BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF021H13

Length=548
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009768860.1|  PREDICTED: BAG family molecular chaperone re...    142   2e-37   Nicotiana sylvestris
ref|XP_009615951.1|  PREDICTED: BAG family molecular chaperone re...    142   2e-37   Nicotiana tomentosiformis
ref|XP_009608641.1|  PREDICTED: BAG family molecular chaperone re...    137   2e-35   
ref|XP_009774065.1|  PREDICTED: BAG family molecular chaperone re...    136   3e-35   Nicotiana sylvestris
ref|XP_006340523.1|  PREDICTED: BAG family molecular chaperone re...    135   2e-34   Solanum tuberosum [potatoes]
ref|XP_007038591.1|  BCL-2-associated athanogene 3                      132   2e-33   Theobroma cacao [chocolate]
ref|XP_004234356.1|  PREDICTED: BAG family molecular chaperone re...    128   4e-32   Solanum lycopersicum
emb|CDP10646.1|  unnamed protein product                                128   7e-32   Coffea canephora [robusta coffee]
ref|XP_007218234.1|  hypothetical protein PRUPE_ppa007973mg             128   8e-32   Prunus persica
ref|XP_006490329.1|  PREDICTED: BAG family molecular chaperone re...    128   8e-32   Citrus sinensis [apfelsine]
ref|XP_006421855.1|  hypothetical protein CICLE_v10005288mg             128   8e-32   Citrus clementina [clementine]
ref|XP_008377120.1|  PREDICTED: BAG family molecular chaperone re...    127   9e-32   Malus domestica [apple tree]
ref|XP_008376529.1|  PREDICTED: BAG family molecular chaperone re...    127   1e-31   Malus domestica [apple tree]
gb|ADW66455.1|  BCL-2-associated athanogene                             127   1e-31   Malus hupehensis
ref|XP_008234288.1|  PREDICTED: BAG family molecular chaperone re...    127   1e-31   Prunus mume [ume]
gb|KHG08052.1|  BAG family molecular chaperone regulator 3              126   1e-31   Gossypium arboreum [tree cotton]
ref|NP_001292195.1|  BAG family molecular chaperone regulator 3         126   3e-31   Fragaria vesca [alpine strawberry]
gb|KJB39387.1|  hypothetical protein B456_007G010400                    125   6e-31   Gossypium raimondii
ref|XP_009371286.1|  PREDICTED: BAG family molecular chaperone re...    124   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_010107398.1|  BAG family molecular chaperone regulator 1         124   3e-30   Morus notabilis
gb|KHG18670.1|  BAG family molecular chaperone regulator 1              123   4e-30   Gossypium arboreum [tree cotton]
gb|EYU25059.1|  hypothetical protein MIMGU_mgv1a010635mg                122   5e-30   Erythranthe guttata [common monkey flower]
ref|XP_004169255.1|  PREDICTED: BAG family molecular chaperone re...    120   5e-30   
ref|XP_010321994.1|  PREDICTED: BAG family molecular chaperone re...    122   1e-29   Solanum lycopersicum
gb|KJB23928.1|  hypothetical protein B456_004G121700                    122   1e-29   Gossypium raimondii
ref|XP_011076229.1|  PREDICTED: LOW QUALITY PROTEIN: BAG family m...    121   2e-29   Sesamum indicum [beniseed]
ref|XP_006353366.1|  PREDICTED: BAG family molecular chaperone re...    120   3e-29   Solanum tuberosum [potatoes]
ref|XP_002510840.1|  protein binding protein, putative                  120   3e-29   Ricinus communis
ref|XP_006401868.1|  hypothetical protein EUTSA_v10014030mg             120   4e-29   Eutrema salsugineum [saltwater cress]
ref|XP_011041640.1|  PREDICTED: BAG family molecular chaperone re...    120   5e-29   Populus euphratica
ref|XP_002321874.2|  hypothetical protein POPTR_0015s13910g             120   5e-29   Populus trichocarpa [western balsam poplar]
gb|KDP22324.1|  hypothetical protein JCGZ_26155                         120   6e-29   Jatropha curcas
ref|XP_010537211.1|  PREDICTED: BAG family molecular chaperone re...    119   6e-29   Tarenaya hassleriana [spider flower]
emb|CBI31837.3|  unnamed protein product                                119   7e-29   Vitis vinifera
ref|XP_010537209.1|  PREDICTED: BAG family molecular chaperone re...    120   7e-29   Tarenaya hassleriana [spider flower]
ref|XP_010519233.1|  PREDICTED: BAG family molecular chaperone re...    120   7e-29   Tarenaya hassleriana [spider flower]
ref|XP_010035095.1|  PREDICTED: BAG family molecular chaperone re...    120   8e-29   Eucalyptus grandis [rose gum]
emb|CDP09089.1|  unnamed protein product                                119   1e-28   Coffea canephora [robusta coffee]
ref|XP_008439171.1|  PREDICTED: BAG family molecular chaperone re...    119   1e-28   Cucumis melo [Oriental melon]
emb|CDY27085.1|  BnaA02g11050D                                          119   2e-28   Brassica napus [oilseed rape]
ref|XP_009127257.1|  PREDICTED: BAG family molecular chaperone re...    118   2e-28   Brassica rapa
ref|XP_004143625.1|  PREDICTED: BAG family molecular chaperone re...    118   2e-28   Cucumis sativus [cucumbers]
ref|XP_002279827.1|  PREDICTED: BAG family molecular chaperone re...    118   2e-28   Vitis vinifera
emb|CAN63593.1|  hypothetical protein VITISV_023247                     118   2e-28   Vitis vinifera
emb|CDY67495.1|  BnaC02g45010D                                          118   2e-28   Brassica napus [oilseed rape]
ref|XP_004496603.1|  PREDICTED: BAG family molecular chaperone re...    117   4e-28   Cicer arietinum [garbanzo]
ref|XP_004140792.1|  PREDICTED: BAG family molecular chaperone re...    117   5e-28   Cucumis sativus [cucumbers]
ref|XP_002865891.1|  hypothetical protein ARALYDRAFT_357447             117   5e-28   
ref|XP_006599634.1|  PREDICTED: BAG family molecular chaperone re...    117   6e-28   Glycine max [soybeans]
gb|KHN31536.1|  BAG family molecular chaperone regulator 3              117   6e-28   Glycine soja [wild soybean]
ref|XP_009127256.1|  PREDICTED: BAG family molecular chaperone re...    117   7e-28   Brassica rapa
gb|KHN31535.1|  BAG family molecular chaperone regulator 1              117   8e-28   Glycine soja [wild soybean]
ref|XP_009132555.1|  PREDICTED: BAG family molecular chaperone re...    116   9e-28   Brassica rapa
emb|CDY68101.1|  BnaCnng57590D                                          116   1e-27   Brassica napus [oilseed rape]
ref|XP_003592309.1|  BAG-domain protein 1 / regulator of cell death     116   2e-27   Medicago truncatula
ref|XP_003533229.2|  PREDICTED: BAG family molecular chaperone re...    115   4e-27   Glycine max [soybeans]
ref|XP_011101173.1|  PREDICTED: BAG family molecular chaperone re...    115   4e-27   Sesamum indicum [beniseed]
gb|EYU19519.1|  hypothetical protein MIMGU_mgv1a009583mg                114   6e-27   Erythranthe guttata [common monkey flower]
ref|XP_008467215.1|  PREDICTED: BAG family molecular chaperone re...    113   1e-26   Cucumis melo [Oriental melon]
ref|XP_011081155.1|  PREDICTED: BAG family molecular chaperone re...    112   2e-26   
ref|XP_007152341.1|  hypothetical protein PHAVU_004G121800g             113   2e-26   Phaseolus vulgaris [French bean]
ref|XP_002318848.2|  hypothetical protein POPTR_0012s13940g             112   2e-26   
ref|XP_011030027.1|  PREDICTED: BAG family molecular chaperone re...    113   3e-26   Populus euphratica
gb|KEH16829.1|  BAG family molecular chaperone regulator-like pro...    112   6e-26   Medicago truncatula
gb|KHG06573.1|  BAG family molecular chaperone regulator 1              111   1e-25   Gossypium arboreum [tree cotton]
gb|KJB52839.1|  hypothetical protein B456_008G280100                    111   1e-25   Gossypium raimondii
ref|XP_007152340.1|  hypothetical protein PHAVU_004G121700g             110   2e-25   Phaseolus vulgaris [French bean]
emb|CDP09809.1|  unnamed protein product                                109   3e-25   Coffea canephora [robusta coffee]
ref|XP_004516168.1|  PREDICTED: BAG family molecular chaperone re...    109   4e-25   Cicer arietinum [garbanzo]
ref|XP_004245651.1|  PREDICTED: BAG family molecular chaperone re...    107   8e-25   Solanum lycopersicum
ref|NP_001242839.1|  uncharacterized protein LOC100790513               108   1e-24   
ref|XP_010693501.1|  PREDICTED: BAG family molecular chaperone re...    107   2e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006586682.1|  PREDICTED: uncharacterized protein LOC100790...    107   2e-24   
dbj|BAE71291.1|  hypothetical protein                                   107   3e-24   Trifolium pratense [peavine clover]
ref|XP_009759895.1|  PREDICTED: BAG family molecular chaperone re...    106   3e-24   Nicotiana sylvestris
ref|XP_006358866.1|  PREDICTED: BAG family molecular chaperone re...    105   7e-24   Solanum tuberosum [potatoes]
ref|XP_010933885.1|  PREDICTED: BAG family molecular chaperone re...    105   7e-24   Elaeis guineensis
ref|XP_010278545.1|  PREDICTED: BAG family molecular chaperone re...    105   1e-23   Nelumbo nucifera [Indian lotus]
ref|XP_009609256.1|  PREDICTED: BAG family molecular chaperone re...    103   2e-23   Nicotiana tomentosiformis
ref|XP_010523590.1|  PREDICTED: BAG family molecular chaperone re...    104   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_002873301.1|  BCL-2-associated athanogene 3                      103   3e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_006288325.1|  hypothetical protein CARUB_v10001571mg             103   4e-23   Capsella rubella
emb|CDY30692.1|  BnaA02g33140D                                          103   4e-23   Brassica napus [oilseed rape]
ref|XP_010546084.1|  PREDICTED: BAG family molecular chaperone re...    101   5e-23   
gb|EMT16875.1|  hypothetical protein F775_12964                         102   6e-23   
ref|XP_010555653.1|  PREDICTED: BAG family molecular chaperone re...    103   6e-23   Tarenaya hassleriana [spider flower]
ref|XP_010086544.1|  BAG family molecular chaperone regulator 1         103   6e-23   Morus notabilis
gb|EYU38991.1|  hypothetical protein MIMGU_mgv1a011152mg                102   7e-23   Erythranthe guttata [common monkey flower]
ref|XP_010919227.1|  PREDICTED: BAG family molecular chaperone re...    102   8e-23   Elaeis guineensis
ref|XP_006857897.1|  hypothetical protein AMTR_s00069p00126080          102   1e-22   Amborella trichopoda
ref|XP_010442728.1|  PREDICTED: BAG family molecular chaperone re...    102   1e-22   Camelina sativa [gold-of-pleasure]
gb|EEC84905.1|  hypothetical protein OsI_32096                          102   1e-22   Oryza sativa Indica Group [Indian rice]
ref|NP_001063716.1|  Os09g0524800                                       102   1e-22   
ref|XP_010497456.1|  PREDICTED: BAG family molecular chaperone re...  99.0    1e-22   
gb|EPS73724.1|  hypothetical protein M569_01034                         101   2e-22   Genlisea aurea
ref|XP_008795379.1|  PREDICTED: BAG family molecular chaperone re...    101   2e-22   Phoenix dactylifera
ref|NP_196339.1|  BCL-2-associated athanogene 3                         101   2e-22   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA62366.1|  TPA: hypothetical protein ZEAMMB73_865805              100   3e-22   
ref|XP_010444347.1|  PREDICTED: BAG family molecular chaperone re...    101   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006280779.1|  hypothetical protein CARUB_v10026750mg             101   4e-22   Capsella rubella
gb|AAM61448.1|  unknown                                                 100   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002298065.2|  hypothetical protein POPTR_0001s08760g             100   5e-22   
gb|ACG35882.1|  protein binding protein                                 100   5e-22   Zea mays [maize]
ref|XP_010676552.1|  PREDICTED: BAG family molecular chaperone re...    100   5e-22   Beta vulgaris subsp. vulgaris [field beet]
gb|ACG37214.1|  protein binding protein                                 100   5e-22   Zea mays [maize]
ref|XP_007155563.1|  hypothetical protein PHAVU_003G212500g             100   5e-22   Phaseolus vulgaris [French bean]
tpg|DAA62368.1|  TPA: hypothetical protein ZEAMMB73_865805              100   6e-22   
ref|XP_009130192.1|  PREDICTED: BAG family molecular chaperone re...    100   6e-22   Brassica rapa
ref|XP_010423239.1|  PREDICTED: BAG family molecular chaperone re...    100   6e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010491327.1|  PREDICTED: BAG family molecular chaperone re...    100   7e-22   Camelina sativa [gold-of-pleasure]
tpg|DAA62367.1|  TPA: hypothetical protein ZEAMMB73_865805              100   7e-22   
emb|CDX70017.1|  BnaA10g23660D                                          100   8e-22   
ref|XP_003578469.1|  PREDICTED: BAG family molecular chaperone re...    100   8e-22   Brachypodium distachyon [annual false brome]
ref|NP_001119477.1|  BCL-2-associated athanogene 2                    98.2    9e-22   
emb|CDX98996.1|  BnaC09g48390D                                        99.8    9e-22   
ref|XP_010483938.1|  PREDICTED: BAG family molecular chaperone re...  98.2    9e-22   
ref|XP_010452677.1|  PREDICTED: BAG family molecular chaperone re...  99.8    9e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010458273.1|  PREDICTED: BAG family molecular chaperone re...  98.2    1e-21   Camelina sativa [gold-of-pleasure]
ref|NP_001146867.1|  protein binding protein                          99.8    1e-21   Zea mays [maize]
ref|XP_010546082.1|  PREDICTED: BAG family molecular chaperone re...  99.4    1e-21   
ref|XP_006579417.1|  PREDICTED: uncharacterized protein LOC100792...  99.0    1e-21   Glycine max [soybeans]
ref|XP_008670335.1|  PREDICTED: BAG family molecular chaperone re...  99.4    2e-21   Zea mays [maize]
ref|XP_008803274.1|  PREDICTED: BAG family molecular chaperone re...  98.6    2e-21   Phoenix dactylifera
gb|KFK26814.1|  hypothetical protein AALP_AA8G296800                  99.0    2e-21   Arabis alpina [alpine rockcress]
ref|XP_006600808.1|  PREDICTED: BAG family molecular chaperone re...  98.2    3e-21   Glycine max [soybeans]
ref|XP_008803273.1|  PREDICTED: BAG family molecular chaperone re...  98.6    3e-21   Phoenix dactylifera
gb|EPS70571.1|  hypothetical protein M569_04192                       97.4    3e-21   Genlisea aurea
ref|XP_006399204.1|  hypothetical protein EUTSA_v10014190mg           98.2    3e-21   Eutrema salsugineum [saltwater cress]
gb|ABG73438.1|  BAG domain-containing protein                         98.2    4e-21   Oryza brachyantha
ref|XP_011029180.1|  PREDICTED: BAG family molecular chaperone re...  98.2    4e-21   Populus euphratica
gb|EAZ07876.1|  hypothetical protein OsI_30134                        97.8    4e-21   Oryza sativa Indica Group [Indian rice]
dbj|BAD09231.1|  putative BAG domain containing protein               97.8    5e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660860.1|  PREDICTED: BAG family molecular chaperone re...  97.8    5e-21   
ref|XP_002304467.2|  hypothetical protein POPTR_0003s12150g           97.4    5e-21   Populus trichocarpa [western balsam poplar]
ref|XP_008646348.1|  PREDICTED: BAG family molecular chaperone re...  97.8    6e-21   Zea mays [maize]
ref|XP_010483939.1|  PREDICTED: BAG family molecular chaperone re...  95.9    6e-21   
gb|EAZ43546.1|  hypothetical protein OsJ_28168                        97.4    6e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010919226.1|  PREDICTED: BAG family molecular chaperone re...  97.4    6e-21   Elaeis guineensis
ref|XP_010483934.1|  PREDICTED: BAG family molecular chaperone re...  97.4    6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_009122361.1|  PREDICTED: BAG family molecular chaperone re...  97.8    7e-21   Brassica rapa
ref|XP_002864772.1|  BCL-2-associated athanogene 2                    97.1    7e-21   
tpg|DAA48370.1|  TPA: hypothetical protein ZEAMMB73_960791            95.1    7e-21   
ref|NP_001242681.1|  uncharacterized protein LOC100792005             97.1    8e-21   
ref|XP_008803268.1|  PREDICTED: BAG family molecular chaperone re...  97.1    8e-21   
ref|XP_010919225.1|  PREDICTED: BAG family molecular chaperone re...  97.1    8e-21   
ref|NP_001150807.1|  protein binding protein                          97.1    9e-21   
gb|AFW65014.1|  protein binding protein                               97.1    1e-20   
dbj|BAK08177.1|  predicted protein                                    97.1    1e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010483940.1|  PREDICTED: BAG family molecular chaperone re...  96.7    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_003549864.2|  PREDICTED: BAG family molecular chaperone re...  97.1    1e-20   Glycine max [soybeans]
ref|XP_011014081.1|  PREDICTED: BAG family molecular chaperone re...  96.3    1e-20   Populus euphratica
