymbalariae DBVPG#7215]
Length=534

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 54/80 (68%), Gaps = 9/80 (11%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  301
            PL  E+LN NV + +YAVRG++  RA EL+++          KKII+ N+GNP  LGQKP
Sbjct  55   PLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKP  114

Query  302  LTFPRQVIALCQAPFLLDDP  361
            L+F R+V++L ++P LL  P
Sbjct  115  LSFSREVLSLLESPNLLQMP  134



>gb|KFP06658.1| Alanine aminotransferase 2, partial [Calypte anna]
Length=538

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  63   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  122

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  123  FLRQVVALCTYPNLLDSPS  141



>ref|XP_010939848.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Elaeis guineensis]
Length=518

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 53/78 (68%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            PL ++++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  40   PLTFDSINPKVLKCEYAVRGEIVSHAQRLQQELQTKPGSYPFDEILYCNIGNPQSLGQQP  99

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P +LD
Sbjct  100  VTFFREVLALCDHPSILD  117



>ref|XP_010261672.1| PREDICTED: alanine aminotransferase 2-like [Nelumbo nucifera]
Length=528

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+  E LN  V KCQYAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  50   PVTAETLNPKVLKCQYAVRGEIVTHAQRLQQELQSKPSSHPFNEILYCNIGNPQSLGQQP  109

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P LL+
Sbjct  110  ITFFREVLALCDHPALLN  127



>gb|AGE89226.1| cytosolic alanine aminotransferase, partial [Dicentrarchus labrax]
Length=186

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 52/77 (68%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  + +N NVK+ +YAVRG +  RA +++KE K+        +I  N+G+ HA+GQKP+T
Sbjct  1    LTVDTMNPNVKRVEYAVRGPIVQRAVQIEKELKEGVKKPFSEVIKANIGDAHAMGQKPIT  60

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LL+D
Sbjct  61   FLRQVLALCSYPELLED  77



>ref|XP_005052721.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Ficedula albicollis]
 ref|XP_005052722.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Ficedula albicollis]
Length=549

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  74   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  133

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  134  FLRQVVALCTYPNLLDSPS  152



>ref|XP_005526439.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Pseudopodoces 
humilis]
Length=551

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  76   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  135

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  136  FLRQVVALCTYPNLLDSPS  154



>gb|KFW64540.1| Alanine aminotransferase 2, partial [Pygoscelis adeliae]
Length=539

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  64   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  123

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  124  FLRQVVALCTYPNLLDSPS  142



>ref|XP_008499534.1| PREDICTED: alanine aminotransferase 2 [Calypte anna]
Length=486

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  11   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  70

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  71   FLRQVVALCTYPNLLDSPS  89



>ref|XP_008637027.1| PREDICTED: alanine aminotransferase 2 [Corvus brachyrhynchos]
Length=551

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  76   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  135

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  136  FLRQVVALCTYPNLLDSPS  154



>ref|XP_002194653.1| PREDICTED: alanine aminotransferase 2 [Taeniopygia guttata]
Length=552

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  77   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  136

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  137  FLRQVVALCTYPNLLDSPS  155



>gb|KFQ95766.1| Alanine aminotransferase 2, partial [Nipponia nippon]
Length=539

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  64   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  123

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  124  FLRQVVALCTYPNLLDSPS  142



>gb|KFM05788.1| Alanine aminotransferase 2, partial [Aptenodytes forsteri]
Length=539

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  64   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  123

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  124  FLRQVVALCTYPNLLDSPS  142



>gb|KFO63157.1| Alanine aminotransferase 2, partial [Corvus brachyrhynchos]
Length=536

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  61   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  120

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  121  FLRQVVALCTYPNLLDSPS  139



>ref|XP_008305774.1| PREDICTED: alanine aminotransferase 1 [Cynoglossus semilaevis]
Length=491

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  +N+N  VK+ +YAVRG +YLRA E++KE K+        +I  N+G+ HA+GQ+P+T
Sbjct  16   LTLDNMNPFVKRVEYAVRGPIYLRAVEIEKELKEGVKKPFTEVIKANIGDAHAMGQQPIT  75

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+A+C  P LL+D
Sbjct  76   FFRQVLAICSYPELLED  92



>ref|XP_002430266.1| Alanine aminotransferase, putative [Pediculus humanus corporis]
 gb|EEB17528.1| Alanine aminotransferase, putative [Pediculus humanus corporis]
Length=485

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 8/76 (11%)
 Frame = +2

Query  161  ENLNENVKKCQYAVRGELYLRASELQKE---GKKIIFT-----NVGNPHALGQKPLTFPR  316
            EN+NEN+ + +YAVRG + +RA E++KE   G K  FT     N+G+ HA+GQKP+TF R
Sbjct  15   ENMNENIIRLEYAVRGPIVIRAGEIEKELEQGVKKPFTEVLKANIGDCHAMGQKPITFFR  74

Query  317  QVIALCQAPFLLDDPN  364
            QV+AL   P L DDP+
Sbjct  75   QVLALVSLPSLFDDPS  90



>ref|WP_005033524.1| aminotransferase class I/II [Holophaga foetida]
Length=451

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIAL  331
            +  ++L + V + QYAVRG +  +A ++++EG++II+ N+GNP AL QKPLT+ RQ +AL
Sbjct  3    MQLKDLGKAVLETQYAVRGPIVAKAQDMEREGREIIYCNIGNPQALEQKPLTYLRQTLAL  62

Query  332  CQAPFLL  352
            CQ P L+
Sbjct  63   CQYPELI  69



>ref|XP_006121251.1| PREDICTED: alanine aminotransferase 2 [Pelodiscus sinensis]
Length=558

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  83   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQQPIT  142

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  143  FLRQVVALCTYPNLLDSPS  161



>ref|XP_007059708.1| PREDICTED: alanine aminotransferase 2 [Chelonia mydas]
Length=557

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  82   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQQPIT  141

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  142  FLRQVVALCTYPNLLDSPS  160



>ref|XP_005289905.1| PREDICTED: alanine aminotransferase 2 [Chrysemys picta bellii]
Length=558

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  83   LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQQPIT  142

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  143  FLRQVVALCTYPNLLDSPS  161



>ref|XP_002175263.1| alanine aminotransferase [Schizosaccharomyces japonicus yFS275]
 gb|EEB08970.1| alanine aminotransferase [Schizosaccharomyces japonicus yFS275]
Length=486

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 9/80 (11%)
 Frame = +2

Query  155  DYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKPLT  307
            D E LN+NV   QYAVRG L +RA EL+ + K+         II  N+GNPH +GQ PLT
Sbjct  12   DPEQLNQNVFAAQYAVRGPLAVRAEELRAQLKEKPDSLPFTEIINANIGNPHQMGQIPLT  71

Query  308  FPRQVIALCQAPFLLDDPNV  367
            F RQV+ALCQ P L+++  +
Sbjct  72   FIRQVLALCQYPALIENAEI  91



>ref|XP_008783332.1| PREDICTED: alanine aminotransferase 2 [Phoenix dactylifera]
Length=526

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 53/78 (68%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+ ++++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  48   PVTFDSINPKVLKCEYAVRGEIVSHAQRLQQELQTKPGSRPFDEILYCNIGNPQSLGQQP  107

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P +LD
Sbjct  108  ITFFREVLALCDHPSILD  125



>ref|XP_006657960.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Oryza 
brachyantha]
Length=491

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  301
            P+  + +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  13   PVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPESLPFDEILYCNIGNPQSLGQQP  72

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V++LC  P LLD
Sbjct  73   VTFFREVLSLCDHPALLD  90



>ref|XP_011499275.1| PREDICTED: alanine aminotransferase 2 [Ceratosolen solmsi marchali]
Length=533

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 8/78 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  307
            L  +N+ EN+ K +YAVRG L LRA EL+KE         K++I  NVG+ HA+GQKP+T
Sbjct  59   LTEDNVFENLVKMEYAVRGPLLLRAIELEKELLKGAKKPFKEVIKANVGDAHAMGQKPVT  118

Query  308  FPRQVIALCQAPFLLDDP  361
            F RQV+A+   P LLDDP
Sbjct  119  FLRQVLAIALYPKLLDDP  136



>gb|EEE67593.1| hypothetical protein OsJ_25140 [Oryza sativa Japonica Group]
Length=546

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  301
            P+  + +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  68   PVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPDSLPFDEILYCNIGNPQSLGQQP  127

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V++LC  P LLD
Sbjct  128  VTFFREVLSLCDHPALLD  145



>gb|EEC82447.1| hypothetical protein OsI_26881 [Oryza sativa Indica Group]
Length=546

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  301
            P+  + +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  68   PVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPDSLPFDEILYCNIGNPQSLGQQP  127

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V++LC  P LLD
Sbjct  128  VTFFREVLSLCDHPALLD  145



>gb|KFO69634.1| Alanine aminotransferase 2, partial [Cuculus canorus]
Length=482

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE ++        +I  N+G+ HA+GQ+P+T
Sbjct  7    LTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRRGIKKPFTEVIKANIGDAHAMGQRPIT  66

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  67   FLRQVVALCTYPNLLDSPS  85



>gb|AGG11473.1| hypothetical protein, partial [Trypanosomatidae sp. TS-2013]
Length=510

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 11/77 (14%)
 Frame = +2

Query  164  NLNENVKKCQYAVRGELYLRASELQKEGKK-----------IIFTNVGNPHALGQKPLTF  310
            ++N  V + QYAVRG + LRA E++KE ++           +++ N+GNP AL QKPLTF
Sbjct  26   HINPRVIEAQYAVRGLIPLRAGEIEKELQRADGAAKYPFDSLVYCNIGNPQALKQKPLTF  85

Query  311  PRQVIALCQAPFLLDDP  361
             RQV++L  APFLLD+P
Sbjct  86   FRQVMSLIDAPFLLDNP  102



>ref|XP_011140986.1| PREDICTED: alanine aminotransferase 1 isoform X1 [Harpegnathos 
saltator]
 ref|XP_011140995.1| PREDICTED: alanine aminotransferase 1 isoform X1 [Harpegnathos 
saltator]
 ref|XP_011141005.1| PREDICTED: alanine aminotransferase 1 isoform X1 [Harpegnathos 
saltator]
 ref|XP_011141015.1| PREDICTED: alanine aminotransferase 1 isoform X1 [Harpegnathos 
saltator]
 ref|XP_011141024.1| PREDICTED: alanine aminotransferase 1 isoform X1 [Harpegnathos 
saltator]
 gb|EFN89499.1| Alanine aminotransferase 2 [Harpegnathos saltator]
Length=557

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 37/76 (49%), Positives = 54/76 (71%), Gaps = 8/76 (11%)
 Frame = +2

Query  161  ENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLTFPR  316
            +N+ EN+++ +YAVRG L LRA E++KE         K++I  NVG+ HA+GQ+P+TF R
Sbjct  87   DNVFENLRRMEYAVRGPLLLRALEIEKELQKGVKKPFKEVIKANVGDAHAMGQQPITFLR  146

Query  317  QVIALCQAPFLLDDPN  364
            QV+ L  +P LLDDP+
Sbjct  147  QVLTLTVSPTLLDDPS  162



>ref|XP_003967921.1| PREDICTED: alanine aminotransferase 2-like [Takifugu rubripes]
Length=451

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 53/77 (69%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  +N+N NVK+ +YAVRG + LRA +L+KE K+        +I  N+G+  A+GQKP+T
Sbjct  16   LTLDNMNPNVKRVEYAVRGPIVLRAMQLEKELKEGAKKPFNEVIRANIGDAQAMGQKPIT  75