ref|XP_010458257.1|  PREDICTED: BAG family molecular chaperone re...  96.7    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002444634.1|  hypothetical protein SORBIDRAFT_07g025170        96.7    1e-20   Sorghum bicolor [broomcorn]
gb|ADT78385.1|  BCL-2-associated athanogene 3                         96.7    1e-20   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008664486.1|  PREDICTED: BAG family molecular chaperone re...  95.9    1e-20   
ref|XP_008677333.1|  PREDICTED: protein binding protein isoform X1    96.7    1e-20   
gb|AFW21574.1|  hypothetical protein ZEAMMB73_142939                  95.9    2e-20   
ref|XP_010444072.1|  PREDICTED: BAG family molecular chaperone re...  96.3    2e-20   Camelina sativa [gold-of-pleasure]
ref|NP_568950.2|  BCL-2-associated athanogene 2                       95.9    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004294033.1|  PREDICTED: BAG family molecular chaperone re...  95.5    2e-20   Fragaria vesca subsp. vesca
gb|EMS50479.1|  hypothetical protein TRIUR3_24271                     95.9    2e-20   Triticum urartu
tpg|DAA48371.1|  TPA: hypothetical protein ZEAMMB73_960791            95.9    2e-20   
gb|AAM62536.1|  unknown                                               95.5    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851246.1|  BCL-2-associated athanogene 2                       95.5    3e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KEH31705.1|  BAG family molecular chaperone regulator-like pro...  95.5    3e-20   Medicago truncatula
ref|XP_010483936.1|  PREDICTED: BAG family molecular chaperone re...  95.1    4e-20   Camelina sativa [gold-of-pleasure]
ref|NP_001062419.2|  Os08g0546100                                     96.7    5e-20   
ref|XP_004957405.1|  PREDICTED: BAG family molecular chaperone re...  95.1    5e-20   Setaria italica
gb|EMT32730.1|  hypothetical protein F775_28565                       95.1    5e-20   
ref|XP_009391950.1|  PREDICTED: BAG family molecular chaperone re...  95.1    5e-20   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ89114.1|  predicted protein                                    94.7    6e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89060.1|  predicted protein                                    94.7    6e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAB11054.1|  unnamed protein product                              94.7    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004974079.1|  PREDICTED: BAG family molecular chaperone re...  94.7    6e-20   Setaria italica
gb|ACU29544.1|  BCL-2-associated athanogene                           94.7    7e-20   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004515797.1|  PREDICTED: BAG family molecular chaperone re...  93.2    8e-20   
ref|NP_200019.2|  BCL-2-associated athanogene 1                       94.4    8e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392353.1|  PREDICTED: BAG family molecular chaperone re...  94.0    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007023111.1|  BCL-2-associated athanogene 1, putative          93.6    2e-19   
ref|XP_004515796.1|  PREDICTED: BAG family molecular chaperone re...  93.2    2e-19   Cicer arietinum [garbanzo]
ref|XP_011033801.1|  PREDICTED: BAG family molecular chaperone re...  93.2    2e-19   Populus euphratica
ref|XP_006280889.1|  hypothetical protein CARUB_v10026882mg           92.8    2e-19   Capsella rubella
ref|XP_009393412.1|  PREDICTED: BAG family molecular chaperone re...  92.8    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006853020.1|  hypothetical protein AMTR_s00174p00056430        90.5    3e-19   
ref|XP_011033800.1|  PREDICTED: BAG family molecular chaperone re...  92.8    4e-19   Populus euphratica
gb|EMS57176.1|  hypothetical protein TRIUR3_33832                     92.8    4e-19   Triticum urartu
ref|XP_007210065.1|  hypothetical protein PRUPE_ppa021099mg           92.4    4e-19   Prunus persica
ref|XP_008238779.1|  PREDICTED: BAG family molecular chaperone re...  92.0    5e-19   Prunus mume [ume]
gb|ABK26055.1|  unknown                                               91.3    6e-19   Picea sitchensis
ref|XP_010052010.1|  PREDICTED: BAG family molecular chaperone re...  92.0    6e-19   Eucalyptus grandis [rose gum]
ref|XP_006399203.1|  hypothetical protein EUTSA_v10014190mg           91.3    9e-19   
ref|XP_011073883.1|  PREDICTED: BAG family molecular chaperone re...  90.9    1e-18   Sesamum indicum [beniseed]
ref|XP_006369981.1|  hypothetical protein POPTR_0001s36860g           90.1    1e-18   
ref|XP_002280537.1|  PREDICTED: BAG family molecular chaperone re...  90.5    1e-18   Vitis vinifera
emb|CAN67094.1|  hypothetical protein VITISV_016805                   90.9    1e-18   Vitis vinifera
ref|NP_001292194.1|  BAG family molecular chaperone regulator 2       90.9    1e-18   Fragaria vesca [alpine strawberry]
gb|KDP25508.1|  hypothetical protein JCGZ_20664                       90.9    1e-18   Jatropha curcas
ref|XP_011085223.1|  PREDICTED: BAG family molecular chaperone re...  89.7    2e-18   Sesamum indicum [beniseed]
ref|XP_010933886.1|  PREDICTED: BAG family molecular chaperone re...  89.4    4e-18   Elaeis guineensis
gb|KCW75858.1|  hypothetical protein EUGRSUZ_D00246                   89.7    4e-18   Eucalyptus grandis [rose gum]
ref|XP_006655733.1|  PREDICTED: BAG family molecular chaperone re...  89.7    4e-18   
ref|XP_004174122.1|  PREDICTED: BAG family molecular chaperone re...  87.4    6e-18   
ref|XP_004135718.1|  PREDICTED: BAG family molecular chaperone re...  89.0    7e-18   
gb|KGN65887.1|  hypothetical protein Csa_1G537370                     88.2    9e-18   Cucumis sativus [cucumbers]
ref|XP_009377924.1|  PREDICTED: BAG family molecular chaperone re...  88.2    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_009344264.1|  PREDICTED: BAG family molecular chaperone re...  88.2    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_007041104.1|  BCL-2-associated athanogene 3                    87.8    1e-17   
ref|XP_009398731.1|  PREDICTED: BAG family molecular chaperone re...  88.2    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008371808.1|  PREDICTED: BAG family molecular chaperone re...  87.8    1e-17   Malus domestica [apple tree]
ref|XP_004964389.1|  PREDICTED: BAG family molecular chaperone re...  88.2    1e-17   Setaria italica
dbj|BAA90810.1|  BAG domain containing protein-like                   88.2    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056659.2|  Os06g0126500                                     88.2    1e-17   
ref|XP_009362271.1|  PREDICTED: BAG family molecular chaperone re...  87.4    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_010054787.1|  PREDICTED: BAG family molecular chaperone re...  84.3    2e-17   Eucalyptus grandis [rose gum]
ref|XP_010245179.1|  PREDICTED: BAG family molecular chaperone re...  87.0    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_009803851.1|  PREDICTED: BAG family molecular chaperone re...  86.7    2e-17   Nicotiana sylvestris
ref|XP_008225543.1|  PREDICTED: BAG family molecular chaperone re...  87.0    2e-17   Prunus mume [ume]
ref|XP_003574879.1|  PREDICTED: BAG family molecular chaperone re...  87.0    3e-17   Brachypodium distachyon [annual false brome]
ref|XP_009414438.1|  PREDICTED: BAG family molecular chaperone re...  87.8    4e-17   
gb|EEE65009.1|  hypothetical protein OsJ_19959                        87.0    4e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007211889.1|  hypothetical protein PRUPE_ppa010271mg           86.3    4e-17   Prunus persica
gb|KDP38026.1|  hypothetical protein JCGZ_04669                       86.3    4e-17   Jatropha curcas
ref|XP_009803850.1|  PREDICTED: BAG family molecular chaperone re...  86.3    4e-17   Nicotiana sylvestris
ref|XP_009364171.1|  PREDICTED: BAG family molecular chaperone re...  86.3    5e-17   Pyrus x bretschneideri [bai li]
gb|KCW44531.1|  hypothetical protein EUGRSUZ_L01966                   85.9    5e-17   Eucalyptus grandis [rose gum]
gb|KHN06956.1|  BAG family molecular chaperone regulator 2            85.5    7e-17   Glycine soja [wild soybean]
ref|XP_006448982.1|  hypothetical protein CICLE_v10016355mg           85.1    9e-17   
ref|NP_001149344.1|  protein binding protein                          85.5    1e-16   
ref|XP_008444790.1|  PREDICTED: BAG family molecular chaperone re...  85.1    1e-16   Cucumis melo [Oriental melon]
ref|XP_002973687.1|  hypothetical protein SELMODRAFT_99632            85.1    1e-16   
ref|XP_010041222.1|  PREDICTED: BAG family molecular chaperone re...  85.1    1e-16   Eucalyptus grandis [rose gum]
ref|XP_003542946.1|  PREDICTED: BAG family molecular chaperone re...  84.7    1e-16   Glycine max [soybeans]
ref|XP_009605457.1|  PREDICTED: BAG family molecular chaperone re...  85.1    1e-16   Nicotiana tomentosiformis
gb|ACN25625.1|  unknown                                               85.5    1e-16   Zea mays [maize]
dbj|BAB10172.1|  unnamed protein product                              85.1    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003546074.1|  PREDICTED: BAG family molecular chaperone re...  84.7    1e-16   Glycine max [soybeans]
gb|AFW86084.1|  hypothetical protein ZEAMMB73_238582                  84.0    1e-16   
ref|XP_008454738.1|  PREDICTED: BAG family molecular chaperone re...  85.1    1e-16   Cucumis melo [Oriental melon]
ref|XP_010275914.1|  PREDICTED: BAG family molecular chaperone re...  84.7    2e-16   Nelumbo nucifera [Indian lotus]
ref|XP_009407955.1|  PREDICTED: BAG family molecular chaperone re...  84.7    2e-16   
ref|XP_006448983.1|  hypothetical protein CICLE_v10016355mg           84.3    2e-16   Citrus clementina [clementine]
ref|XP_002436384.1|  hypothetical protein SORBIDRAFT_10g001600        84.7    2e-16   Sorghum bicolor [broomcorn]
ref|XP_009407954.1|  PREDICTED: BAG family molecular chaperone re...  84.3    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009339651.1|  PREDICTED: BAG family molecular chaperone re...  84.0    3e-16   Pyrus x bretschneideri [bai li]
ref|NP_001151280.1|  protein binding protein                          84.0    4e-16   
gb|EYU43246.1|  hypothetical protein MIMGU_mgv1a012035mg              83.2    6e-16   Erythranthe guttata [common monkey flower]
ref|XP_002509707.1|  protein binding protein, putative                82.8    7e-16   
ref|XP_004165671.1|  PREDICTED: BAG family molecular chaperone re...  82.8    7e-16   
pdb|4HWI|B  Chain B, Crystal Structure Of Atbag1 In Complex With ...  81.6    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001147497.1|  protein binding protein                          82.8    9e-16   
ref|XP_008795378.1|  PREDICTED: BAG family molecular chaperone re...  82.0    1e-15   Phoenix dactylifera
ref|XP_004485986.1|  PREDICTED: BAG family molecular chaperone re...  82.0    1e-15   Cicer arietinum [garbanzo]
ref|XP_007147941.1|  hypothetical protein PHAVU_006G167400g           82.0    1e-15   Phaseolus vulgaris [French bean]
ref|XP_010086865.1|  BAG family molecular chaperone regulator 3       81.6    1e-15   
ref|XP_004142296.1|  PREDICTED: BAG family molecular chaperone re...  81.6    2e-15   
ref|XP_010941524.1|  PREDICTED: BAG family molecular chaperone re...  81.3    2e-15   Elaeis guineensis
ref|XP_010941523.1|  PREDICTED: BAG family molecular chaperone re...  81.3    2e-15   Elaeis guineensis
ref|NP_001168312.1|  protein binding protein isoform 1                81.6    2e-15   Zea mays [maize]
ref|XP_010941525.1|  PREDICTED: BAG family molecular chaperone re...  79.7    4e-15   Elaeis guineensis
ref|XP_008371654.1|  PREDICTED: BAG family molecular chaperone re...  80.5    4e-15   Malus domestica [apple tree]
ref|XP_002531057.1|  conserved hypothetical protein                   80.1    6e-15   
ref|XP_009393318.1|  PREDICTED: BAG family molecular chaperone re...  79.7    7e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006468074.1|  PREDICTED: BAG family molecular chaperone re...  79.3    9e-15   Citrus sinensis [apfelsine]
ref|XP_010922588.1|  PREDICTED: BAG family molecular chaperone re...  78.6    2e-14   
ref|XP_010922586.1|  PREDICTED: BAG family molecular chaperone re...  78.6    2e-14   Elaeis guineensis
ref|XP_009386479.1|  PREDICTED: LOW QUALITY PROTEIN: BAG family m...  78.2    2e-14   
gb|AFW85557.1|  hypothetical protein ZEAMMB73_939476                  78.2    4e-14   
ref|XP_001763281.1|  predicted protein                                76.6    8e-14   
ref|XP_010676791.1|  PREDICTED: BAG family molecular chaperone re...  76.3    1e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006440532.1|  hypothetical protein CICLE_v10021471mg           75.9    1e-13   
ref|XP_006394434.1|  hypothetical protein EUTSA_v10004705mg           76.3    1e-13   Eutrema salsugineum [saltwater cress]
ref|XP_006440533.1|  hypothetical protein CICLE_v10021471mg           75.9    2e-13   
ref|XP_006477390.1|  PREDICTED: BAG family molecular chaperone re...  75.9    2e-13   
ref|XP_008811669.1|  PREDICTED: BAG family molecular chaperone re...  75.5    2e-13   Phoenix dactylifera
ref|XP_008802415.1|  PREDICTED: BAG family molecular chaperone re...  75.5    2e-13   Phoenix dactylifera
ref|XP_010257095.1|  PREDICTED: BAG family molecular chaperone re...  75.1    2e-13   Nelumbo nucifera [Indian lotus]
gb|KEH36688.1|  BAG family molecular chaperone regulator              75.5    2e-13   Medicago truncatula
ref|XP_003561114.2|  PREDICTED: BAG family molecular chaperone re...  76.3    2e-13   
ref|XP_010444073.1|  PREDICTED: BAG family molecular chaperone re...  75.5    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_008802416.1|  PREDICTED: BAG family molecular chaperone re...  74.7    3e-13   
ref|XP_009597094.1|  PREDICTED: BAG family molecular chaperone re...  75.1    3e-13   
ref|XP_006644951.1|  PREDICTED: BAG family molecular chaperone re...  75.1    3e-13   
ref|XP_009760476.1|  PREDICTED: BAG family molecular chaperone re...  75.1    3e-13   
ref|XP_010257093.1|  PREDICTED: BAG family molecular chaperone re...  74.7    4e-13   
ref|XP_006344117.1|  PREDICTED: BAG family molecular chaperone re...  74.7    5e-13   
dbj|BAJ34177.1|  unnamed protein product                              74.7    5e-13   
gb|KJB26249.1|  hypothetical protein B456_004G233000                  74.3    6e-13   
ref|XP_009396868.1|  PREDICTED: BAG family molecular chaperone re...  73.9    6e-13   
gb|KJB26248.1|  hypothetical protein B456_004G233000                  74.3    6e-13   
ref|XP_007016932.1|  BCL-2-associated athanogene 4 isoform 1          73.6    1e-12   
ref|XP_002961906.1|  hypothetical protein SELMODRAFT_164705           73.6    1e-12   
ref|XP_010909200.1|  PREDICTED: BAG family molecular chaperone re...  73.6    1e-12   
gb|AAM63329.1|  unknown                                               73.6    1e-12   
ref|XP_010909215.1|  PREDICTED: BAG family molecular chaperone re...  73.6    1e-12   
ref|NP_190746.2|  BCL-2-associated athanogene 4                       73.6    1e-12   
gb|AAC14405.1|  unknown                                               73.6    1e-12   
gb|KHG25489.1|  BAG family molecular chaperone regulator 4            73.2    1e-12   
ref|XP_010483937.1|  PREDICTED: BAG family molecular chaperone re...  73.6    1e-12   
ref|XP_007205730.1|  hypothetical protein PRUPE_ppa010083mg           73.2    1e-12   
ref|XP_008221363.1|  PREDICTED: BAG family molecular chaperone re...  73.2    1e-12   
ref|XP_010458265.1|  PREDICTED: BAG family molecular chaperone re...  72.8    2e-12   
ref|XP_008356509.1|  PREDICTED: LOW QUALITY PROTEIN: BAG family m...  73.2    2e-12   
gb|ACL53357.1|  unknown                                               72.4    2e-12   
ref|NP_001141543.1|  BCL-2 binding anthanogene-1                      72.4    2e-12   
emb|CDX73692.1|  BnaC08g23110D                                        72.4    2e-12   
ref|XP_004240412.1|  PREDICTED: BAG family molecular chaperone re...  72.4    3e-12   
gb|KJB56241.1|  hypothetical protein B456_009G111900                  71.6    3e-12   
ref|XP_006836320.1|  hypothetical protein AMTR_s00092p00064570        71.6    3e-12   
gb|KJB56240.1|  hypothetical protein B456_009G111900                  71.6    4e-12   
ref|XP_002278599.2|  PREDICTED: BAG family molecular chaperone re...  71.6    4e-12   
emb|CBI30967.3|  unnamed protein product                              71.2    5e-12   