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LL+D
Sbjct  76   FFRQVMALCSYPELLED  92



>ref|XP_010318453.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X3 [Solanum lycopersicum]
Length=470

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 12/76 (16%)
 Frame = +2

Query  164  NLNENVKKCQYAVRGELYLRASELQK------------EGKKIIFTNVGNPHALGQKPLT  307
            +LN  V KC YA+RGE+   A  LQ+            E  +I++ N+GNPH+LGQKP+T
Sbjct  11   DLNPKVLKCAYAIRGEIVTHAQILQQDLFENPGSHPFNEFMQILYCNIGNPHSLGQKPIT  70

Query  308  FPRQVIALCQAPFLLD  355
            F R+V+ALC  P LLD
Sbjct  71   FFREVLALCDHPLLLD  86



>ref|XP_008380735.1| PREDICTED: alanine aminotransferase 2 [Malus domestica]
Length=543

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+  +N+N  V KC+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  65   PVTLQNINPKVLKCEYAVRGEIVTLAQRLQEELKANPGSHPFDEILYCNIGNPQSLGQQP  124

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+++ALC  P +LD
Sbjct  125  ITFFREILALCDHPAILD  142



>ref|XP_006775215.1| PREDICTED: alanine aminotransferase 1 [Myotis davidii]
Length=307

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  + +N  VK+ +YAVRG + LRA EL++E ++        +I  N+G+ HA+GQKP+T
Sbjct  21   LTLDTMNACVKRVEYAVRGPIVLRALELEQELRQGVKKPFTEVIHANIGDAHAMGQKPIT  80

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LL+ P+
Sbjct  81   FLRQVLALCVHPDLLNSPD  99



>gb|AFK39904.1| unknown [Medicago truncatula]
Length=524

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQK---------EGKKIIFTNVGNPHALGQKP  301
            P+  +N+N  V KCQYAVRGE+   A  LQK            +II+ N+GNP +LGQ+P
Sbjct  46   PVTAQNINPQVLKCQYAVRGEIVTLAQNLQKALQANPDAHSFDEIIYCNIGNPQSLGQQP  105

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P LLD
Sbjct  106  ITFFREVLALCDYPALLD  123



>ref|WP_012096788.1| aminotransferase class I/II [Anaeromyxobacter sp. Fw109-5]
 gb|ABS26209.1| aminotransferase class I and II [Anaeromyxobacter sp. Fw109-5]
Length=457

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  161  ENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVIALCQA  340
            E++   V++ QYAVRG +  RA EL+++G+++I+ N+GNP +LGQ+PL++ RQV+A+ + 
Sbjct  6    EDVAPVVREAQYAVRGPIVARAQELERQGREVIYCNIGNPQSLGQRPLSWVRQVLAIAEW  65

Query  341  PFLLD  355
            P LL+
Sbjct  66   PELLE  70



>ref|XP_009380146.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=523

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  301
            P+  + +N+ V KC+YAVRGE+   A  LQ+E          ++I++ N+GNP +LGQ+P
Sbjct  45   PVALDTINQKVLKCEYAVRGEIVTHAQRLQQELQSKPGSHPFEEILYCNIGNPQSLGQQP  104

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P LLD
Sbjct  105  ITFFREVLALCDHPPLLD  122



>ref|XP_008460349.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X3 [Cucumis melo]
 ref|XP_008460350.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X4 [Cucumis melo]
 ref|XP_008460351.1| PREDICTED: alanine aminotransferase 1, mitochondrial-like isoform 
X5 [Cucumis melo]
Length=436

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  301
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  52   PLSVATINDKVLKCEYAVRGEIVTLAQKLQEELSAKPGLHPFDEILYCNIGNPQSLGQQP  111

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P +LD
Sbjct  112  ITFFREVLALCDHPAILD  129



>ref|XP_004235528.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X2 [Solanum lycopersicum]
Length=484

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 35/73 (48%), Positives = 48/73 (66%), Gaps = 9/73 (12%)
 Frame = +2

Query  164  NLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKPLTFPR  316
            +LN  V KC YA+RGE+   A  LQ++           +I++ N+GNPH+LGQKP+TF R
Sbjct  11   DLNPKVLKCAYAIRGEIVTHAQILQQDLFENPGSHPFNEILYCNIGNPHSLGQKPITFFR  70

Query  317  QVIALCQAPFLLD  355
            +V+ALC  P LLD
Sbjct  71   EVLALCDHPLLLD  83



>emb|CBN81871.1| Alanine aminotransferase 2-like [Dicentrarchus labrax]
Length=491

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 53/77 (69%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  +N+N NVK+ +YAVRG +  RA +++KE K+        +I  N+G+ HA+GQKP+T
Sbjct  16   LTLDNMNPNVKRVEYAVRGPIVQRAVQIEKELKEGVKKPFSEVIKANIGDAHAMGQKPIT  75

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LL+D
Sbjct  76   FLRQVLALCSYPELLED  92



>ref|XP_010318452.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X1 [Solanum lycopersicum]
Length=487

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 12/76 (16%)
 Frame = +2

Query  164  NLNENVKKCQYAVRGELYLRASELQK------------EGKKIIFTNVGNPHALGQKPLT  307
            +LN  V KC YA+RGE+   A  LQ+            E  +I++ N+GNPH+LGQKP+T
Sbjct  11   DLNPKVLKCAYAIRGEIVTHAQILQQDLFENPGSHPFNEFMQILYCNIGNPHSLGQKPIT  70

Query  308  FPRQVIALCQAPFLLD  355
            F R+V+ALC  P LLD
Sbjct  71   FFREVLALCDHPLLLD  86



>gb|KFV72169.1| Alanine aminotransferase 2, partial [Picoides pubescens]
Length=536

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  61   LTLESMNPLVKALEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  120

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  121  FLRQVVALCTYPNLLDSPS  139