ref|XP_002877823.1|  hypothetical protein ARALYDRAFT_485533           71.6    5e-12   
ref|NP_001242032.1|  uncharacterized protein LOC100800041             71.2    5e-12   
ref|XP_002456583.1|  hypothetical protein SORBIDRAFT_03g038830        71.2    5e-12   
tpg|DAA48368.1|  TPA: hypothetical protein ZEAMMB73_960791            71.6    6e-12   
ref|XP_002456804.1|  hypothetical protein SORBIDRAFT_03g043180        70.1    7e-12   
ref|XP_006291668.1|  hypothetical protein CARUB_v10017833mg           71.2    7e-12   
emb|CDX78039.1|  BnaA09g32340D                                        71.2    7e-12   
dbj|BAJ93244.1|  predicted protein                                    72.4    7e-12   
ref|XP_004970973.1|  PREDICTED: BAG family molecular chaperone re...  70.1    7e-12   
ref|XP_006574436.1|  PREDICTED: uncharacterized protein LOC100800...  70.9    1e-11   
ref|XP_006852233.1|  hypothetical protein AMTR_s00049p00149150        69.3    1e-11   
ref|XP_009354037.1|  PREDICTED: BAG family molecular chaperone re...  70.5    1e-11   
ref|XP_009408266.1|  PREDICTED: BAG family molecular chaperone re...  70.5    1e-11   
ref|XP_002516645.1|  protein binding protein, putative                70.5    1e-11   
ref|XP_008344769.1|  PREDICTED: BAG family molecular chaperone re...  70.5    1e-11   
gb|KDP45733.1|  hypothetical protein JCGZ_17340                       70.1    2e-11   
ref|XP_009115880.1|  PREDICTED: BAG family molecular chaperone re...  70.1    2e-11   
ref|XP_006403882.1|  hypothetical protein EUTSA_v10010632mg           70.1    2e-11   
gb|EEC71739.1|  hypothetical protein OsI_04304                        69.7    2e-11   
ref|NP_001044700.1|  Os01g0831200                                     69.7    2e-11   
ref|XP_006843653.1|  hypothetical protein AMTR_s00007p00177030        69.7    2e-11   
ref|XP_009369637.1|  PREDICTED: BAG family molecular chaperone re...  69.7    3e-11   
ref|XP_007216075.1|  hypothetical protein PRUPE_ppa018019mg           68.6    3e-11   
ref|XP_008230479.1|  PREDICTED: BAG family molecular chaperone re...  68.6    3e-11   
tpg|DAA48369.1|  TPA: hypothetical protein ZEAMMB73_960791            70.5    3e-11   
ref|XP_006645194.1|  PREDICTED: BAG family molecular chaperone re...  68.2    3e-11   
ref|NP_001292200.1|  BAG family molecular chaperone regulator 1       69.3    4e-11   
emb|CDM85259.1|  unnamed protein product                              68.2    4e-11   
ref|XP_007142181.1|  hypothetical protein PHAVU_008G259000g           68.6    5e-11   
ref|XP_002313979.1|  BAG domain-containing family protein             68.6    6e-11   
ref|XP_006585617.1|  PREDICTED: BAG family molecular chaperone re...  67.0    7e-11   
ref|XP_003564534.1|  PREDICTED: BAG family molecular chaperone re...  68.2    8e-11   
ref|XP_009371728.1|  PREDICTED: BAG family molecular chaperone re...  67.0    8e-11   
ref|XP_008799930.1|  PREDICTED: BAG family molecular chaperone re...  67.0    9e-11   
ref|XP_006601162.1|  PREDICTED: BAG family molecular chaperone re...  67.4    1e-10   
gb|KHG02396.1|  BAG family molecular chaperone regulator 4            68.9    1e-10   
dbj|BAK07886.1|  predicted protein                                    67.8    1e-10   
ref|XP_009370325.1|  PREDICTED: BAG family molecular chaperone re...  66.6    1e-10   
emb|CDP05659.1|  unnamed protein product                              67.0    1e-10   
ref|XP_010555969.1|  PREDICTED: BAG family molecular chaperone re...  65.9    1e-10   
ref|NP_001183231.1|  hypothetical protein                             66.2    1e-10   
ref|XP_010929986.1|  PREDICTED: BAG family molecular chaperone re...  65.9    2e-10   
ref|XP_010932276.1|  PREDICTED: BAG family molecular chaperone re...  65.9    2e-10   
emb|CDM85258.1|  unnamed protein product                              65.9    2e-10   
gb|AID23888.1|  BCL-2-associated athanogene 1                         65.5    2e-10   
emb|CAI39214.1|  BCL-2 binding anthanogene-1                          66.6    2e-10   
ref|XP_004976841.1|  PREDICTED: BAG family molecular chaperone re...  67.0    2e-10   
dbj|BAK02631.1|  predicted protein                                    66.6    2e-10   
ref|XP_006357170.1|  PREDICTED: BAG family molecular chaperone re...  65.1    2e-10   
gb|AFK49147.1|  unknown                                               66.2    2e-10   
ref|XP_002271245.1|  PREDICTED: BAG family molecular chaperone re...  65.5    3e-10   
ref|XP_009403639.1|  PREDICTED: BAG family molecular chaperone re...  65.5    3e-10   
ref|XP_011003789.1|  PREDICTED: BAG family molecular chaperone re...  66.6    3e-10   
emb|CAN74116.1|  hypothetical protein VITISV_033471                   65.5    3e-10   
ref|XP_009386689.1|  PREDICTED: BAG family molecular chaperone re...  65.1    3e-10   
ref|XP_011024920.1|  PREDICTED: BAG family molecular chaperone re...  66.2    3e-10   
gb|KJB62429.1|  hypothetical protein B456_009G416600                  65.5    4e-10   
ref|XP_006284657.1|  hypothetical protein CARUB_v10005914mg           65.1    4e-10   
ref|XP_002298491.1|  BAG domain-containing family protein             66.2    4e-10   
ref|XP_002868643.1|  ubiquitin family protein                         65.1    4e-10   
ref|NP_198879.1|  ubiquitin family protein                            65.1    4e-10   
ref|XP_008379176.1|  PREDICTED: LOW QUALITY PROTEIN: BAG family m...  65.1    4e-10   
gb|EEE61706.1|  hypothetical protein OsJ_16195                        65.5    4e-10   
ref|XP_002446685.1|  hypothetical protein SORBIDRAFT_06g020550        64.7    5e-10   
ref|NP_001152106.1|  BCL-2 binding anthanogene-1                      64.7    5e-10   
ref|XP_003575290.1|  PREDICTED: BAG family molecular chaperone re...  64.7    5e-10   
ref|XP_002452395.1|  hypothetical protein SORBIDRAFT_04g025000        64.7    6e-10   
ref|XP_003564875.1|  PREDICTED: BAG family molecular chaperone re...  64.7    6e-10   
ref|XP_004142771.1|  PREDICTED: BAG family molecular chaperone re...  64.3    7e-10   
ref|XP_003623325.1|  BAG-domain protein 1 / regulator of cell death   65.1    7e-10   
ref|XP_010435999.1|  PREDICTED: BAG family molecular chaperone re...  64.3    8e-10   
ref|XP_002446684.1|  hypothetical protein SORBIDRAFT_06g020540        63.9    9e-10   
ref|XP_004976000.1|  PREDICTED: BAG family molecular chaperone re...  63.9    9e-10   
gb|KFK33088.1|  hypothetical protein AALP_AA6G329200                  63.9    9e-10   
ref|NP_001045135.1|  Os01g0907200                                     64.3    9e-10   
ref|XP_004492474.1|  PREDICTED: BAG family molecular chaperone re...  65.1    9e-10   
ref|XP_006405452.1|  hypothetical protein EUTSA_v10028263mg           63.9    9e-10   
ref|XP_009340848.1|  PREDICTED: BAG family molecular chaperone re...  63.9    1e-09   
ref|XP_010496579.1|  PREDICTED: BAG family molecular chaperone re...  63.9    1e-09   
ref|XP_010441217.1|  PREDICTED: BAG family molecular chaperone re...  63.9    1e-09   
ref|XP_008384761.1|  PREDICTED: BAG family molecular chaperone re...  65.1    1e-09   
emb|CAB51831.2|  hypothetical protein                                 65.1    1e-09   
ref|NP_001053903.1|  Os04g0619900                                     65.1    1e-09   
emb|CAH66977.1|  H0714H04.4                                           65.1    1e-09   
ref|XP_010912909.1|  PREDICTED: BAG family molecular chaperone re...  63.5    1e-09   
ref|XP_009765247.1|  PREDICTED: BAG family molecular chaperone re...  63.5    1e-09   
ref|NP_001150735.1|  BCL-2 binding anthanogene-1                      63.5    1e-09   
gb|KDO45662.1|  hypothetical protein CISIN_1g031040mg                 63.5    1e-09   
ref|XP_010248761.1|  PREDICTED: BAG family molecular chaperone re...  63.2    2e-09   
ref|XP_004952990.1|  PREDICTED: BAG family molecular chaperone re...  63.2    2e-09   
dbj|BAD82741.1|  ubiquitin-like                                       63.9    2e-09   
ref|XP_004975999.1|  PREDICTED: BAG family molecular chaperone re...  62.4    3e-09   
ref|NP_001239668.1|  uncharacterized protein LOC100815369             62.8    3e-09   
gb|KDP46364.1|  hypothetical protein JCGZ_10204                       62.4    3e-09   
ref|XP_008458851.1|  PREDICTED: BAG family molecular chaperone re...  62.4    3e-09   
ref|XP_006652427.1|  PREDICTED: BAG family molecular chaperone re...  62.4    4e-09   
ref|NP_001047327.1|  Os02g0597700                                     62.4    4e-09   
ref|XP_003580571.1|  PREDICTED: BAG family molecular chaperone re...  63.2    5e-09   
ref|XP_006647458.1|  PREDICTED: BAG family molecular chaperone re...  62.0    5e-09   
ref|NP_001151140.1|  LOC100284773                                     61.6    5e-09   
dbj|BAJ94421.1|  predicted protein                                    61.6    6e-09   
ref|XP_008668876.1|  PREDICTED: BAG family molecular chaperone re...  62.8    7e-09   
ref|XP_010529898.1|  PREDICTED: BAG family molecular chaperone re...  62.8    7e-09   
emb|CAH66973.1|  H0525D09.13                                          61.6    7e-09   
ref|XP_009758216.1|  PREDICTED: BAG family molecular chaperone re...  61.6    7e-09   
gb|EMS67916.1|  hypothetical protein TRIUR3_06970                     61.2    7e-09   
emb|CAE03140.1|  OSJNBa0081L15.2                                      61.2    8e-09   
ref|XP_006481083.1|  PREDICTED: BAG family molecular chaperone re...  62.8    8e-09   
ref|XP_003579995.1|  PREDICTED: BAG family molecular chaperone re...  61.2    9e-09   
ref|XP_004169279.1|  PREDICTED: BAG family molecular chaperone re...  62.8    9e-09   
ref|XP_009140028.1|  PREDICTED: BAG family molecular chaperone re...  60.8    1e-08   
ref|XP_002271076.1|  PREDICTED: BAG family molecular chaperone re...  62.4    1e-08   
emb|CDY70267.1|  BnaA04g27870D                                        60.8    1e-08   
ref|NP_001151656.1|  BCL-2 binding anthanogene-1                      60.8    1e-08   
ref|NP_001292198.1|  BAG family molecular chaperone regulator 4       62.8    1e-08   
ref|XP_002447113.1|  hypothetical protein SORBIDRAFT_06g028870        62.4    1e-08   
gb|KFK34422.1|  hypothetical protein AALP_AA5G142700                  62.4    1e-08   
emb|CDY36367.1|  BnaC04g32750D                                        60.5    1e-08   
ref|XP_007151583.1|  hypothetical protein PHAVU_004G059000g           60.5    1e-08   
ref|XP_010250913.1|  PREDICTED: BAG family molecular chaperone re...  60.5    1e-08   
ref|XP_006429453.1|  hypothetical protein CICLE_v10012355mg           62.4    1e-08   
ref|XP_011098993.1|  PREDICTED: BAG family molecular chaperone re...  60.5    2e-08   
ref|XP_008808169.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    2e-08   
ref|XP_008668875.1|  PREDICTED: BAG family molecular chaperone re...  62.4    2e-08   
emb|CDM85260.1|  unnamed protein product                              60.5    2e-08   
ref|XP_003618794.1|  hypothetical protein MTR_6g022040                60.1    2e-08   
gb|EMS51640.1|  hypothetical protein TRIUR3_25944                     60.1    2e-08   
emb|CDX91068.1|  BnaC02g05290D                                        59.7    2e-08   
gb|EAY86542.1|  hypothetical protein OsI_07924                        59.7    2e-08   
emb|CDX70560.1|  BnaC03g06440D                                        59.7    2e-08   
gb|EMS67915.1|  hypothetical protein TRIUR3_06969                     60.1    3e-08   
ref|XP_004489556.1|  PREDICTED: BAG family molecular chaperone re...  59.7    3e-08   
ref|XP_008465267.1|  PREDICTED: BAG family molecular chaperone re...  62.0    3e-08   
gb|KJB33891.1|  hypothetical protein B456_006G036700                  59.7    3e-08   
ref|XP_004148610.1|  PREDICTED: LOW QUALITY PROTEIN: BAG family m...  61.2    3e-08   
gb|KDP22855.1|  hypothetical protein JCGZ_00442                       61.2    3e-08   
ref|XP_009590838.1|  PREDICTED: BAG family molecular chaperone re...  59.3    3e-08   
ref|XP_003618792.1|  hypothetical protein MTR_6g022020                59.3    3e-08   
gb|AFK37645.1|  unknown                                               59.3    3e-08   
ref|XP_010111659.1|  BAG family molecular chaperone regulator 3       59.3    4e-08   
ref|XP_002871615.1|  ubiquitin family protein                         59.3    4e-08   
ref|XP_010420070.1|  PREDICTED: BAG family molecular chaperone re...  59.3    4e-08   
ref|XP_010492237.1|  PREDICTED: BAG family molecular chaperone re...  59.3    4e-08   
ref|XP_009625327.1|  PREDICTED: BAG family molecular chaperone re...  59.3    4e-08   
ref|XP_010453555.1|  PREDICTED: BAG family molecular chaperone re...  59.3    4e-08   
emb|CDM84850.1|  unnamed protein product                              60.5    4e-08   
ref|XP_009771755.1|  PREDICTED: BAG family molecular chaperone re...  60.5    5e-08   
emb|CDX85601.1|  BnaA02g02120D                                        58.9    5e-08   
gb|KHG24376.1|  BAG family molecular chaperone regulator 2            58.9    5e-08   
ref|XP_006399948.1|  hypothetical protein EUTSA_v10014879mg           58.9    5e-08   
gb|KHG25101.1|  BAG family molecular chaperone regulator 2            58.9    5e-08   
ref|XP_002526949.1|  protein binding protein, putative                58.9    5e-08   
ref|XP_009125970.1|  PREDICTED: BAG family molecular chaperone re...  58.9    5e-08   
ref|XP_009131401.1|  PREDICTED: BAG family molecular chaperone re...  58.9    5e-08   
ref|XP_006286583.1|  hypothetical protein CARUB_v10002128mg           58.9    6e-08   
ref|XP_004172227.1|  PREDICTED: BAG family molecular chaperone re...  59.3    7e-08   
ref|XP_006447218.1|  hypothetical protein CICLE_v10016973mg           58.5    7e-08   
ref|XP_010515609.1|  PREDICTED: BAG family molecular chaperone re...  59.7    9e-08   
ref|XP_009631556.1|  PREDICTED: BAG family molecular chaperone re...  59.3    1e-07   
ref|XP_011013639.1|  PREDICTED: BAG family molecular chaperone re...  58.2    1e-07   
ref|NP_196940.1|  ubiquitin-like superfamily protein                  58.2    1e-07   
ref|XP_004304688.1|  PREDICTED: BAG family molecular chaperone re...  58.2    1e-07   
gb|KGN47060.1|  hypothetical protein Csa_6G182140                     59.3    1e-07   
ref|XP_007031691.1|  Binding protein, putative                        57.8    1e-07   
gb|EMS67914.1|  hypothetical protein TRIUR3_06968                     57.8    1e-07   
gb|EYU34767.1|  hypothetical protein MIMGU_mgv1a015477mg              57.8    1e-07   
ref|XP_011097345.1|  PREDICTED: BAG family molecular chaperone re...  57.4    2e-07   
ref|XP_004143218.1|  PREDICTED: uncharacterized protein LOC101206694  60.1    2e-07   
gb|KJB11589.1|  hypothetical protein B456_001G267400                  57.4    2e-07   
gb|KHN27583.1|  BAG family molecular chaperone regulator 2            57.0    2e-07   
emb|CDP16633.1|  unnamed protein product                              57.4    2e-07   
gb|EMT24660.1|  hypothetical protein F775_43089                       56.6    3e-07   
ref|XP_010033352.1|  PREDICTED: BAG family molecular chaperone re...  56.6    3e-07   
ref|XP_003547687.2|  PREDICTED: BAG family molecular chaperone re...  57.8    3e-07   
ref|XP_007026621.1|  BCL-2-associated athanogene 4, putative isof...  58.5    3e-07   
ref|XP_007140853.1|  hypothetical protein PHAVU_008G147200g           56.2    4e-07   
ref|XP_007140228.1|  hypothetical protein PHAVU_008G095000g           57.0    5e-07   
gb|EMT19876.1|  hypothetical protein F775_42472                       55.5    5e-07   
ref|XP_004231825.1|  PREDICTED: BAG family molecular chaperone re...  55.5    7e-07   
ref|XP_002300070.1|  hypothetical protein POPTR_0001s36000g           55.5    8e-07   
ref|XP_006338639.1|  PREDICTED: BAG family molecular chaperone re...  55.1    1e-06   
ref|XP_010550176.1|  PREDICTED: BAG family molecular chaperone re...  54.7    1e-06   
ref|XP_011010945.1|  PREDICTED: BAG family molecular chaperone re...  55.1    1e-06   
ref|XP_008668131.1|  PREDICTED: BCL-2 binding anthanogene-1 isofo...  55.1    1e-06   
ref|XP_004970452.1|  PREDICTED: BAG family molecular chaperone re...  55.5    2e-06   
gb|KFK25675.1|  hypothetical protein AALP_AA8G144800                  53.5    4e-06   
ref|XP_006604113.1|  PREDICTED: BAG family molecular chaperone re...  53.1    5e-06   
emb|CBI15919.3|  unnamed protein product                              54.3    6e-06   
gb|KCW49435.1|  hypothetical protein EUGRSUZ_K02967                   53.9    6e-06   



>ref|XP_009768860.1| PREDICTED: BAG family molecular chaperone regulator 2 [Nicotiana 
sylvestris]
Length=341

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 80/99 (81%), Gaps = 8/99 (8%)
 Frame = +1

Query  274  MLRMKTKTTS--------PaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRV  429
            M+RMKTKTT+         A      + NEWE+RPGGMLVQKR+PDSEN PPPP IRVRV
Sbjct  1    MMRMKTKTTAVPPMMNGASAVGRDRATENEWEVRPGGMLVQKRNPDSENRPPPPTIRVRV  60

Query  430  KYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            KYGSIYHEI+IS+QATFGELKKMLTGPTG+HH+D KLL+
Sbjct  61   KYGSIYHEINISAQATFGELKKMLTGPTGLHHQDQKLLY  99



>ref|XP_009615951.1| PREDICTED: BAG family molecular chaperone regulator 1 [Nicotiana 
tomentosiformis]
Length=341

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 80/99 (81%), Gaps = 8/99 (8%)
 Frame = +1

Query  274  MLRMKTKTTS--------PaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRV  429
            M+RMKTKTT+         A      + NEWE+RPGGMLVQKR+PDSEN PPPP IRVRV
Sbjct  1    MMRMKTKTTAVPPMMNGASAVGRDRATENEWEVRPGGMLVQKRNPDSENRPPPPTIRVRV  60

Query  430  KYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            KYGSIYHEI+IS+QATFGELKKMLTGPTG+HH+D KLL+
Sbjct  61   KYGSIYHEINISAQATFGELKKMLTGPTGLHHQDQKLLY  99



>ref|XP_009608641.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009608642.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Nicotiana 
tomentosiformis]
Length=323

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 75/94 (80%), Gaps = 3/94 (3%)
 Frame = +1

Query  274  MLRMKTKTTSP---aaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSI  444
            M++MKTKTT        +   S  EWE+RP GMLVQKR+PD EN PPPP IRVRVKY SI
Sbjct  1    MMQMKTKTTGMPPMMNGSSDASEKEWELRPSGMLVQKRNPDCENCPPPPTIRVRVKYHSI  60

Query  445  YHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            YHEI+ISSQATFGELKKMLTGPTG+HH+D KLL+
Sbjct  61   YHEINISSQATFGELKKMLTGPTGLHHQDQKLLY  94



>ref|XP_009774065.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Nicotiana 
sylvestris]
 ref|XP_009774066.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Nicotiana 
sylvestris]
Length=323

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 75/94 (80%), Gaps = 3/94 (3%)
 Frame = +1

Query  274  MLRMKTKTTSP---aaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSI  444
            M++MKTKTT        +      EWE+RP GMLVQKR+PDSEN PPPP IRVRVKY SI
Sbjct  1    MMQMKTKTTGMPPMMNGSSDAGEKEWELRPSGMLVQKRNPDSENRPPPPTIRVRVKYHSI  60

Query  445  YHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            YHEI+ISSQATFGELKKMLTGPTG+HH+D KLL+
Sbjct  61   YHEINISSQATFGELKKMLTGPTGLHHQDQKLLY  94



>ref|XP_006340523.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Solanum 
tuberosum]
Length=333

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 78/94 (83%), Gaps = 3/94 (3%)
 Frame = +1

Query  274  MLRMKTKTT---SPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSI  444
            M+ MKT+TT   S    +  GS NEWE+RP GMLVQKR+PDSEN PPPP IRVRVKY S+
Sbjct  1    MMGMKTRTTGMPSIMKGSSVGSENEWELRPSGMLVQKRNPDSENRPPPPTIRVRVKYRSV  60

Query  445  YHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            YHEI+ISSQATFGELKKML+GPTG+HHED KLL+
Sbjct  61   YHEINISSQATFGELKKMLSGPTGLHHEDQKLLY  94



>ref|XP_007038591.1| BCL-2-associated athanogene 3 [Theobroma cacao]
 gb|EOY23092.1| BCL-2-associated athanogene 3 [Theobroma cacao]
Length=354

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 83/100 (83%), Gaps = 9/100 (9%)
 Frame = +1

Query  274  MLRMKTKTT--SPaaanggg------sanEWEMRPGGMLVQKRSPDSE-NLPPPPNIRVR  426
            M+RMKTK T  SP    GGG      +A++WE+RPGGMLVQKRSPDS+ +  PPPNIRVR
Sbjct  1    MMRMKTKATGLSPVTNGGGGGGGGEPAAHDWELRPGGMLVQKRSPDSDRSTIPPPNIRVR  60

Query  427  VKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            VKYGSIYHEISI+SQATFGELKKMLTGPTG+HH+D KLL+
Sbjct  61   VKYGSIYHEISINSQATFGELKKMLTGPTGLHHQDQKLLY  100



>ref|XP_004234356.1| PREDICTED: BAG family molecular chaperone regulator 1 [Solanum 
lycopersicum]
Length=341

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 79/100 (79%), Gaps = 9/100 (9%)
 Frame = +1

Query  274  MLRMKTKTT---------SPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVR  426
            M+RMKTKTT         S    +   + NEWE+RPGGMLVQKR+PD+EN PPPP IRVR
Sbjct  1    MMRMKTKTTAMPPMMNDNSAGGRDRAAADNEWEVRPGGMLVQKRNPDAENRPPPPPIRVR  60

Query  427  VKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            VKYGSIYHEI+IS QATFGELKKMLTGPTG+HH+D KLL+
Sbjct  61   VKYGSIYHEINISPQATFGELKKMLTGPTGLHHQDQKLLY  100



>emb|CDP10646.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   128 bits (321),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            +WEMRPGGMLVQKR+   +NLPPPP IRVRVK+G++YHE++ISSQATFGELKKMLTGPTG
Sbjct  36   DWEMRPGGMLVQKRTSSDQNLPPPPTIRVRVKHGAVYHELNISSQATFGELKKMLTGPTG  95

Query  517  MHHEDXKLLF  546
            +HHED KL+F
Sbjct  96   LHHEDQKLIF  105



>ref|XP_007218234.1| hypothetical protein PRUPE_ppa007973mg [Prunus persica]
 gb|EMJ19433.1| hypothetical protein PRUPE_ppa007973mg [Prunus persica]
Length=350

 Score =   128 bits (321),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 80/101 (79%), Gaps = 10/101 (10%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsa---------nEWEMRPGGMLVQKRSPDSE-NLPPPPNIRV  423
            M+RMKTKTT  A +   GS+          EWE+RPGGMLVQKR+PDS+ N+ PPP IRV
Sbjct  1    MMRMKTKTTGVALSELNGSSGSGGNESGPAEWELRPGGMLVQKRNPDSDRNIAPPPTIRV  60

Query  424  RVKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            RVKYGSIYHEI+IS+Q++FG+LKKML GPTG+HH+D KL+F
Sbjct  61   RVKYGSIYHEINISAQSSFGDLKKMLAGPTGLHHQDQKLIF  101



>ref|XP_006490329.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Citrus 
sinensis]
 gb|KDO60094.1| hypothetical protein CISIN_1g018493mg [Citrus sinensis]
Length=355

 Score =   128 bits (321),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 8/99 (8%)
 Frame = +1

Query  274  MLRMKT-KTTSPa------aangggsanEWEMRPGGMLVQKRSPDSENL-PPPPNIRVRV  429
            M+RMKT KTT P+        +   +A+EWE+RPGGMLVQKR+PDS+    PPP IRVRV
Sbjct  1    MMRMKTSKTTGPSPMATMNGGSAEAAAHEWELRPGGMLVQKRNPDSDRTSAPPPTIRVRV  60

Query  430  KYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            KYGSIYHEI I+SQATFGELKK+LTGPTG+HHED KL++
Sbjct  61   KYGSIYHEIHINSQATFGELKKLLTGPTGLHHEDQKLIY  99



>ref|XP_006421855.1| hypothetical protein CICLE_v10005288mg [Citrus clementina]
 gb|ESR35095.1| hypothetical protein CICLE_v10005288mg [Citrus clementina]
Length=355

 Score =   128 bits (321),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 8/99 (8%)
 Frame = +1

Query  274  MLRMKT-KTTSPa------aangggsanEWEMRPGGMLVQKRSPDSENL-PPPPNIRVRV  429
            M+RMKT KTT P+        +   +A+EWE+RPGGMLVQKR+PDS+    PPP IRVRV
Sbjct  1    MMRMKTSKTTGPSPMAMMNGGSAEAAAHEWELRPGGMLVQKRNPDSDRTSAPPPTIRVRV  60

Query  430  KYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            KYGSIYHEI I+SQATFGELKK+LTGPTG+HHED KL++
Sbjct  61   KYGSIYHEIHINSQATFGELKKLLTGPTGLHHEDQKLIY  99



>ref|XP_008377120.1| PREDICTED: BAG family molecular chaperone regulator 1 [Malus 
domestica]
 ref|XP_008377127.1| PREDICTED: BAG family molecular chaperone regulator 1 [Malus 
domestica]
Length=338

 Score =   127 bits (320),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 79/101 (78%), Gaps = 10/101 (10%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsan---------EWEMRPGGMLVQKRSPDSE-NLPPPPNIRV  423
            M+RMKTKTT  + A   GS+          EWE+RPGGMLVQKR+PDS+ N  PPP IRV
Sbjct  1    MMRMKTKTTGVSLAELNGSSGGGGAESGQGEWELRPGGMLVQKRNPDSDRNSAPPPTIRV  60

Query  424  RVKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            RVKYGSIYHE+SIS+Q++FG+LKKML GPTG+HHED KL+F
Sbjct  61   RVKYGSIYHEMSISAQSSFGDLKKMLVGPTGLHHEDQKLIF  101



>ref|XP_008376529.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Malus 
domestica]
Length=338

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 10/101 (10%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsan---------EWEMRPGGMLVQKRSPDSE-NLPPPPNIRV  423
            M+RMKTKTT  + A   G +          EWE+RPGGMLVQKR+PDS+ N  PPP IRV
Sbjct  1    MMRMKTKTTGVSLAELNGRSGGGGADSGQGEWELRPGGMLVQKRNPDSDRNSVPPPTIRV  60

Query  424  RVKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            RVKYGSIYHEISIS+Q++FG+LKKML GPTG+HH+D KL+F
Sbjct  61   RVKYGSIYHEISISAQSSFGDLKKMLVGPTGLHHQDQKLIF  101



>gb|ADW66455.1| BCL-2-associated athanogene [Malus hupehensis]
Length=338

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 10/101 (10%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsan---------EWEMRPGGMLVQKRSPDSE-NLPPPPNIRV  423
            M+RMKTKTT  + A   G +          EWE+RPGGMLVQKR+PDS+ N  PPP IRV
Sbjct  1    MMRMKTKTTGVSLAELNGRSGGGGADSGQGEWELRPGGMLVQKRNPDSDRNSVPPPTIRV  60

Query  424  RVKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            RVKYGSIYHEISIS+Q++FG+LKKML GPTG+HH+D KL+F
Sbjct  61   RVKYGSIYHEISISAQSSFGDLKKMLVGPTGLHHQDQKLIF  101



>ref|XP_008234288.1| PREDICTED: BAG family molecular chaperone regulator 1 [Prunus 
mume]
Length=354

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 80/101 (79%), Gaps = 10/101 (10%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsa---------nEWEMRPGGMLVQKRSPDSE-NLPPPPNIRV  423
            M+RMKTKTT  A +   GS+          EWE+RPGGMLVQKR+PDS+ N+ PPP IRV
Sbjct  1    MMRMKTKTTGVALSELNGSSGSGGNESGPAEWELRPGGMLVQKRNPDSDRNMAPPPTIRV  60

Query  424  RVKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            RVKYGSIYHEI+IS+Q++FG+LKKML GPTG+HH+D KL+F
Sbjct  61   RVKYGSIYHEINISAQSSFGDLKKMLAGPTGLHHQDQKLIF  101



>gb|KHG08052.1| BAG family molecular chaperone regulator 3 [Gossypium arboreum]
Length=312

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 3/94 (3%)
 Frame = +1

Query  274  MLRMKTK-TTSPaaangggsanEWEMRPGGMLVQKRSPDSENL--PPPPNIRVRVKYGSI  444
            M+RMKTK T +         A EWE+RPGGMLVQKR PDS+ +  PP P IRV+VKYGSI
Sbjct  1    MMRMKTKPTAATFNGGCEPVAREWELRPGGMLVQKRHPDSDQITIPPAPTIRVKVKYGSI  60

Query  445  YHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            YH+I+I+SQATFGELKKMLTGPTG+HH+D KL++
Sbjct  61   YHQININSQATFGELKKMLTGPTGLHHKDQKLIY  94



>ref|NP_001292195.1| BAG family molecular chaperone regulator 3 [Fragaria vesca]
 gb|AFK10143.1| BAG protein [Fragaria vesca]
Length=346

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 79/103 (77%), Gaps = 12/103 (12%)
 Frame = +1

Query  274  MLRMKTKTTS-----------PaaangggsanEWEMRPGGMLVQKRSPDSE-NLPPPPNI  417
            M+RMK KT+S            + A   G A EWE+RPGGMLVQKR+PDS+ N+ PPP I
Sbjct  1    MMRMKNKTSSGVEVPFSSMNGSSGAAESGPAGEWEVRPGGMLVQKRNPDSDRNVAPPPTI  60

Query  418  RVRVKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            RVRVK+GS+YHEISIS+QA+FGELKKML GPTG+HH+D KL+F
Sbjct  61   RVRVKHGSVYHEISISAQASFGELKKMLVGPTGLHHQDQKLIF  103



>gb|KJB39387.1| hypothetical protein B456_007G010400 [Gossypium raimondii]
Length=312

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 3/94 (3%)
 Frame = +1

Query  274  MLRMKTK-TTSPaaangggsanEWEMRPGGMLVQKRSPDSENL--PPPPNIRVRVKYGSI  444
            M+RMKTK T +     G   A EWE+RPGGMLVQKR+PDS+ +  PP P IRV+VK+GSI
Sbjct  1    MMRMKTKPTAATFKGGGEPVAREWELRPGGMLVQKRNPDSDQITIPPAPTIRVKVKHGSI  60

Query  445  YHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            YH+I+I+SQATFGELKKMLTGPTG+HH+D KL++
Sbjct  61   YHQININSQATFGELKKMLTGPTGLHHKDQKLIY  94



>ref|XP_009371286.1| PREDICTED: BAG family molecular chaperone regulator 1 [Pyrus 
x bretschneideri]
 ref|XP_009371287.1| PREDICTED: BAG family molecular chaperone regulator 1 [Pyrus 
x bretschneideri]
Length=338

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 74/101 (73%), Gaps = 10/101 (10%)
 Frame = +1

Query  274  MLRMKTKTT---------SPaaangggsanEWEMRPGGMLVQKRSPDSE-NLPPPPNIRV  423
            M+RMKTK T         S           EWE+RPGGMLVQKR+PDS+ N  PPP IRV
Sbjct  1    MMRMKTKITGVSLAELNGSSGGGEADSGQGEWELRPGGMLVQKRNPDSDRNSVPPPTIRV  60

Query  424  RVKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            RVK+GSIYHEISIS+Q++FG+LKKML GPTG+HH+D KL+F
Sbjct  61   RVKHGSIYHEISISAQSSFGDLKKMLVGPTGLHHQDQKLIF  101



>ref|XP_010107398.1| BAG family molecular chaperone regulator 1 [Morus notabilis]
 gb|EXC15936.1| BAG family molecular chaperone regulator 1 [Morus notabilis]
Length=369

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 75/98 (77%), Gaps = 7/98 (7%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsa-------nEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVK  432
            M++M+TKTT  +  NGG +        +EWEMRPGGMLVQKR+   +N  PPP IRVRVK
Sbjct  1    MMKMRTKTTGISQINGGSAGGGAESTPSEWEMRPGGMLVQKRNDSDQNSAPPPTIRVRVK  60

Query  433  YGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            YGS YHEI ISSQATFGELKKML GPTG+HH+D KL++
Sbjct  61   YGSTYHEIHISSQATFGELKKMLVGPTGLHHQDQKLIY  98



>gb|KHG18670.1| BAG family molecular chaperone regulator 1 [Gossypium arboreum]
Length=338

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 77/98 (79%), Gaps = 7/98 (7%)
 Frame = +1