>gb|KFH67262.1| alanine transaminase [Mortierella verticillata NRRL 6337]
Length=540

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 52/79 (66%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  307
            L  +N+NE V+K +YAVRGEL +R+ EL+ E         K+++  N+GNP AL QKP+T
Sbjct  62   LTSKNMNEQVRKAEYAVRGELAIRSEELKNELAKGVKLPFKRVVGCNIGNPQALDQKPIT  121

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV +L + P LL D N
Sbjct  122  FFRQVASLTEYPELLKDEN  140



>ref|XP_005865158.1| PREDICTED: alanine aminotransferase 1 [Myotis brandtii]
Length=265

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  + +N  VK+ +YAVRG + LRA EL++E ++        +I  N+G+ HA+GQKP+T
Sbjct  21   LTLDTMNACVKRVEYAVRGPIVLRALELEQELRQGVKKPFTEVIRANIGDAHAMGQKPIT  80

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LL+ P+
Sbjct  81   FLRQVLALCVHPDLLNSPD  99



>ref|XP_009904992.1| PREDICTED: alanine aminotransferase 2 [Picoides pubescens]
Length=486

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  11   LTLESMNPLVKALEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPIT  70

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  71   FLRQVVALCTYPNLLDSPS  89



>tpg|DAA63614.1| TPA: hypothetical protein ZEAMMB73_898222, partial [Zea mays]
Length=175

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  301
            P+    +N  V KC+YAVRGE+   A  LQ+E +K         I++ N+GNP +LGQ+P
Sbjct  63   PVSVATINPKVLKCEYAVRGEIVTHAQNLQQELQKNPESLPFDEILYCNIGNPQSLGQQP  122

Query  302  LTFPRQVIALCQAPFLLD  355
            +T+ R+V++LC  P LLD
Sbjct  123  VTYFREVLSLCDHPALLD  140



>ref|XP_002304255.2| hypothetical protein POPTR_0003s07020g [Populus trichocarpa]
 gb|EEE79234.2| hypothetical protein POPTR_0003s07020g [Populus trichocarpa]
Length=481

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+  +N+N  V KC+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  3    PVSLDNINPKVLKCEYAVRGEIVTLAQALQEELKSKPGSHPFDEILYCNIGNPQSLGQQP  62

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P +LD
Sbjct  63   ITFFREVLALCDHPSILD  80



>ref|XP_002532946.1| alanine transaminase, putative [Ricinus communis]
 gb|EEF29430.1| alanine transaminase, putative [Ricinus communis]
Length=170

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            PL    +N  V +C+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  56   PLSLNTINPKVLECEYAVRGEIVTIAQRLQEELKTNPGSHPFDEILYCNIGNPQSLGQQP  115

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P +LD
Sbjct  116  ITFFREVLALCDHPAILD  133



>ref|XP_007510961.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66521.1| predicted protein [Bathycoccus prasinos]
Length=480

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 51/80 (64%), Gaps = 9/80 (11%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  301
            P++   +N+NV   +YAVRG + +RA EL  + KK         I+  N+GNP +LGQKP
Sbjct  4    PVNANTINQNVLTAEYAVRGPIVVRAGELALQLKKDPSSLPFEDIVLCNIGNPQSLGQKP  63

Query  302  LTFPRQVIALCQAPFLLDDP  361
            +TF RQ++A+C  P LLD P
Sbjct  64   ITFYRQIMAICDYPDLLDSP  83



>ref|XP_005648726.1| alanine aminotransferase 2 [Coccomyxa subellipsoidea C-169]
 gb|EIE24182.1| alanine aminotransferase 2 [Coccomyxa subellipsoidea C-169]
Length=505

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 8/78 (10%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPL  304
            PL  EN+N  V K QYAVRGE+ +RA EL+ +          KI++ N+GNP  LGQ P+
Sbjct  19   PLALENINPKVVKAQYAVRGEIVIRAKELEDKLHAGEKLPFDKILYCNIGNPQQLGQHPV  78

Query  305  TFPRQVIALCQAPFLLDD  358
            TF RQV+A+C  P LL+ 
Sbjct  79   TFYRQVLAICDYPELLES  96



>emb|CDI98892.1| alanine aminotransferase 2 [Echinococcus multilocularis]
 emb|CDS36174.1| alanine aminotransferase 2 [Echinococcus multilocularis]
Length=587

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 52/79 (66%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKE---GKK-----IIFTNVGNPHALGQKPLT  307
            L    +N NV   +YAVRG + +R+ EL+KE   G+K     +I  N+G+ HA GQKP+T
Sbjct  54   LTLATINPNVIHMEYAVRGPIVIRSQELEKELQLGEKKNFQQVIKCNIGDCHATGQKPIT  113

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQVIALC  P LL+DPN
Sbjct  114  FFRQVIALCSYPPLLEDPN  132



>ref|XP_008460347.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Cucumis 
melo]
Length=530

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  301
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  52   PLSVATINDKVLKCEYAVRGEIVTLAQKLQEELSAKPGLHPFDEILYCNIGNPQSLGQQP  111

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P +LD
Sbjct  112  ITFFREVLALCDHPAILD  129



>ref|XP_008800517.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+ + ++N  V KC+YAVRGE+   A  LQ+E +         +I++ N+GNP +LGQ+P
Sbjct  52   PVTFASINPKVLKCEYAVRGEIVSHAQRLQQELQTKPDSHPFDEILYCNIGNPQSLGQQP  111

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P +LD
Sbjct  112  VTFFREVLALCDHPSILD  129



>ref|XP_004144444.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=528

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  301
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  50   PLSIATINDKVLKCEYAVRGEIVTLAQKLQEELSVKPGSHPFDEILYCNIGNPQSLGQQP  109

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P +LD
Sbjct  110  ITFFREVLALCDHPAILD  127