Query  274  MLRMKTKTT------SPaaangggsanEWEMRPGGMLVQKRSPDSE-NLPPPPNIRVRVK  432
            M+R+KTK T      S     G  +A++ E+RPGGMLVQKR+P S+ N  PPP IRVRVK
Sbjct  1    MMRVKTKATGLAPVASGGGGRGESAAHDLELRPGGMLVQKRNPASDRNSIPPPTIRVRVK  60

Query  433  YGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            YGSIYHEISISSQATFGELKKMLTGPTG+HH+D KLL+
Sbjct  61   YGSIYHEISISSQATFGELKKMLTGPTGLHHQDQKLLY  98



>gb|EYU25059.1| hypothetical protein MIMGU_mgv1a010635mg [Erythranthe guttata]
Length=306

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 64/72 (89%), Gaps = 3/72 (4%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLP--PPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKR+ D+EN P  PPPNIRVRVKYGSIYHEI ISSQATFGELKK LTGP
Sbjct  30   EWELRPGGMLVQKRT-DAENNPAAPPPNIRVRVKYGSIYHEIHISSQATFGELKKKLTGP  88

Query  511  TGMHHEDXKLLF  546
            TG+HHED KL +
Sbjct  89   TGLHHEDQKLYY  100



>ref|XP_004169255.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Cucumis 
sativus]
Length=242

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR+   +N    PN+RVRVKYGS+YHEISISSQATFGELKKML G TG
Sbjct  27   EWEMRPGGMLVQKRTESEKNSVSAPNVRVRVKYGSVYHEISISSQATFGELKKMLVGATG  86

Query  517  MHHEDXKLLF  546
            +H ED KL++
Sbjct  87   LHQEDQKLIY  96



>ref|XP_010321994.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Solanum 
lycopersicum]
 ref|XP_010321995.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Solanum 
lycopersicum]
Length=333

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = +1

Query  274  MLRMKTKTTS---PaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSI  444
            M+ MKT+TT           GS NEWE+RP GMLVQKR+ DSEN  PPP IRVRVKY S+
Sbjct  1    MMGMKTRTTGMPPIMNGGSVGSENEWELRPSGMLVQKRNLDSENRRPPPTIRVRVKYRSV  60

Query  445  YHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
             HEI+ISSQATFGELKKML+GPTG+HHED KLL+
Sbjct  61   NHEINISSQATFGELKKMLSGPTGLHHEDQKLLY  94



>gb|KJB23928.1| hypothetical protein B456_004G121700 [Gossypium raimondii]
Length=337

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 79/98 (81%), Gaps = 7/98 (7%)
 Frame = +1

Query  274  MLRMKTKTT--SPaaa----ngggsanEWEMRPGGMLVQKRSPDSE-NLPPPPNIRVRVK  432
            M+R+KTK T  +P A      G  +A++ E+RPGGMLVQKR+PDS+ N  PPP IRVRVK
Sbjct  1    MMRVKTKATGLAPVANGGGGRGESAAHDLELRPGGMLVQKRNPDSDRNSIPPPTIRVRVK  60

Query  433  YGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            YGSIYHEISISSQATFGELKKMLT PTG+HH+D KLL+
Sbjct  61   YGSIYHEISISSQATFGELKKMLTVPTGLHHQDQKLLY  98



>ref|XP_011076229.1| PREDICTED: LOW QUALITY PROTEIN: BAG family molecular chaperone 
regulator 2 [Sesamum indicum]
Length=349

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE+RPGGMLVQKR+   +N  PPP IRVRVKYGSIYHEI I+SQATFGELKKMLTGPTG
Sbjct  39   EWELRPGGMLVQKRTDVDQNRVPPPTIRVRVKYGSIYHEIRINSQATFGELKKMLTGPTG  98

Query  517  MHHEDXKLLF  546
            +HH+D KL +
Sbjct  99   LHHQDQKLFY  108



>ref|XP_006353366.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Solanum 
tuberosum]
Length=341

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 80/100 (80%), Gaps = 9/100 (9%)
 Frame = +1

Query  274  MLRMKTKTT---------SPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVR  426
            M+RMKTKTT         S A  +   + NEWE+RPGGMLVQKR+PDSEN PPPP IR+R
Sbjct  1    MMRMKTKTTAMPPMMHDNSAAGRDRTAADNEWEVRPGGMLVQKRNPDSENRPPPPPIRIR  60

Query  427  VKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            VKYGSIYHEI+IS QATFGELKKMLTGPTG+HH+D KLL+
Sbjct  61   VKYGSIYHEINISPQATFGELKKMLTGPTGLHHQDQKLLY  100



>ref|XP_002510840.1| protein binding protein, putative [Ricinus communis]
 gb|EEF51442.1| protein binding protein, putative [Ricinus communis]
Length=353

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLP-PPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGMLVQKR+PDS+     PP IRVRVKYGS YHE+SISSQATFGELKKMLTGPT
Sbjct  37   EWELRPGGMLVQKRTPDSDRSSISPPTIRVRVKYGSTYHELSISSQATFGELKKMLTGPT  96

Query  514  GMHHEDXKLLF  546
            G++HED KL+F
Sbjct  97   GLNHEDQKLIF  107



>ref|XP_006401868.1| hypothetical protein EUTSA_v10014030mg [Eutrema salsugineum]
 gb|ESQ43321.1| hypothetical protein EUTSA_v10014030mg [Eutrema salsugineum]
Length=339

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 65/72 (90%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE--NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            +WEMRPGGMLVQKR+PDS+    PPPP IRVR+KYGS+YHEI+IS QA+FGELKKML+GP
Sbjct  36   DWEMRPGGMLVQKRNPDSDPVGAPPPPMIRVRIKYGSVYHEITISPQASFGELKKMLSGP  95

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  96   TGIHHQDQKLMY  107



>ref|XP_011041640.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Populus 
euphratica]
Length=357

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 77/97 (79%), Gaps = 6/97 (6%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsan-----EWEMRPGGMLVQKRSPDSENLP-PPPNIRVRVKY  435
            M+RMKT  T+  +   GGSA      EWE+RPGGMLVQKRSPDS+    PPP IRV+VKY
Sbjct  1    MMRMKTAKTTGLSQMNGGSAGGGAGGEWEVRPGGMLVQKRSPDSDRTSIPPPTIRVKVKY  60

Query  436  GSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            GS +HEI+ISSQATFGELKKML+GPTG+HH+D KL++
Sbjct  61   GSTHHEINISSQATFGELKKMLSGPTGLHHQDQKLIY  97



>ref|XP_002321874.2| hypothetical protein POPTR_0015s13910g [Populus trichocarpa]
 gb|EEF06001.2| hypothetical protein POPTR_0015s13910g [Populus trichocarpa]
Length=357

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 77/97 (79%), Gaps = 6/97 (6%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsan-----EWEMRPGGMLVQKRSPDSENLP-PPPNIRVRVKY  435
            M+RMKT  T+  +   GGSA      EWE+RPGGMLVQKRSPDS+    PPP IRV+VKY
Sbjct  1    MMRMKTAKTTGLSQMNGGSAGGGAGGEWEVRPGGMLVQKRSPDSDRTSIPPPTIRVKVKY  60

Query  436  GSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            GS +HEI+ISSQATFGELKKML+GPTG+HH+D KL++
Sbjct  61   GSTHHEINISSQATFGELKKMLSGPTGLHHQDQKLIY  97



>gb|KDP22324.1| hypothetical protein JCGZ_26155 [Jatropha curcas]
Length=331

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLP-PPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGMLVQKR+P+S+    PPP IRVRVKYGS YH+I+ISSQATFGELKK+LTGPT
Sbjct  32   EWELRPGGMLVQKRNPNSDRSSIPPPTIRVRVKYGSAYHQINISSQATFGELKKLLTGPT  91

Query  514  GMHHEDXKLLF  546
            G+HH+D KL+F
Sbjct  92   GLHHQDQKLIF  102



>ref|XP_010537211.1| PREDICTED: BAG family molecular chaperone regulator 1 isoform 
X2 [Tarenaya hassleriana]
Length=330

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 7/98 (7%)
 Frame = +1

Query  274  MLRMKTKTTS------PaaangggsanEWEMRPGGMLVQKRSPDSENL-PPPPNIRVRVK  432
            ML+M++K ++      P  A G    N+WEMRPGGMLVQKR+PDS+ +  PPP IRVR+K
Sbjct  1    MLKMRSKPSTLSPAMVPGGAGGDSGGNDWEMRPGGMLVQKRNPDSDRVGAPPPPIRVRIK  60

Query  433  YGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            YGS+YHEI IS QATFGELKKML+GPTG+HH+D K+++
Sbjct  61   YGSVYHEIKISPQATFGELKKMLSGPTGLHHQDQKIMY  98



>emb|CBI31837.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLP-PPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGMLVQ+R PDS+    P P IRVRVK+GSIYHEI ISSQATFGELKKML+GPT
Sbjct  29   EWELRPGGMLVQRRDPDSDRSSVPAPTIRVRVKFGSIYHEIYISSQATFGELKKMLSGPT  88

Query  514  GMHHEDXKLLF  546
            G+HH+D KLLF
Sbjct  89   GLHHQDQKLLF  99



>ref|XP_010537209.1| PREDICTED: BAG family molecular chaperone regulator 1 isoform 
X1 [Tarenaya hassleriana]
Length=335

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 7/98 (7%)
 Frame = +1

Query  274  MLRMKTKTTS------PaaangggsanEWEMRPGGMLVQKRSPDSENL-PPPPNIRVRVK  432
            ML+M++K ++      P  A G    N+WEMRPGGMLVQKR+PDS+ +  PPP IRVR+K
Sbjct  1    MLKMRSKPSTLSPAMVPGGAGGDSGGNDWEMRPGGMLVQKRNPDSDRVGAPPPPIRVRIK  60

Query  433  YGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            YGS+YHEI IS QATFGELKKML+GPTG+HH+D K+++
Sbjct  61   YGSVYHEIKISPQATFGELKKMLSGPTGLHHQDQKIMY  98



>ref|XP_010519233.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Tarenaya 
hassleriana]
Length=348

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 74/98 (76%), Gaps = 7/98 (7%)
 Frame = +1

Query  274  MLRMKTK-TTSP-----aaangggsanEWEMRPGGMLVQKRSPDSENLPPP-PNIRVRVK  432
            ML+M+TK TT P         G    +EWEMRPGGMLVQKR PDS+    P P IRVR+K
Sbjct  1    MLKMRTKPTTLPPALTHGGGGGDSVGHEWEMRPGGMLVQKRKPDSDQAGAPRPTIRVRIK  60

Query  433  YGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            YGS+YHEI+IS QATFGELKKML+GPTG+HH+D K+L+
Sbjct  61   YGSVYHEINISPQATFGELKKMLSGPTGLHHQDQKILY  98



>ref|XP_010035095.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Eucalyptus 
grandis]
 ref|XP_010035096.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Eucalyptus 
grandis]
 ref|XP_010035097.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Eucalyptus 
grandis]
 gb|KCW46390.1| hypothetical protein EUGRSUZ_K00225 [Eucalyptus grandis]
Length=363

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN--LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWEMRPGGMLVQKR+  S++   PPPP IRVRVK+GS YHE+SI+SQATFGELKKMLTGP
Sbjct  32   EWEMRPGGMLVQKRNAGSDHGLAPPPPTIRVRVKHGSTYHEMSINSQATFGELKKMLTGP  91

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL+F
Sbjct  92   TGLHHQDQKLIF  103



>emb|CDP09089.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTGM  519
            WEMRPGGMLVQ R+   +  PPPP IRVRVKYGS+YHEI+ISSQ++FGELKKML+GPTG+
Sbjct  37   WEMRPGGMLVQMRTDSDQYRPPPPTIRVRVKYGSVYHEINISSQSSFGELKKMLSGPTGL  96

Query  520  HHEDXKLLF  546
            HH+D KLLF
Sbjct  97   HHQDQKLLF  105



>ref|XP_008439171.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Cucumis 
melo]
Length=340

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 74/98 (76%), Gaps = 6/98 (6%)
 Frame = +1

Query  271  RMLRMKTKTTSPaaangggsa-----nEWEMRPGGMLVQKRSPDSEN-LPPPPNIRVRVK  432
            +++++KTKTT  +   G  +       +WE+RPGGMLVQKR+PDS+    P P IRV+VK
Sbjct  3    KLMKLKTKTTEMSEMKGSSTVGDNRPMDWELRPGGMLVQKRTPDSDTESTPAPMIRVKVK  62

Query  433  YGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            Y S YHEISISSQATFGELKKML GPTG+HH+D KLLF
Sbjct  63   YDSTYHEISISSQATFGELKKMLVGPTGLHHQDQKLLF  100



>emb|CDY27085.1| BnaA02g11050D [Brassica napus]
Length=327

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 65/72 (90%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE--NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            +WEMRPGGMLVQKR+PDS+    PPPP IRV++KYGS+YHE+SIS QA+FGELKKML+GP
Sbjct  25   DWEMRPGGMLVQKRNPDSDPVGAPPPPMIRVKIKYGSLYHEMSISPQASFGELKKMLSGP  84

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  85   TGIHHQDQKLMY  96



>ref|XP_009127257.1| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X2 [Brassica rapa]
 ref|XP_009127258.1| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X3 [Brassica rapa]
Length=328

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 65/72 (90%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE--NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            +WEMRPGGMLVQKR+PDS+    PPPP IRV++KYGS+YHE+SIS QA+FGELKKML+GP
Sbjct  25   DWEMRPGGMLVQKRNPDSDPVGAPPPPMIRVKIKYGSLYHEMSISPQASFGELKKMLSGP  84

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  85   TGIHHQDQKLMY  96



>ref|XP_004143625.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Cucumis 
sativus]
 gb|KGN50430.1| hypothetical protein Csa_5G174560 [Cucumis sativus]
Length=328

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR+   +N    PN+RVRVKYGS+YHEISISSQATFGELKKML G TG
Sbjct  30   EWEMRPGGMLVQKRTESEKNSVSAPNVRVRVKYGSVYHEISISSQATFGELKKMLVGATG  89

Query  517  MHHEDXKLLF  546
            +H ED KL++
Sbjct  90   LHQEDQKLIY  99



>ref|XP_002279827.1| PREDICTED: BAG family molecular chaperone regulator 1 [Vitis 
vinifera]
Length=343

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLP-PPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGMLVQ+R PDS+    P P IRVRVK+GSIYHEI ISSQATFGELKKML+GPT
Sbjct  29   EWELRPGGMLVQRRDPDSDRSSVPAPTIRVRVKFGSIYHEIYISSQATFGELKKMLSGPT  88

Query  514  GMHHEDXKLLF  546
            G+HH+D KLLF
Sbjct  89   GLHHQDQKLLF  99



>emb|CAN63593.1| hypothetical protein VITISV_023247 [Vitis vinifera]
Length=343

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLP-PPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGMLVQ+R PDS+    P P IRVRVK+GSIYHEI ISSQATFGELKKML+GPT
Sbjct  29   EWELRPGGMLVQRRDPDSDRSSVPAPTIRVRVKFGSIYHEIYISSQATFGELKKMLSGPT  88

Query  514  GMHHEDXKLLF  546
            G+HH+D KLLF
Sbjct  89   GLHHQDQKLLF  99



>emb|CDY67495.1| BnaC02g45010D [Brassica napus]
Length=327

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 65/72 (90%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE--NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            +WEMRPGGMLVQKR+PDS+    PPPP IRV++KYGS+YHE+SIS QA+FGELKKML+GP
Sbjct  25   DWEMRPGGMLVQKRNPDSDPVGAPPPPMIRVKIKYGSVYHEMSISPQASFGELKKMLSGP  84

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  85   TGIHHQDQKLMY  96



>ref|XP_004496603.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Cicer 
arietinum]
Length=334

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE-NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWEMRPGGMLVQ+R+ DS+ N  PPP IRVRVKYGS YHE++I SQATFGELKKMLTGPT
Sbjct  21   EWEMRPGGMLVQRRTVDSDPNPVPPPTIRVRVKYGSTYHEVNIGSQATFGELKKMLTGPT  80

Query  514  GMHHEDXKLLF  546
            G+HH+D KL +
Sbjct  81   GLHHQDQKLFY  91



>ref|XP_004140792.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Cucumis 
sativus]
 ref|XP_004166652.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Cucumis 
sativus]
 gb|KGN57344.1| hypothetical protein Csa_3G180320 [Cucumis sativus]
Length=338

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 6/98 (6%)
 Frame = +1

Query  271  RMLRMKTKTTSPaaangggsa-----nEWEMRPGGMLVQKRSPDSE-NLPPPPNIRVRVK  432
            +++++KTKTT  +   G  +       +WE+RPGGMLVQKR+PDS+    P P IRV+VK
Sbjct  3    KLMKLKTKTTEMSEMKGSSTVGDNRPMDWELRPGGMLVQKRTPDSDKESTPAPMIRVKVK  62

Query  433  YGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            Y S YHEISISSQATFGELKK+L GPTG+HH+D KLLF
Sbjct  63   YDSTYHEISISSQATFGELKKILVGPTGLHHQDQKLLF  100



>ref|XP_002865891.1| hypothetical protein ARALYDRAFT_357447 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42150.1| hypothetical protein ARALYDRAFT_357447 [Arabidopsis lyrata subsp. 
lyrata]
Length=349

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 65/72 (90%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENL--PPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            +WEMRPGGMLVQKR+PD + +  PPPP IRVR+KYG++YHEISIS QA+FGELKKMLTGP
Sbjct  32   DWEMRPGGMLVQKRNPDLDPVGAPPPPLIRVRIKYGAVYHEISISPQASFGELKKMLTGP  91

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  92   TGIHHQDQKLMY  103



>ref|XP_006599634.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Glycine 
max]
Length=354

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPP-PPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWEMRPGGMLVQ R+ DS+  P   P IRVRVKYGSIYHE++ISSQATFGELKKML+GPT
Sbjct  39   EWEMRPGGMLVQMRTADSDRNPALVPTIRVRVKYGSIYHEVNISSQATFGELKKMLSGPT  98

Query  514  GMHHEDXKLLF  546
            G+HHED KLL+
Sbjct  99   GLHHEDQKLLY  109



>gb|KHN31536.1| BAG family molecular chaperone regulator 3 [Glycine soja]
Length=354

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPP-PPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWEMRPGGMLVQ R+ DS+  P   P IRVRVKYGSIYHE++ISSQATFGELKKML+GPT
Sbjct  39   EWEMRPGGMLVQMRTADSDRNPALVPTIRVRVKYGSIYHEVNISSQATFGELKKMLSGPT  98

Query  514  GMHHEDXKLLF  546
            G+HHED KLL+
Sbjct  99   GLHHEDQKLLY  109



>ref|XP_009127256.1| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X1 [Brassica rapa]
Length=350

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 65/72 (90%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE--NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            +WEMRPGGMLVQKR+PDS+    PPPP IRV++KYGS+YHE+SIS QA+FGELKKML+GP
Sbjct  47   DWEMRPGGMLVQKRNPDSDPVGAPPPPMIRVKIKYGSLYHEMSISPQASFGELKKMLSGP  106

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  107  TGIHHQDQKLMY  118



>gb|KHN31535.1| BAG family molecular chaperone regulator 1 [Glycine soja]
Length=349

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE-NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWEMRPGGMLVQ R+ DS+ N    P IRVRVKYGSIYHE++ISSQATFGELKKML+GPT
Sbjct  38   EWEMRPGGMLVQMRTTDSDRNSALVPTIRVRVKYGSIYHEVNISSQATFGELKKMLSGPT  97

Query  514  GMHHEDXKLLF  546
            G+HHED KLL+
Sbjct  98   GLHHEDQKLLY  108



>ref|XP_009132555.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Brassica 
rapa]
 emb|CDY38897.1| BnaA03g12820D [Brassica napus]
Length=328

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 63/72 (88%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE--NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            +WEMRPGGMLVQKR+PDS+     PPP IRVRVKYGS+YHEISIS  A+FGELKKML+GP
Sbjct  33   DWEMRPGGMLVQKRNPDSDPVGAKPPPMIRVRVKYGSVYHEISISPHASFGELKKMLSGP  92

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  93   TGIHHQDQKLMY  104



>emb|CDY68101.1| BnaCnng57590D [Brassica napus]
Length=326

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 63/72 (88%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE--NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            +WEMRPGGMLVQKR+PDS+     PPP +RVRVKYGS+YHEISIS  A+FGELKKML+GP
Sbjct  31   DWEMRPGGMLVQKRNPDSDPVGAKPPPMVRVRVKYGSVYHEISISPHASFGELKKMLSGP  90

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  91   TGIHHQDQKLMY  102



>ref|XP_003592309.1| BAG-domain protein 1 / regulator of cell death [Medicago truncatula]
 gb|AES62560.1| BAG family molecular chaperone regulator-like protein [Medicago 
truncatula]
Length=333

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsanEWEMRPGGMLVQKRSPDSE-NLPPPPNIRVRVKYGSIYH  450
            M++MK  T     +       EWEMRPGGMLVQ+R+ DS+ +  PPP IR++VK+GS YH
Sbjct  1    MMKMKNVTNHNGGSVPEPRGLEWEMRPGGMLVQRRTLDSDRDSVPPPTIRIKVKFGSTYH  60

Query  451  EISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            E++ISSQATFGELKKMLTGPTG+HH+D K+ +
Sbjct  61   EVNISSQATFGELKKMLTGPTGLHHQDQKIFY  92



>ref|XP_003533229.2| PREDICTED: BAG family molecular chaperone regulator 1-like [Glycine 
max]
 gb|KHN40256.1| BAG family molecular chaperone regulator 1 [Glycine soja]
Length=340

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPP-PPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWEMRPGGMLVQ R+ DS+  P   P IRVR+K+GSIYHE++ISSQATFGELKKML+GPT
Sbjct  39   EWEMRPGGMLVQMRTADSDRNPALVPTIRVRIKFGSIYHEVNISSQATFGELKKMLSGPT  98

Query  514  GMHHEDXKLLF  546
            G+HHED KL +
Sbjct  99   GLHHEDQKLFY  109



>ref|XP_011101173.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Sesamum 
indicum]
Length=346

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            +WE+RPGGMLVQKR+       PPP IRVRVKYGSIYHEI ISSQATFGELKKML+GPTG
Sbjct  36   QWELRPGGMLVQKRTDADIAHMPPPTIRVRVKYGSIYHEIYISSQATFGELKKMLSGPTG  95

Query  517  MHHEDXKLLF  546
            +HH+D KL +
Sbjct  96   LHHQDQKLFY  105



>gb|EYU19519.1| hypothetical protein MIMGU_mgv1a009583mg [Erythranthe guttata]
Length=337

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE+RPGGMLVQKR+   +   PPP IRVRVK+ SIYHEI ISSQA+FGELKKML+GPTG
Sbjct  29   EWELRPGGMLVQKRTDGDQARAPPPTIRVRVKHASIYHEIRISSQASFGELKKMLSGPTG  88

Query  517  MHHEDXKLLF  546
            +HHED KL +
Sbjct  89   LHHEDQKLFY  98



>ref|XP_008467215.1| PREDICTED: BAG family molecular chaperone regulator 3 [Cucumis 
melo]
Length=299

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            +WEMRPGGMLVQKR+   +N    P +RVRVKYGS+YHEISISSQATFGELKKML G TG
Sbjct  25   DWEMRPGGMLVQKRTESEKNSVSAPIVRVRVKYGSVYHEISISSQATFGELKKMLVGATG  84

Query  517  MHHEDXKLLF  546
            +H ED KL++
Sbjct  85   LHQEDQKLIY  94



>ref|XP_011081155.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Sesamum 
indicum]
Length=275

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsanEWEMRPGGMLVQKRSPDS-ENLPPPPNIRVRVKYGSIYH  450
            M RMK+     ++     +A  WE+RPGGMLVQ+RS DS +N    PNI+VRVKYGS YH
Sbjct  9    MFRMKSDGKGFSSPPAKAAAGGWEVRPGGMLVQRRSSDSNQNSGHVPNIKVRVKYGSSYH  68

Query  451  EISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            E+SISSQA+FGELKKML+GPTG+H +D KL+F
Sbjct  69   EVSISSQASFGELKKMLSGPTGLHTQDQKLIF  100



>ref|XP_007152341.1| hypothetical protein PHAVU_004G121800g [Phaseolus vulgaris]
 gb|ESW24335.1| hypothetical protein PHAVU_004G121800g [Phaseolus vulgaris]
Length=363

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPP-PPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWEMRPGGMLVQ R+ DS+  P   P IRVRVKYGSIYHE++ISSQATFGELKKML+G T
Sbjct  38   EWEMRPGGMLVQMRTADSDRNPVLVPTIRVRVKYGSIYHEVNISSQATFGELKKMLSGVT  97

Query  514  GMHHEDXKLLF  546
            G+HHED KL +
Sbjct  98   GLHHEDQKLFY  108



>ref|XP_002318848.2| hypothetical protein POPTR_0012s13940g [Populus trichocarpa]
 gb|EEE97068.2| hypothetical protein POPTR_0012s13940g [Populus trichocarpa]
Length=323

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLP-PPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            E E+RPGGMLVQKR PDS+    PPP IR++VKYGS YHEI+ISSQATFGELKKML+ PT
Sbjct  26   ELEVRPGGMLVQKRDPDSDRTSIPPPTIRIKVKYGSTYHEINISSQATFGELKKMLSAPT  85

Query  514  GMHHEDXKLLF  546
            G+HH+D KL++
Sbjct  86   GLHHQDQKLIY  96



>ref|XP_011030027.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Populus 
euphratica]
Length=355

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLP-PPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            E E+RPGGMLVQKR PDS+    PPP IR++VKYGS YHEI+ISSQATFGELKKML+ PT
Sbjct  26   ELEVRPGGMLVQKRDPDSDRTSIPPPTIRIKVKYGSTYHEINISSQATFGELKKMLSAPT  85

Query  514  GMHHEDXKLLF  546
            G+HH+D KL++
Sbjct  86   GLHHQDQKLIY  96



>gb|KEH16829.1| BAG family molecular chaperone regulator-like protein [Medicago 
truncatula]
Length=355

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPP-PPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWEMRPGGMLVQ R+ DS   P   P IRVRVK+GSIYHE++ISSQATFG+LKKML+GPT
Sbjct  34   EWEMRPGGMLVQTRTTDSNRNPALVPTIRVRVKFGSIYHELNISSQATFGDLKKMLSGPT  93

Query  514  GMHHEDXKLLF  546
            G+HH+D KL +
Sbjct  94   GLHHQDQKLFY  104



>gb|KHG06573.1| BAG family molecular chaperone regulator 1 [Gossypium arboreum]
Length=340

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 76/102 (75%), Gaps = 11/102 (11%)
 Frame = +1

Query  274  MLRMKTKTT--SPaaanggg--------sanEWEMRPGGMLVQKRSPDS-ENLPPPPNIR  420
            M+RMKTK T  SPA  N           +A++WE+RPGGMLVQKR  D+     PPP IR
Sbjct  1    MMRMKTKATGLSPAVTNEESGFVGGGEPTAHDWELRPGGMLVQKRDLDTGRPPIPPPTIR  60

Query  421  VRVKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            VRVKY SIYHEISI+SQATFGELKKMLTGPTG+HH+D KLL+
Sbjct  61   VRVKYKSIYHEISINSQATFGELKKMLTGPTGLHHQDQKLLY  102



>gb|KJB52839.1| hypothetical protein B456_008G280100 [Gossypium raimondii]
 gb|KJB52840.1| hypothetical protein B456_008G280100 [Gossypium raimondii]
 gb|KJB52841.1| hypothetical protein B456_008G280100 [Gossypium raimondii]
 gb|KJB52842.1| hypothetical protein B456_008G280100 [Gossypium raimondii]
 gb|KJB52844.1| hypothetical protein B456_008G280100 [Gossypium raimondii]
Length=340

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 77/102 (75%), Gaps = 11/102 (11%)
 Frame = +1

Query  274  MLRMKTKTT--SPaaanggg--------sanEWEMRPGGMLVQKRSPDS-ENLPPPPNIR  420
            M+RMKTK T  SPA  NG          +A++WE+RPGGMLVQKR  D+     PPP IR
Sbjct  1    MMRMKTKATGLSPAVTNGESGFVGGGEPTAHDWELRPGGMLVQKRDLDTGRPPIPPPTIR  60

Query  421  VRVKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            VRVKY SIYHEISI+SQATFGELKKMLTGPTG+HH+D KLL+
Sbjct  61   VRVKYKSIYHEISINSQATFGELKKMLTGPTGLHHQDQKLLY  102



>ref|XP_007152340.1| hypothetical protein PHAVU_004G121700g [Phaseolus vulgaris]
 gb|ESW24334.1| hypothetical protein PHAVU_004G121700g [Phaseolus vulgaris]
Length=362

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE-NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWEMRPGGMLVQ R+ +S+ N    P IRVRVKYGSIYHE++ISSQATFGELKKML+G T
Sbjct  37   EWEMRPGGMLVQMRTSESDRNSVLVPTIRVRVKYGSIYHEVNISSQATFGELKKMLSGLT  96

Query  514  GMHHEDXKLLF  546
            G+HHED KL +
Sbjct  97   GLHHEDQKLFY  107



>emb|CDP09809.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 70/95 (74%), Gaps = 4/95 (4%)
 Frame = +1

Query  274  MLRMKTKTT---SPaaangggsanEWEMRPGGMLVQKRSPDS-ENLPPPPNIRVRVKYGS  441
            MLRMK K T   SPA   G   A  WE+RPGGMLVQKR+ DS +N    P I+VRVKYGS
Sbjct  5    MLRMKPKATGMSSPAKGGGKSEAGGWEVRPGGMLVQKRNIDSNQNFNIVPMIKVRVKYGS  64

Query  442  IYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
             YHE++ISSQA+FGELKKML  PTG+H +D KLL+
Sbjct  65   SYHEVNISSQASFGELKKMLAAPTGLHPQDQKLLY  99



>ref|XP_004516168.1| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004516169.1| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X2 [Cicer arietinum]
Length=353

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE-NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            +WEMRPGGMLVQ R+ +S+ N    P IRVRVK+GSIYH+++ISSQATFG+LKKMLTGPT
Sbjct  32   DWEMRPGGMLVQTRTNNSDRNSVLVPTIRVRVKFGSIYHQVNISSQATFGDLKKMLTGPT  91

Query  514  GMHHEDXKLLF  546
            G+HH+D KL +
Sbjct  92   GLHHQDQKLFY  102



>ref|XP_004245651.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Solanum 
lycopersicum]
Length=284

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 68/99 (69%), Gaps = 10/99 (10%)
 Frame = +1

Query  265  SLRMLRMKTKTTSPaaangggsanEWEMRPGGMLVQKRSPD-----SENLPPPPNIRVRV  429
            S  +LRMKTK  +    +  G    WEMRPGGMLVQKRS D     S N+  P  IR++V
Sbjct  3    SKELLRMKTKKANGNGVSSSG----WEMRPGGMLVQKRSSDHNSNQSSNIVVPI-IRLKV  57

Query  430  KYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            KYGS YHE+ ISSQATFGELKKML GPTG+H ED K+ +
Sbjct  58   KYGSSYHEVKISSQATFGELKKMLAGPTGLHTEDQKIFY  96



>ref|NP_001242839.1| uncharacterized protein LOC100790513 [Glycine max]
 gb|ACU21091.1| unknown [Glycine max]
Length=337

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPP-PNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWEMRPGGMLVQ R+ DS   P   P IRV+VK+GSIYHE++ISSQATFGELKKML+G T
Sbjct  28   EWEMRPGGMLVQMRTADSGRNPALLPTIRVKVKFGSIYHEVNISSQATFGELKKMLSGLT  87

Query  514  GMHHEDXKLLF  546
            G+HHED KL +
Sbjct  88   GLHHEDQKLFY  98



>ref|XP_010693501.1| PREDICTED: BAG family molecular chaperone regulator 3 [Beta vulgaris 
subsp. vulgaris]
Length=363

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTGM  519
            WEMRP GMLVQKR  + +N  P P IRVRVKY SIYHEI I+SQATFGELKK+L GPTG+
Sbjct  46   WEMRPCGMLVQKRVDEEQNTKPLPTIRVRVKYASIYHEIHINSQATFGELKKLLAGPTGL  105

Query  520  HHEDXKLLF  546
            HH+D K+ +
Sbjct  106  HHQDMKVYY  114



>ref|XP_006586682.1| PREDICTED: uncharacterized protein LOC100790513 isoform X1 [Glycine 
max]
Length=353

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPP-PNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWEMRPGGMLVQ R+ DS   P   P IRV+VK+GSIYHE++ISSQATFGELKKML+G T
Sbjct  28   EWEMRPGGMLVQMRTADSGRNPALLPTIRVKVKFGSIYHEVNISSQATFGELKKMLSGLT  87

Query  514  GMHHEDXKLLF  546
            G+HHED KL +
Sbjct  88   GLHHEDQKLFY  98



>dbj|BAE71291.1| hypothetical protein [Trifolium pratense]
Length=347

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSP-DSENLP-PPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWEMRPGGMLVQ+R+  DS+  P  PP I+VRVKYGS YHE++ISS ATFGELKKMLTGP
Sbjct  21   EWEMRPGGMLVQRRTDGDSDRKPVQPPTIKVRVKYGSTYHEVNISSIATFGELKKMLTGP  80

Query  511  TGMHHEDXKLLF  546
            TG+HH D K+ +
Sbjct  81   TGLHHLDQKIFY  92



>ref|XP_009759895.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Nicotiana 
sylvestris]
Length=282

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 65/92 (71%), Gaps = 3/92 (3%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsanEWEMRPGGMLVQKRSPDS-ENLPPPPNIRVRVKYGSIYH  450
            +LRMKTK   P       S   WEMRPGGMLVQ+RS DS ++    P I+++VKYGS YH
Sbjct  5    LLRMKTKPNKPNGNGLSSSG--WEMRPGGMLVQQRSSDSYQSSVTVPTIKIKVKYGSSYH  62

Query  451  EISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            E+ ISSQATFGELKKML G TG+H ED K+ +
Sbjct  63   EVKISSQATFGELKKMLAGQTGLHTEDQKIFY  94



>ref|XP_006358866.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Solanum 
tuberosum]
Length=283

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 68/99 (69%), Gaps = 10/99 (10%)
 Frame = +1

Query  265  SLRMLRMKTKTTSPaaangggsanEWEMRPGGMLVQKRSPD-----SENLPPPPNIRVRV  429
            S  +LRMKTK  +    +  G    WEMRPGGMLVQKRS D     S N+  P  IR++V
Sbjct  2    SKELLRMKTKKPNGNGLSSSG----WEMRPGGMLVQKRSSDHNSNQSSNIVVPI-IRLKV  56