>gb|KGN58474.1| hypothetical protein Csa_3G646610 [Cucumis sativus]
Length=535

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKE---------GKKIIFTNVGNPHALGQKP  301
            PL    +N+ V KC+YAVRGE+   A +LQ+E           +I++ N+GNP +LGQ+P
Sbjct  57   PLSIATINDKVLKCEYAVRGEIVTLAQKLQEELSVKPGSHPFDEILYCNIGNPQSLGQQP  116

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P +LD
Sbjct  117  ITFFREVLALCDHPAILD  134



>ref|XP_010896061.1| PREDICTED: alanine aminotransferase 2 [Esox lucius]
Length=558

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQK---EGKKIIFT-----NVGNPHALGQKPLT  307
            L  E LN  VK  +YAVRG + L+A E+++   +G+K  FT     N+G+ HA+GQKP+T
Sbjct  76   LTMETLNPQVKAVEYAVRGPIVLKAGEIERGLQQGQKHPFTEVIKANIGDAHAMGQKPIT  135

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LL+ P+
Sbjct  136  FLRQVVALCSFPELLESPS  154



>ref|XP_008436808.1| PREDICTED: alanine aminotransferase 1 [Poecilia reticulata]
Length=491

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  EN+N NVK+ +YAVRG +  RA +++KE ++        +I  N+G+ HA+GQ+P+T
Sbjct  16   LTVENMNPNVKRVEYAVRGPIVQRAVQIEKELREGVKKPFTEVIKANIGDAHAMGQRPIT  75

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LL+D
Sbjct  76   FFRQVLALCSYPELLED  92



>ref|XP_006794722.1| PREDICTED: alanine aminotransferase 2-like [Neolamprologus brichardi]
Length=491

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 53/77 (69%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  +++N NVK+ +YAVRG +  RA +L+KE K+        +I  N+G+ HA+GQKP+T
Sbjct  16   LTLDSMNPNVKRVEYAVRGPIVQRAVQLEKELKEGVKKPFTEVIKANIGDAHAMGQKPIT  75

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LL+D
Sbjct  76   FFRQVLALCSYPALLED  92



>ref|XP_011079322.1| PREDICTED: alanine aminotransferase 2-like [Sesamum indicum]
Length=542

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 52/78 (67%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            PL  + +N  V +C+YAVRGE+ + A  LQ+E K         +I++ N+GNP +LGQ+P
Sbjct  64   PLTLDTINPKVLECEYAVRGEIVILAQRLQEELKNNPNAHPFDEILYCNIGNPQSLGQQP  123

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P LLD
Sbjct  124  ITFFREVLALCDHPALLD  141



>ref|XP_010537653.1| PREDICTED: alanine aminotransferase 2, mitochondrial [Tarenaya 
hassleriana]
Length=540

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 9/79 (11%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKP  301
            P+  +++N  V KC+YAVRGE+   A  LQ++ K         +II+ N+GNP +LGQ+P
Sbjct  62   PVTVQSINPKVLKCEYAVRGEIVSIAQRLQEDLKVNKDAYPFDEIIYCNIGNPQSLGQQP  121

Query  302  LTFPRQVIALCQAPFLLDD  358
            +T+ R+V+ALC  P LLD+
Sbjct  122  ITYFREVLALCDHPALLDE  140



>ref|XP_011304772.1| PREDICTED: alanine aminotransferase 1 [Fopius arisanus]
 ref|XP_011304773.1| PREDICTED: alanine aminotransferase 1 [Fopius arisanus]
Length=536

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  307
            L  +N+  N+++ +YAVRG L LRA E++KE         K++I  N+G+ HA+GQ+P+ 
Sbjct  63   LTLDNVYSNLRRMEYAVRGPLLLRALEIEKELEKGAKKPFKEVIKANIGDAHAMGQRPIK  122

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ L  +P LLDDPN
Sbjct  123  FLRQVLTLTVSPELLDDPN  141



>ref|XP_001219089.1| alanine aminotransferase [Trypanosoma brucei brucei TREU927]
 emb|CAJ16602.1| alanine aminotransferase, putative [Trypanosoma brucei brucei 
TREU927]
Length=569

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 11/79 (14%)
 Frame = +2

Query  164  NLNENVKKCQYAVRGELYLRASELQKE-----GK------KIIFTNVGNPHALGQKPLTF  310
            ++N  VKK QYAVRG + +RA E+++E     GK      ++++ N+GNP AL QKPLTF
Sbjct  85   HINPRVKKAQYAVRGLVPMRADEIREEIRSGTGKSKFSFNELVYCNIGNPQALEQKPLTF  144

Query  311  PRQVIALCQAPFLLDDPNV  367
             RQV++L  APFLL+D  V
Sbjct  145  HRQVMSLIDAPFLLEDNAV  163



>ref|NP_001136246.1| alanine aminotransferase 2-like [Danio rerio]
Length=493

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  + +N NVKK  YAVRG +  RA +++KE K+        +I  N+G+ HA+GQ+P+T
Sbjct  18   LTVDTMNANVKKVDYAVRGPIVQRAVQIEKELKEGVKKPFDEVIKANIGDAHAMGQRPIT  77

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LLDD
Sbjct  78   FFRQVMALCTYPQLLDD  94



>ref|XP_004600748.1| PREDICTED: alanine aminotransferase 2 [Sorex araneus]
Length=522

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E+++E ++        +I  N+G+ HA+GQ+P+T
Sbjct  48   LTLESMNPQVKALEYAVRGPIVLKAGEIERELRRGIKKPFTEVIRANIGDAHAMGQQPIT  107

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  108  FLRQVVALCTYPNLLDSPS  126



>ref|XP_003222977.1| PREDICTED: alanine aminotransferase 2 [Anolis carolinensis]
Length=541

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 52/79 (66%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++ E +K        +I  N+G+ HA+GQ+P+T
Sbjct  66   LTLESMNPQVKAVEYAVRGPIVLKAGEIENELRKGIKKPFTEVIKANIGDAHAMGQQPIT  125