Query  430  KYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            KYGS YHE+ ISSQATFGELKKML GPTG+H ED K+ +
Sbjct  57   KYGSSYHEVKISSQATFGELKKMLAGPTGLHTEDQKIFY  95



>ref|XP_010933885.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Elaeis 
guineensis]
Length=300

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE+RPGGMLVQKR PDS    P P IRVR+KYG++YHEI +SSQATFGELKK+L+  TG
Sbjct  35   EWEVRPGGMLVQKRDPDSAA-APVPAIRVRIKYGAVYHEIYLSSQATFGELKKLLSARTG  93

Query  517  MHHEDXKLLF  546
            +H +D KL++
Sbjct  94   LHPQDQKLVY  103



>ref|XP_010278545.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Nelumbo 
nucifera]
Length=351

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 70/99 (71%), Gaps = 8/99 (8%)
 Frame = +1

Query  274  MLRMKTKTT--SPaaangg-----gsanEWEMRPGGMLVQKRSPDSENLPPPPN-IRVRV  429
            M+RM+TKTT  SP     G         +WE+RPGGMLVQKR+PDS+    P + IRVRV
Sbjct  1    MMRMRTKTTGMSPVNGITGNGVGGSEVADWELRPGGMLVQKRNPDSDGGAIPAHTIRVRV  60

Query  430  KYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            K+GS YHEI I+SQA+FGELKK+L  PTG+H +D KL F
Sbjct  61   KHGSNYHEIYINSQASFGELKKLLAAPTGLHPQDQKLFF  99



>ref|XP_009609256.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Nicotiana 
tomentosiformis]
Length=282

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 65/92 (71%), Gaps = 3/92 (3%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsanEWEMRPGGMLVQKRSPDS-ENLPPPPNIRVRVKYGSIYH  450
            +L+MKTK   P       S   WEMRPGGMLVQ+RS DS ++    P I+V+VKYGS YH
Sbjct  5    LLKMKTKPNKPNGNGLSSSG--WEMRPGGMLVQQRSSDSYQSSITVPTIKVKVKYGSSYH  62

Query  451  EISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            E+ ISSQATFGELKKML G TG+H ED K+ +
Sbjct  63   EVKISSQATFGELKKMLAGQTGLHPEDQKIFY  94



>ref|XP_010523590.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Tarenaya 
hassleriana]
Length=304

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 58/70 (83%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            +WE+RPGGM+VQ+R+  S      P IRVRVKYGS+YHEI+ISSQATFGELKK L+G TG
Sbjct  18   DWELRPGGMVVQRRTDQSSG--ESPVIRVRVKYGSVYHEITISSQATFGELKKALSGRTG  75

Query  517  MHHEDXKLLF  546
            +HH+D K+L+
Sbjct  76   LHHQDMKILY  85



>ref|XP_002873301.1| BCL-2-associated athanogene 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49560.1| BCL-2-associated athanogene 3 [Arabidopsis lyrata subsp. lyrata]
Length=297

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHE  453
            M++MKT  TSP    GG S NEWE RPGGM+VQ+R+   +N   P  IRVRVKYGS+YHE
Sbjct  1    MMKMKT-GTSPPVIGGGSSGNEWESRPGGMVVQRRT--DQNSDVPRVIRVRVKYGSVYHE  57

Query  454  ISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            I+I+SQ++FGELKKML+   G+HHED K+L+
Sbjct  58   ININSQSSFGELKKMLSDQVGLHHEDMKVLY  88



>ref|XP_006288325.1| hypothetical protein CARUB_v10001571mg [Capsella rubella]
 gb|EOA21223.1| hypothetical protein CARUB_v10001571mg [Capsella rubella]
Length=300

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = +1

Query  283  MKTKTTSPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISI  462
            MK KT S  + +GG S NEWE RPGGM+VQ+R+   +N   P  IR+RVKYGS+YHEI+I
Sbjct  2    MKMKTGSSPSVSGGSSGNEWEYRPGGMVVQRRT--DQNSEVPRVIRIRVKYGSVYHEINI  59

Query  463  SSQATFGELKKMLTGPTGMHHEDXKLLF  546
            +SQ+TFGELKKML+   G+HHED K+L+
Sbjct  60   NSQSTFGELKKMLSDQVGLHHEDMKVLY  87



>emb|CDY30692.1| BnaA02g33140D [Brassica napus]
 emb|CDY30694.1| BnaA02g33160D [Brassica napus]
Length=297

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 60/70 (86%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE+RPGGM+VQ+R+ DS N+P    IRVRVKYGS++HEISI+SQ+TFGELKK L+  TG
Sbjct  15   EWELRPGGMVVQRRTDDSSNVPHV--IRVRVKYGSVHHEISINSQSTFGELKKRLSFKTG  72

Query  517  MHHEDXKLLF  546
            +HHED K+L+
Sbjct  73   VHHEDMKILY  82



>ref|XP_010546084.1| PREDICTED: BAG family molecular chaperone regulator 3-like isoform 
X2 [Tarenaya hassleriana]
Length=203

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 57/70 (81%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            +W++R GGM+VQ+R+  S      P IRVRVKYGS+YHEI+I+SQATF ELKKML+G TG
Sbjct  22   DWDLRSGGMMVQRRTDQSSG--ESPVIRVRVKYGSVYHEITINSQATFAELKKMLSGRTG  79

Query  517  MHHEDXKLLF  546
            +HH+D K+L+
Sbjct  80   LHHQDMKILY  89



>gb|EMT16875.1| hypothetical protein F775_12964 [Aegilops tauschii]
Length=246

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  268  LRMLRMKTKTTSPaaangggsanEWEMRPGGMLVQKRSPDSEN--LPPPPNIRVRVKYGS  441
            L  ++  T   SPAAA      +EWE+RPGGMLVQKR PDS+     P P +R++VK+  
Sbjct  11   LDAMKETTSPVSPAAAKEALKEDEWEVRPGGMLVQKRDPDSDAPAGAPVPTVRLKVKFNG  70

Query  442  IYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            + HEI I+SQA+FGELKKM++  TG+HHED K+L+
Sbjct  71   VSHEIYINSQASFGELKKMMSEKTGLHHEDQKVLY  105



>ref|XP_010555653.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Tarenaya 
hassleriana]
Length=356

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 3/72 (4%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPPPN---IRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            WEMRPGGMLVQKR+PD +    PP    IRVR+KY S+YHEI+IS QATFGELKKML+GP
Sbjct  29   WEMRPGGMLVQKRNPDPDRAGAPPPPPPIRVRIKYNSVYHEINISPQATFGELKKMLSGP  88

Query  511  TGMHHEDXKLLF  546
            TG+HH+D K+++
Sbjct  89   TGLHHQDQKIMY  100



>ref|XP_010086544.1| BAG family molecular chaperone regulator 1 [Morus notabilis]
 gb|EXB19761.1| BAG family molecular chaperone regulator 1 [Morus notabilis]
Length=297

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPD-SENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            +WE+RPGGMLVQKR+ D ++   P   IRVRVKYGS YHEI ISSQA+FGELKK L GPT
Sbjct  30   QWEIRPGGMLVQKRNSDVNQTSAPISTIRVRVKYGSSYHEIYISSQASFGELKKKLAGPT  89

Query  514  GMHHEDXKLLF  546
            G+H +D KL+F
Sbjct  90   GLHPQDQKLIF  100



>gb|EYU38991.1| hypothetical protein MIMGU_mgv1a011152mg [Erythranthe guttata]
Length=290

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +1

Query  343  EMRPGGMLVQKRSPDS-ENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTGM  519
            E+RPGGMLVQKRS DS +N  P PNI+V+VKYGS+YHEI I+SQ+ FGE+KKML G TG+
Sbjct  40   EVRPGGMLVQKRSSDSNQNYNPVPNIKVKVKYGSVYHEILIASQSNFGEMKKMLAGLTGL  99

Query  520  HHEDXKLLF  546
            H +D KL++
Sbjct  100  HTQDQKLIY  108



>ref|XP_010919227.1| PREDICTED: BAG family molecular chaperone regulator 2-like [Elaeis 
guineensis]
Length=310

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 59/71 (83%), Gaps = 3/71 (4%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPP-PNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGMLVQKR PDS  +P P P IRVRVKYG++YHEI +SSQ TFGELKK+L+  T
Sbjct  31   EWEVRPGGMLVQKRDPDS--VPAPAPTIRVRVKYGAVYHEIYLSSQTTFGELKKLLSPRT  88

Query  514  GMHHEDXKLLF  546
            G+H ED KL++
Sbjct  89   GLHPEDQKLIY  99



>ref|XP_006857897.1| hypothetical protein AMTR_s00069p00126080 [Amborella trichopoda]
 gb|ERN19364.1| hypothetical protein AMTR_s00069p00126080 [Amborella trichopoda]
Length=272

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRS--PDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            +WE+RPGGMLVQKRS   D  +  P P IRVRVKYG++ HEI ISSQATFGELKK+L   
Sbjct  27   DWELRPGGMLVQKRSLGIDQASSAPAPTIRVRVKYGALMHEIHISSQATFGELKKLLASE  86

Query  511  TGMHHEDXKLLF  546
            TG+H +D KLLF
Sbjct  87   TGLHTQDQKLLF  98



>ref|XP_010442728.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Camelina 
sativa]
 ref|XP_010442729.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Camelina 
sativa]
Length=340

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 64/72 (89%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPN--IRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWEMRPGGMLVQKR+PD + + PPP   IRVR+KYGS+YHEISIS QA+FGELKKML+GP
Sbjct  36   EWEMRPGGMLVQKRNPDLDPVGPPPPPMIRVRIKYGSVYHEISISPQASFGELKKMLSGP  95

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  96   TGIHHQDQKLMY  107



>gb|EEC84905.1| hypothetical protein OsI_32096 [Oryza sativa Indica Group]
Length=415

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = +1

Query  250  FPPAGSLRMLRMKTKTTSPaaangggsanEWEMRPGGMLVQKRSPDSEN-LPPPPNIRVR  426
            FPPA +   ++  +    PAAA      +EWE+RPGGMLVQKRSPD +    P P IRV+
Sbjct  10   FPPAAA--AMKESSAPPPPAAAAAAAREDEWEVRPGGMLVQKRSPDGDAPAAPVPTIRVK  67

Query  427  VKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            VK+  +YHEI I+SQA+FGELKK L+ PTG+H ED K+++
Sbjct  68   VKFNGVYHEIYINSQASFGELKKQLSAPTGLHPEDQKIVY  107



>ref|NP_001063716.1| Os09g0524800 [Oryza sativa Japonica Group]
 dbj|BAD46488.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25630.1| Os09g0524800 [Oryza sativa Japonica Group]
 dbj|BAG97389.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87460.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE70071.1| hypothetical protein OsJ_30057 [Oryza sativa Japonica Group]
Length=334

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = +1

Query  250  FPPAGSLRMLRMKTKTTSPaaangggsanEWEMRPGGMLVQKRSPDSEN-LPPPPNIRVR  426
            FPPA +   ++  +    PAAA      +EWE+RPGGMLVQKRSPD +    P P IRV+
Sbjct  10   FPPAAA--AMKESSAPPPPAAAAAAAREDEWEVRPGGMLVQKRSPDGDAPAAPVPTIRVK  67

Query  427  VKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            VK+  +YHEI I+SQA+FGELKK L+ PTG+H ED K+++
Sbjct  68   VKFNGVYHEIYINSQASFGELKKQLSAPTGLHPEDQKIVY  107



>ref|XP_010497456.1| PREDICTED: BAG family molecular chaperone regulator 1-like, partial 
[Camelina sativa]
Length=141

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 64/72 (89%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPN--IRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWEMRPGGMLVQKR+PD + + PPP   IRVR+KYG++YHEISIS QA+FGELKKML+GP
Sbjct  36   EWEMRPGGMLVQKRNPDLDPVGPPPPPMIRVRIKYGAVYHEISISPQASFGELKKMLSGP  95

Query  511  TGMHHEDXKLLF  546
            TG+H++D KL++
Sbjct  96   TGIHYQDQKLMY  107



>gb|EPS73724.1| hypothetical protein M569_01034 [Genlisea aurea]
Length=282

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 64/94 (68%), Gaps = 6/94 (6%)
 Frame = +1

Query  274  MLRMKTKTTS---PaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSI  444
            M++MKT + +   P         NEWE+RPGGMLVQKR+   ++   PP IRVRVKYG  
Sbjct  1    MMQMKTSSFAHAPPPMNGNSSGENEWELRPGGMLVQKRTDGDKS---PPKIRVRVKYGDT  57

Query  445  YHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            YHEI ISSQATFG LKK L+ PTG++H D KL F
Sbjct  58   YHEIHISSQATFGALKKKLSEPTGLNHHDQKLFF  91



>ref|XP_008795379.1| PREDICTED: BAG family molecular chaperone regulator 1 [Phoenix 
dactylifera]
Length=309

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPD--SENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKR PD  +    P P IRVRVK+G++YHEI +SSQATFGELKK+L+  
Sbjct  35   EWEVRPGGMLVQKRDPDFAAAAAAPVPTIRVRVKFGAVYHEIYLSSQATFGELKKLLSAR  94

Query  511  TGMHHEDXKLLF  546
            TG+H +D KL++
Sbjct  95   TGLHPQDQKLIY  106



>ref|NP_196339.1| BCL-2-associated athanogene 3 [Arabidopsis thaliana]
 sp|Q9LYP4.1|BAG3_ARATH RecName: Full=BAG family molecular chaperone regulator 3; AltName: 
Full=Bcl-2-associated athanogene 3 [Arabidopsis thaliana]
 gb|AAL16179.1|AF428411_1 AT5g07220/T28J14_160 [Arabidopsis thaliana]
 emb|CAB87278.1| putative protein [Arabidopsis thaliana]
 gb|AED91123.1| BCL-2-associated athanogene 3 [Arabidopsis thaliana]
Length=303

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHE  453
            M++M T  TSP+   GG S NEWE RPGGM+VQ+R+  + ++P     RVRVKYGS+YHE
Sbjct  1    MMKMNT-GTSPSVIGGGTSGNEWESRPGGMVVQRRTDQNSDVPRV--FRVRVKYGSVYHE  57

Query  454  ISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            I+I+SQ++FGELKKML+   G+HHED K+L+
Sbjct  58   ININSQSSFGELKKMLSDQVGLHHEDMKVLY  88



>tpg|DAA62366.1| TPA: hypothetical protein ZEAMMB73_865805 [Zea mays]
Length=224

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN--LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKRSPD++     P P IRV+VK+  +YHEI I+SQA+FGELKKML+  
Sbjct  36   EWEVRPGGMLVQKRSPDADAPAGAPVPTIRVKVKFNGVYHEIYINSQASFGELKKMLSAR  95

Query  511  TGMHHEDXKLLF  546
            TG+H ED KL++
Sbjct  96   TGLHPEDQKLVY  107



>ref|XP_010444347.1| PREDICTED: BAG family molecular chaperone regulator 1 [Camelina 
sativa]
 ref|XP_010444351.1| PREDICTED: BAG family molecular chaperone regulator 1 [Camelina 
sativa]
Length=342

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 64/72 (89%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPN--IRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWEMRPGGMLVQKR+PD + + PPP   IRVR+KYG++YHEISIS QA+FGELKKML+GP
Sbjct  38   EWEMRPGGMLVQKRNPDLDPVGPPPPPMIRVRIKYGAVYHEISISPQASFGELKKMLSGP  97

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  98   TGIHHQDQKLMY  109



>ref|XP_006280779.1| hypothetical protein CARUB_v10026750mg [Capsella rubella]
 gb|EOA13677.1| hypothetical protein CARUB_v10026750mg [Capsella rubella]
Length=335

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 64/72 (89%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPN--IRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            +WEMRPGGMLVQKR+PD + + PPP   IRVR+KYGS+YHEISIS QA+FGELKKML+GP
Sbjct  39   DWEMRPGGMLVQKRNPDLDPVGPPPPPMIRVRIKYGSVYHEISISPQASFGELKKMLSGP  98

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  99   TGIHHQDQKLMY  110



>gb|AAM61448.1| unknown [Arabidopsis thaliana]
Length=300

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 66/83 (80%), Gaps = 2/83 (2%)
 Frame = +1

Query  298  TSPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQAT  477
            TSP+   GG S NEWE RPGGM+VQ+R+  + ++P    IRVRVKYGS+YHEI+I+SQ++
Sbjct  5    TSPSVIGGGTSGNEWESRPGGMVVQRRTDQNSDVPRV--IRVRVKYGSVYHEININSQSS  62

Query  478  FGELKKMLTGPTGMHHEDXKLLF  546
            FGELKKML+   G+HHED K+L+
Sbjct  63   FGELKKMLSDQVGLHHEDMKVLY  85



>ref|XP_002298065.2| hypothetical protein POPTR_0001s08760g [Populus trichocarpa]
 gb|EEE82870.2| hypothetical protein POPTR_0001s08760g [Populus trichocarpa]
Length=324

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRS-PDSE-NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKR+  DS  N  P   I+VRVKYGS  HEISISSQA+FGELKKML   
Sbjct  34   EWEIRPGGMLVQKRTTADSNHNSVPVSTIKVRVKYGSSCHEISISSQASFGELKKMLAQH  93