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD P+
Sbjct  126  FLRQVVALCTYPNLLDSPS  144



>ref|XP_006559494.1| PREDICTED: alanine aminotransferase 2-like [Apis mellifera]
Length=543

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 54/79 (68%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  307
            L  +N+  N++K +YAVRG L LRA E++KE         K++I  NVG+ HA+GQ+P+T
Sbjct  70   LTEDNVFTNLRKMEYAVRGPLLLRALEIEKELQKGVKKPFKEVIKANVGDAHAMGQQPIT  129

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ L  +P LL+DPN
Sbjct  130  FLRQVLTLTVSPNLLNDPN  148



>dbj|GAA97564.1| hypothetical protein E5Q_04242 [Mixia osmundae IAM 14324]
 gb|KEI42010.1| hypothetical protein L969DRAFT_91476 [Mixia osmundae IAM 14324]
Length=574

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 10/80 (13%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK----------IIFTNVGNPHALGQKP  301
            L  +++N NVK  +YAVRG + LRA EL+ + +K          ++  N+GNP  LGQ P
Sbjct  98   LTLDSINHNVKTAEYAVRGAIALRAEELRVKTQKGDTKDLNFKEVVSCNIGNPQQLGQTP  157

Query  302  LTFPRQVIALCQAPFLLDDP  361
            +TF RQV ALC+ P LLD+P
Sbjct  158  ITFFRQVAALCECPDLLDNP  177



>ref|XP_006641441.1| PREDICTED: alanine aminotransferase 2-like [Lepisosteus oculatus]
Length=555

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 8/78 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIFT-----NVGNPHALGQKPLT  307
            L  E +N  +K  +YAVRG + ++A E+++E   G K  FT     N+G+ HA+GQKP+T
Sbjct  73   LTMETMNPQIKTVEYAVRGPIVIKAGEIERELQEGVKKPFTEVIKANIGDAHAMGQKPIT  132

Query  308  FPRQVIALCQAPFLLDDP  361
            F RQV+ALC  P LLD P
Sbjct  133  FLRQVVALCTCPELLDSP  150



>ref|XP_011036545.1| PREDICTED: alanine aminotransferase 2-like [Populus euphratica]
Length=533

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 50/74 (68%), Gaps = 9/74 (12%)
 Frame = +2

Query  161  ENLNENVKKCQYAVRGELYLRASELQKEGK---------KIIFTNVGNPHALGQKPLTFP  313
            +N+N  V KC+YAVRGE+   A  LQ+E K         +I++ N+GNP +LGQ+P+TF 
Sbjct  59   DNINPKVLKCEYAVRGEIVTLAQALQEELKSKPGSHPFDEILYCNIGNPQSLGQQPITFF  118

Query  314  RQVIALCQAPFLLD  355
            R+V+ALC  P +LD
Sbjct  119  REVLALCDHPSILD  132



>ref|XP_002265294.2| PREDICTED: alanine aminotransferase 2 [Vitis vinifera]
Length=526

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  301
            P+  E +N  V +C+YAVRGE+   A  LQ+E ++         I++ N+GNP +LGQ+P
Sbjct  48   PVTLETINPKVLECEYAVRGEIVTLAQRLQQELQEKPGSLPFDEILYCNIGNPQSLGQQP  107

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+VIALC  P +LD
Sbjct  108  ITFFREVIALCDHPPILD  125



>gb|ADB91976.1| alanine aminotransferase [Branchiostoma belcheri]
Length=500

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 53/77 (69%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  307
            L  +++N  VKK +YAVRG +  RA+EL+KE         K++I  N+G+ HA+GQKP+T
Sbjct  26   LTIDSMNPLVKKVEYAVRGPIVARATELEKELERGVPKPFKQVIKANIGDAHAMGQKPIT  85

Query  308  FPRQVIALCQAPFLLDD  358
            F RQVI+LC  P LLD+
Sbjct  86   FLRQVISLCVNPDLLDN  102



>ref|XP_011169171.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Solenopsis 
invicta]
Length=485

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 55/79 (70%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  +N+ EN++K ++ VRG L++RA E++KE +K        +I  N+G+ HA+GQ+P+T
Sbjct  14   LTEDNVFENLRKMEFVVRGPLHVRAQEIEKELQKGNKKPFNEVITANMGDAHAMGQQPIT  73

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ L  +P LLDDP+
Sbjct  74   FLRQVLTLTVSPHLLDDPS  92



>ref|XP_006607395.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Apis dorsata]
 ref|XP_006607396.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Apis dorsata]
 ref|XP_006607397.1| PREDICTED: alanine aminotransferase 2-like isoform X3 [Apis dorsata]
 ref|XP_006607398.1| PREDICTED: alanine aminotransferase 2-like isoform X4 [Apis dorsata]
Length=543

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  307
            L  +N+  N++K +YAVRG L LRA E++KE         K++I  NVG+ HA+GQ+P+T
Sbjct  70   LTEDNVFTNLRKMEYAVRGPLLLRALEIEKELQKGVKKPFKEVIKANVGDAHAMGQQPIT  129

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ L  +P LL DPN
Sbjct  130  FLRQVLTLTVSPNLLSDPN  148



>ref|XP_003291733.1| alanine transaminase [Dictyostelium purpureum]
 gb|EGC31753.1| alanine transaminase [Dictyostelium purpureum]
Length=530

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 54/85 (64%), Gaps = 13/85 (15%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASEL-------QKEGKK------IIFTNVGNPHALG  292
            +  +N+ +NV+  QYAVRGEL +RA  +       +KEG K      I++ N+GNP  L 
Sbjct  50   MTIDNICQNVRNAQYAVRGELVIRAESISHQLEKQKKEGSKVLPFDEIVYCNIGNPQQLK  109

Query  293  QKPLTFPRQVIALCQAPFLLDDPNV  367
            QKPLTF RQV++L + P LLD+P +
Sbjct  110  QKPLTFFRQVVSLTECPELLDNPYI  134



>ref|XP_004664888.1| PREDICTED: alanine aminotransferase 2 [Jaculus jaculus]
Length=522

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 52/79 (66%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  E++N  VK  +YAVRG + L+A E++ E ++        +I  N+G+ HA+GQ+P+T
Sbjct  48   LTLESMNPQVKAVEYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQPIT  107

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LLD PN
Sbjct  108  FLRQVMALCTYPNLLDSPN  126



>ref|XP_010029516.1| PREDICTED: alanine aminotransferase 2-like [Eucalyptus grandis]
 gb|KCW56436.1| hypothetical protein EUGRSUZ_I02163 [Eucalyptus grandis]
Length=539

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  301
            P+  + +N  V KC+YAVRGE+   A  LQ+E K+         I++ N+GNP +LGQ+P
Sbjct  61   PVTLDTINPKVLKCEYAVRGEIVSIAQRLQQELKENPGSHPFDEILYCNIGNPQSLGQQP  120

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+V+ALC  P +LD
Sbjct  121  ITFFREVLALCDHPSILD  138



>ref|XP_005105612.1| PREDICTED: alanine aminotransferase 2-like [Aplysia californica]
Length=501

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 54/80 (68%), Gaps = 8/80 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIFT-----NVGNPHALGQKPLT  307
            L  +N+N +VK  +YAVRG + +RA E++KE   G+K  FT     N+G+ HA GQ+PLT
Sbjct  27   LTIDNMNPHVKNIEYAVRGPIVIRAGEIEKELNAGEKKNFTDVIRANIGDCHATGQEPLT  86

Query  308  FPRQVIALCQAPFLLDDPNV  367
            F RQV+ +C  P L +DP++
Sbjct  87   FLRQVVGICAYPKLFEDPSL  106



>ref|XP_003692587.1| PREDICTED: LOW QUALITY PROTEIN: alanine aminotransferase 2-like 
[Apis florea]
Length=543

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKE--------GKKIIFTNVGNPHALGQKPLT  307
            L  +N+  N++K +YAVRG L LRA E++KE         K++I  NVG+ HA+GQ+P+T
Sbjct  70   LTEDNVFTNLRKMEYAVRGPLLLRALEIEKELQKGVKKPFKEVIKANVGDAHAMGQQPIT  129

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ L  +P LL DPN
Sbjct  130  FLRQVLTLTVSPNLLSDPN  148



>gb|AAH61955.1| Gpt2l protein [Danio rerio]
 gb|AAH66543.1| Gpt2l protein [Danio rerio]
Length=526

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  + +N NVKK  YAVRG +  RA +++KE K+        +I  N+G+ HA+GQ+P+T
Sbjct  51   LTVDTMNANVKKVDYAVRGPIVQRAVQIEKELKEGVKKPFDEVIKANIGDAHAMGQRPIT  110

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LLDD
Sbjct  111  FFRQVMALCTYPQLLDD  127



>ref|XP_004546617.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Maylandia 
zebra]
Length=511

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  +++N NVK+ +YAVRG +  RA +++KE K+        +I  N+G+ HA+GQKP+T
Sbjct  36   LTLDSMNPNVKRVEYAVRGPIVQRAVQIEKELKEGAKKPFTEVIKANIGDAHAMGQKPIT  95

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LL+D
Sbjct  96   FFRQVLALCSYPALLED  112



>ref|XP_005912152.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Haplochromis 
burtoni]
 ref|XP_005912153.1| PREDICTED: alanine aminotransferase 2-like isoform X3 [Haplochromis 
burtoni]
Length=491

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  +++N NVK+ +YAVRG +  RA +++KE K+        +I  N+G+ HA+GQKP+T
Sbjct  16   LTLDSMNPNVKRVEYAVRGPIVQRAVQIEKELKEGAKKPFTEVIKANIGDAHAMGQKPIT  75

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LL+D
Sbjct  76   FFRQVLALCSYPALLED  92



>ref|XP_005912151.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Haplochromis 
burtoni]
Length=511

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  +++N NVK+ +YAVRG +  RA +++KE K+        +I  N+G+ HA+GQKP+T
Sbjct  36   LTLDSMNPNVKRVEYAVRGPIVQRAVQIEKELKEGAKKPFTEVIKANIGDAHAMGQKPIT  95

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LL+D
Sbjct  96   FFRQVLALCSYPALLED  112



>ref|XP_004546618.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Maylandia 
zebra]
Length=491

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  +++N NVK+ +YAVRG +  RA +++KE K+        +I  N+G+ HA+GQKP+T
Sbjct  16   LTLDSMNPNVKRVEYAVRGPIVQRAVQIEKELKEGAKKPFTEVIKANIGDAHAMGQKPIT  75

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LL+D
Sbjct  76   FFRQVLALCSYPALLED  92



>ref|XP_003443544.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Oreochromis 
niloticus]
Length=491

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  +++N NVK+ +YAVRG +  RA +++KE K+        +I  N+G+ HA+GQKP+T
Sbjct  16   LTLDSMNPNVKRVEYAVRGPIVQRAVQIEKELKEGVKKPFTEVIKANIGDAHAMGQKPIT  75

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LL+D
Sbjct  76   FFRQVLALCSYPALLED  92



>ref|XP_005471814.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Oreochromis 
niloticus]
Length=511

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  +++N NVK+ +YAVRG +  RA +++KE K+        +I  N+G+ HA+GQKP+T
Sbjct  36   LTLDSMNPNVKRVEYAVRGPIVQRAVQIEKELKEGVKKPFTEVIKANIGDAHAMGQKPIT  95

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LL+D
Sbjct  96   FFRQVLALCSYPALLED  112



>sp|Q6NYL5.2|ALAT2_DANRE RecName: Full=Alanine aminotransferase 2-like; Short=ALT2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT 2; 
AltName: Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Danio rerio]
Length=549

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  + +N NVKK  YAVRG +  RA +++KE K+        +I  N+G+ HA+GQ+P+T
Sbjct  74   LTVDTMNANVKKVDYAVRGPIVQRAVQIEKELKEGVKKPFDEVIKANIGDAHAMGQRPIT  133

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LLDD
Sbjct  134  FFRQVMALCTYPQLLDD  150



>gb|AIT69925.1| alanine transaminase [Saccharina sculpera]
Length=501

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  304
            PLD   +NENVK  +YAVRG +  R+ ELQ+    G+K+ F      N+GNPHA  Q PL
Sbjct  21   PLDGTTINENVKSAKYAVRGNVLERSMELQRRMAAGEKLPFDTIVPCNIGNPHACLQSPL  80

Query  305  TFPRQVIALCQAPFLLDD-PNV  367
            +F R+V++LC +P L  D P+V
Sbjct  81   SFHREVLSLCISPTLASDHPHV  102



>gb|AGE89227.1| mitochondrial alanine aminotransferase, partial [Dicentrarchus 
labrax]
Length=154

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKE---GKK-----IIFTNVGNPHALGQKPLT  307
            L  + +N  VKK +YAVRG +  RA EL++E   G K     +I  N+G+ HA+GQ+P+T
Sbjct  21   LTIDTMNPTVKKVEYAVRGPIVQRAVELERELSEGIKKPFAEVIKANIGDAHAMGQQPIT  80

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P LL+D
Sbjct  81   FFRQVLALCSYPELLND  97



>ref|XP_005526440.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Pseudopodoces 
humilis]
Length=471

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 50/74 (68%), Gaps = 8/74 (11%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLTFPRQV  322
            +N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+TF RQV
Sbjct  1    MNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPITFLRQV  60

Query  323  IALCQAPFLLDDPN  364
            +ALC  P LLD P+
Sbjct  61   VALCTYPNLLDSPS  74



>ref|XP_008068165.1| PREDICTED: alanine aminotransferase 1 [Tarsius syrichta]
Length=496

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 52/79 (66%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  + +N +V++ +YAVRG + LRA EL++E ++        II  NVG+  A+GQKP+T
Sbjct  21   LTLDTMNPSVQRVEYAVRGPIVLRAMELERELRQGVKKPFTEIIHANVGDAQAMGQKPIT  80

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LL  PN
Sbjct  81   FLRQVLALCVNPDLLSSPN  99



>emb|CBI35796.3| unnamed protein product [Vitis vinifera]
Length=482

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 9/78 (12%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKEGKK---------IIFTNVGNPHALGQKP  301
            P+  E +N  V +C+YAVRGE+   A  LQ+E ++         I++ N+GNP +LGQ+P
Sbjct  4    PVTLETINPKVLECEYAVRGEIVTLAQRLQQELQEKPGSLPFDEILYCNIGNPQSLGQQP  63

Query  302  LTFPRQVIALCQAPFLLD  355
            +TF R+VIALC  P +LD
Sbjct  64   ITFFREVIALCDHPPILD  81



>ref|XP_008302267.1| PREDICTED: alanine aminotransferase 1 [Stegastes partitus]
Length=491

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 53/77 (69%), Gaps = 8/77 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  +N+N NVK+ +YAVRG +  RA +++KE ++        +I  N+G+ HA+GQKP+T
Sbjct  16   LTVDNMNPNVKRVEYAVRGPIVQRAVQIEKELREGVKKPFTEVIKANIGDAHAMGQKPIT  75

Query  308  FPRQVIALCQAPFLLDD  358
            F RQV+ALC  P L++D
Sbjct  76   FLRQVLALCAYPELMED  92



>gb|AIT69927.1| alanine transaminase [Saccharina japonica]
 gb|AIW62927.1| alanine transaminase [Saccharina japonica]
Length=501

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +2

Query  149  PLDYENLNENVKKCQYAVRGELYLRASELQKE---GKKIIF-----TNVGNPHALGQKPL  304
            PLD   +NENVK  +YAVRG +  R+ ELQ+    G+K+ F      N+GNPHA  Q PL
Sbjct  21   PLDGTTINENVKSAKYAVRGNVLERSMELQRRMAAGEKLPFDTIVPCNIGNPHACLQSPL  80

Query  305  TFPRQVIALCQAPFLLDD-PNV  367
            +F R+V++LC +P L  D P+V
Sbjct  81   SFHREVLSLCISPTLASDHPHV  102



>ref|XP_008682329.1| PREDICTED: alanine aminotransferase 1, partial [Ursus maritimus]
Length=193

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 8/79 (10%)
 Frame = +2

Query  152  LDYENLNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLT  307
            L  + +N  V++ +YAVRG + LRA EL++E ++        +I  N+G+  A+GQKP+T
Sbjct  21   LTLDTMNPCVRRVEYAVRGPIVLRALELEQELRQGVKKPFTEVIRANIGDAQAMGQKPIT  80

Query  308  FPRQVIALCQAPFLLDDPN  364
            F RQV+ALC  P LL+ PN
Sbjct  81   FLRQVLALCVHPDLLNSPN  99



>ref|XP_009461778.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Nipponia nippon]
 ref|XP_009461779.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Nipponia nippon]
Length=471

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 50/74 (68%), Gaps = 8/74 (11%)
 Frame = +2

Query  167  LNENVKKCQYAVRGELYLRASELQKEGKK--------IIFTNVGNPHALGQKPLTFPRQV  322
            +N  VK  +YAVRG + L+A E++KE +K        +I  N+G+ HA+GQ+P+TF RQV
Sbjct  1    MNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKANIGDAHAMGQRPITFLRQV  60

Query  323  IALCQAPFLLDDPN  364
            +ALC  P LLD P+
Sbjct  61   VALCTYPNLLDSPS  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555214126005