Query  511  TGMHHEDXKLLF  546
            TG+HHED KL++
Sbjct  94   TGVHHEDQKLIY  105



>gb|ACG35882.1| protein binding protein [Zea mays]
Length=336

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN--LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKRSPD++     P P IRV+VK+  +YHEI I+SQA+FGELKKML+  
Sbjct  38   EWEVRPGGMLVQKRSPDADAPAGAPVPTIRVKVKFNGVYHEIYINSQASFGELKKMLSAR  97

Query  511  TGMHHEDXKLLF  546
            TG+H ED KL++
Sbjct  98   TGLHPEDQKLVY  109



>ref|XP_010676552.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Beta 
vulgaris subsp. vulgaris]
Length=270

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 3/73 (4%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN---LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTG  507
            EWEMRPGGMLVQKR+ DS     + P P I+V VKYGS YHEI I+S A+FGELKKML G
Sbjct  18   EWEMRPGGMLVQKRNLDSHRNSFINPIPKIKVLVKYGSCYHEIHINSHASFGELKKMLAG  77

Query  508  PTGMHHEDXKLLF  546
             TG+H +D KL+F
Sbjct  78   LTGLHPQDQKLIF  90



>gb|ACG37214.1| protein binding protein [Zea mays]
 tpg|DAA62369.1| TPA: protein binding protein [Zea mays]
Length=334

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN--LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKRSPD++     P P IRV+VK+  +YHEI I+SQA+FGELKKML+  
Sbjct  36   EWEVRPGGMLVQKRSPDADAPAGAPVPTIRVKVKFNGVYHEIYINSQASFGELKKMLSAR  95

Query  511  TGMHHEDXKLLF  546
            TG+H ED KL++
Sbjct  96   TGLHPEDQKLVY  107



>ref|XP_007155563.1| hypothetical protein PHAVU_003G212500g [Phaseolus vulgaris]
 ref|XP_007155564.1| hypothetical protein PHAVU_003G212500g [Phaseolus vulgaris]
 gb|ESW27557.1| hypothetical protein PHAVU_003G212500g [Phaseolus vulgaris]
 gb|ESW27558.1| hypothetical protein PHAVU_003G212500g [Phaseolus vulgaris]
Length=271

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPD-SENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGM+VQKR+ D ++N      ++VRVKYGS YH+I ISS A+FGELKKMLT PT
Sbjct  20   EWELRPGGMVVQKRNSDVNQNFISKSTVKVRVKYGSSYHQIQISSHASFGELKKMLTEPT  79

Query  514  GMHHEDXKLLF  546
            G+H +D KL++
Sbjct  80   GLHVQDQKLIY  90



>tpg|DAA62368.1| TPA: hypothetical protein ZEAMMB73_865805 [Zea mays]
Length=332

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN--LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKRSPD++     P P IRV+VK+  +YHEI I+SQA+FGELKKML+  
Sbjct  36   EWEVRPGGMLVQKRSPDADAPAGAPVPTIRVKVKFNGVYHEIYINSQASFGELKKMLSAR  95

Query  511  TGMHHEDXKLLF  546
            TG+H ED KL++
Sbjct  96   TGLHPEDQKLVY  107



>ref|XP_009130192.1| PREDICTED: BAG family molecular chaperone regulator 2 [Brassica 
rapa]
Length=313

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 59/70 (84%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE+RPGGM+VQ+R+  S N+P    IRVRVKYGS++HEISI+SQ+TFGELKK L+  TG
Sbjct  31   EWELRPGGMVVQRRTDYSSNVPHV--IRVRVKYGSVHHEISINSQSTFGELKKRLSFKTG  88

Query  517  MHHEDXKLLF  546
            +HHED K+L+
Sbjct  89   VHHEDMKILY  98



>ref|XP_010423239.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Camelina 
sativa]
Length=303

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 69/92 (75%), Gaps = 3/92 (3%)
 Frame = +1

Query  274  MLRMKTKTT-SPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYH  450
            M++MKT ++ +  +  G  S NEWE RPGGM+VQ+R+  +  LP    IRVRVKY S+YH
Sbjct  1    MMKMKTGSSPTSVSGGGVSSGNEWEYRPGGMVVQRRTDQNSELPRV--IRVRVKYASVYH  58

Query  451  EISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            EI+I+SQ+TFGELKKML+   G+HHED K+L+
Sbjct  59   EININSQSTFGELKKMLSDQVGLHHEDMKVLY  90



>ref|XP_010491327.1| PREDICTED: BAG family molecular chaperone regulator 3 [Camelina 
sativa]
Length=307

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE RPGGM+VQ+R+  +  LP    IRVRVKY S+YHEI+I+SQ+TFGELKKML+   G
Sbjct  23   EWEYRPGGMVVQRRTDQNSELPRV--IRVRVKYASVYHEININSQSTFGELKKMLSDQVG  80

Query  517  MHHEDXKLLF  546
            +HHED K+L+
Sbjct  81   LHHEDMKVLY  90



>tpg|DAA62367.1| TPA: hypothetical protein ZEAMMB73_865805, partial [Zea mays]
Length=349

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN--LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKRSPD++     P P IRV+VK+  +YHEI I+SQA+FGELKKML+  
Sbjct  36   EWEVRPGGMLVQKRSPDADAPAGAPVPTIRVKVKFNGVYHEIYINSQASFGELKKMLSAR  95

Query  511  TGMHHEDXKLLF  546
            TG+H ED KL++
Sbjct  96   TGLHPEDQKLVY  107



>emb|CDX70017.1| BnaA10g23660D [Brassica napus]
Length=307

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 71/92 (77%), Gaps = 3/92 (3%)
 Frame = +1

Query  274  MLRMKTKTT-SPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYH  450
            M++M T TT S +   GG S NEWE RPGGM+VQ+R+  + + P    IRVRVKY S+YH
Sbjct  1    MMKMNTGTTPSLSVGGGGVSGNEWESRPGGMVVQRRTDQTSDAPRV--IRVRVKYLSVYH  58

Query  451  EISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            EI+I+SQ++FGELKK+L+G TG+HHED K+L+
Sbjct  59   EININSQSSFGELKKVLSGQTGLHHEDMKILY  90



>ref|XP_003578469.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Brachypodium 
distachyon]
Length=332

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN-LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGMLVQKRSPDS+    P P IR++VK+  +YHEI I+SQA+FGELKKM++  T
Sbjct  39   EWEVRPGGMLVQKRSPDSDAPAAPVPTIRIKVKFNGVYHEIYINSQASFGELKKMMSTKT  98

Query  514  GMHHEDXKLLF  546
            G+H ED K+++
Sbjct  99   GLHPEDQKVVY  109



>ref|NP_001119477.1| BCL-2-associated athanogene 2 [Arabidopsis thaliana]
 gb|AED97564.1| BCL-2-associated athanogene 2 [Arabidopsis thaliana]
Length=200

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 60/70 (86%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            E E+RPGGM+VQKR+  S ++P    IRVRVKYGS++HEISI+SQ+TFGELKK+L+G TG
Sbjct  15   EMELRPGGMVVQKRTDHSSSVPR--GIRVRVKYGSVHHEISINSQSTFGELKKILSGATG  72

Query  517  MHHEDXKLLF  546
            +HH+D ++++
Sbjct  73   VHHQDMQIIY  82



>emb|CDX98996.1| BnaC09g48390D [Brassica napus]
Length=306

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 71/92 (77%), Gaps = 3/92 (3%)
 Frame = +1

Query  274  MLRMKTKTT-SPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYH  450
            M++M T TT S +   GG S NEWE RPGGM+VQ+R+  + + P    IRVRVKY S+YH
Sbjct  1    MMKMNTGTTPSLSVGGGGVSGNEWESRPGGMVVQRRTDQTSDAPRV--IRVRVKYLSVYH  58

Query  451  EISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            EI+I+SQ++FGELKK+L+G TG+HHED K+L+
Sbjct  59   EININSQSSFGELKKVLSGQTGLHHEDMKILY  90



>ref|XP_010483938.1| PREDICTED: BAG family molecular chaperone regulator 2-like isoform 
X4 [Camelina sativa]
Length=202

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 58/70 (83%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            E E+RPGGM+VQKR+    N+P    IRVRVKYGS++HEISI+SQ++FGELKK L+G TG
Sbjct  17   ELELRPGGMVVQKRTDQISNVPRV--IRVRVKYGSVHHEISINSQSSFGELKKKLSGATG  74

Query  517  MHHEDXKLLF  546
            +HH+D K+++
Sbjct  75   VHHQDMKIIY  84



>ref|XP_010452677.1| PREDICTED: BAG family molecular chaperone regulator 3 [Camelina 
sativa]
Length=309

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE RPGGM+VQ+R+  +  LP    IRVRVKY S+YHEI+I+SQ+TFGELKKML+   G
Sbjct  25   EWEYRPGGMVVQRRTDQNSELPRV--IRVRVKYASVYHEININSQSTFGELKKMLSDQVG  82

Query  517  MHHEDXKLLF  546
            +HHED K+L+
Sbjct  83   LHHEDMKVLY  92



>ref|XP_010458273.1| PREDICTED: BAG family molecular chaperone regulator 2-like isoform 
X3 [Camelina sativa]
Length=202

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 58/70 (83%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            E E+RPGGM+VQKR+    N+P    IRVRVKYGS++HEISI+SQ++FGELKK L+G TG
Sbjct  17   ELELRPGGMVVQKRTDQISNVPRV--IRVRVKYGSVHHEISINSQSSFGELKKKLSGATG  74

Query  517  MHHEDXKLLF  546
            +HH+D K+++
Sbjct  75   VHHQDMKIIY  84



>ref|NP_001146867.1| protein binding protein [Zea mays]
 gb|ACG24044.1| protein binding protein [Zea mays]
Length=334

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN--LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKRSPD++     P P IRV+VK+  +YHEI I+SQA+FGELKKML+  
Sbjct  36   EWEVRPGGMLVQKRSPDADAPAGAPVPTIRVKVKFNGMYHEIYINSQASFGELKKMLSAR  95

Query  511  TGMHHEDXKLLF  546
            TG+H ED KL++
Sbjct  96   TGLHPEDQKLVY  107



>ref|XP_010546082.1| PREDICTED: BAG family molecular chaperone regulator 3-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010546083.1| PREDICTED: BAG family molecular chaperone regulator 3-like isoform 
X1 [Tarenaya hassleriana]
Length=317

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 57/70 (81%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            +W++R GGM+VQ+R+  S      P IRVRVKYGS+YHEI+I+SQATF ELKKML+G TG
Sbjct  22   DWDLRSGGMMVQRRTDQSSG--ESPVIRVRVKYGSVYHEITINSQATFAELKKMLSGRTG  79

Query  517  MHHEDXKLLF  546
            +HH+D K+L+
Sbjct  80   LHHQDMKILY  89



>ref|XP_006579417.1| PREDICTED: uncharacterized protein LOC100792005 isoform X1 [Glycine 
max]
 gb|KHN34433.1| BAG family molecular chaperone regulator 1 [Glycine soja]
Length=275

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPD-SENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGMLVQKR+ D ++N      I+V+VKYGS YH+I ISS A+FGELKKMLT PT
Sbjct  20   EWELRPGGMLVQKRNLDLNQNSASKSTIKVKVKYGSSYHQIQISSHASFGELKKMLTEPT  79

Query  514  GMHHEDXKLLF  546
            G+H +D KL++
Sbjct  80   GLHIQDQKLIY  90



>ref|XP_008670335.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Zea 
mays]
 tpg|DAA40588.1| TPA: hypothetical protein ZEAMMB73_734833 [Zea mays]
Length=318

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLP--PPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQ+RSPD++     P P IRV+VK+  +YHEI I+SQA+FGELKKML+  
Sbjct  33   EWEVRPGGMLVQRRSPDADAPAGAPVPTIRVKVKFNGVYHEIYINSQASFGELKKMLSAR  92

Query  511  TGMHHEDXKLLF  546
            TG+H ED KL++
Sbjct  93   TGLHPEDQKLVY  104



>ref|XP_008803274.1| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X2 [Phoenix dactylifera]
Length=277

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE+RP GMLVQKR PDS      P IRVRVKYG+ YHEI +SSQATFGELKK+L+  TG
Sbjct  37   EWEVRPSGMLVQKRDPDSAP-SLAPTIRVRVKYGAAYHEIYLSSQATFGELKKLLSSRTG  95

Query  517  MHHEDXKLLF  546
            +H ED KL++
Sbjct  96   LHPEDQKLIY  105



>gb|KFK26814.1| hypothetical protein AALP_AA8G296800 [Arabis alpina]
Length=337

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 64/72 (89%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPN--IRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            +WEMRPGGMLVQKR+PDS+   PPP   IRVR+KYG++YHE++IS QA+FGELKKML+GP
Sbjct  36   DWEMRPGGMLVQKRNPDSDPAGPPPPPMIRVRIKYGAVYHEVNISPQASFGELKKMLSGP  95

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  96   TGIHHQDQKLMY  107



>ref|XP_006600808.1| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X2 [Glycine max]
Length=274

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPD-SENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGM+VQKR+ D ++N      I+V+VKYGS YH+I ISS A+FGELKKMLT PT
Sbjct  20   EWELRPGGMVVQKRNSDLNQNSASKFTIKVKVKYGSSYHQIQISSHASFGELKKMLTEPT  79

Query  514  GMHHEDXKLLF  546
            G+H +D KL++
Sbjct  80   GLHVQDQKLIY  90



>ref|XP_008803273.1| PREDICTED: BAG family molecular chaperone regulator 2-like isoform 
X1 [Phoenix dactylifera]
Length=308

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE+RP GMLVQKR PDS      P IRVRVKYG+ YHEI +SSQATFGELKK+L+  TG
Sbjct  37   EWEVRPSGMLVQKRDPDSAP-SLAPTIRVRVKYGAAYHEIYLSSQATFGELKKLLSSRTG  95

Query  517  MHHEDXKLLF  546
            +H ED KL++
Sbjct  96   LHPEDQKLIY  105



>gb|EPS70571.1| hypothetical protein M569_04192, partial [Genlisea aurea]
Length=228

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE+RPGGMLVQKR+   +       I VRVKYGSIYHEI I SQATFGELKKML+G TG
Sbjct  22   EWELRPGGMLVQKRAAHRD---FASMILVRVKYGSIYHEIHIRSQATFGELKKMLSGATG  78

Query  517  MHHEDXKLLF  546
            + H + KLLF
Sbjct  79   LDHHEQKLLF  88



>ref|XP_006399204.1| hypothetical protein EUTSA_v10014190mg [Eutrema salsugineum]
 gb|ESQ40657.1| hypothetical protein EUTSA_v10014190mg [Eutrema salsugineum]
Length=307

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 70/94 (74%), Gaps = 5/94 (5%)
 Frame = +1

Query  274  MLRMKTKTT---SPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSI  444
            M++MKT TT   S     GG S NEWE RPGGM+VQ+R+  S ++P    IRVRVKYGSI
Sbjct  1    MMKMKTGTTPSVSGGGGGGGSSGNEWESRPGGMIVQRRTDQSSDVPRV--IRVRVKYGSI  58

Query  445  YHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            Y EI+I+SQ+TFGELKK+L+  T +HHED K+L+
Sbjct  59   YLEININSQSTFGELKKLLSDQTRLHHEDMKILY  92



>gb|ABG73438.1| BAG domain-containing protein [Oryza brachyantha]
Length=332

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN-LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGMLVQKRSP+S+    P P IRV+VK+  +YHEI ++SQA+FGELKK+L+  T
Sbjct  34   EWEVRPGGMLVQKRSPESDAPAAPVPTIRVKVKFNGVYHEIYVNSQASFGELKKLLSAQT  93

Query  514  GMHHEDXKLLF  546
            G+H ED K+++
Sbjct  94   GLHPEDQKIVY  104



>ref|XP_011029180.1| PREDICTED: BAG family molecular chaperone regulator 2-like [Populus 
euphratica]
Length=358

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRS-PDSE-NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKR+  DS  N  P   I+VRVKYGS  HEISISSQA+FGELKKML   
Sbjct  34   EWEIRPGGMLVQKRTTADSNHNSVPVSTIKVRVKYGSSCHEISISSQASFGELKKMLAQH  93

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  94   TGVHHDDQKLIY  105



>gb|EAZ07876.1| hypothetical protein OsI_30134 [Oryza sativa Indica Group]
Length=305

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 7/74 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-----PNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            WE+RPGGMLVQKRSP+SE  PPP     P IRV+VKY  +YHEI I+SQA+FGELKK+L+
Sbjct  14   WEVRPGGMLVQKRSPESE--PPPGGAPVPTIRVKVKYNGVYHEIYINSQASFGELKKLLS  71

Query  505  GPTGMHHEDXKLLF  546
              TG+H +D K+++
Sbjct  72   EKTGLHPDDQKVVY  85



>dbj|BAD09231.1| putative BAG domain containing protein [Oryza sativa Japonica 
Group]
Length=316

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 7/74 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-----PNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            WE+RPGGMLVQKRSP+SE  PPP     P IRV+VKY  +YHEI I+SQA+FGELKK+L+
Sbjct  25   WEVRPGGMLVQKRSPESE--PPPGGAPVPTIRVKVKYNGVYHEIYINSQASFGELKKLLS  82

Query  505  GPTGMHHEDXKLLF  546
              TG+H +D K+++
Sbjct  83   EKTGLHPDDQKVVY  96



>ref|XP_006660860.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Oryza 
brachyantha]
Length=332

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN-LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGMLVQKRSP+S+    P P IRV+VK+  +YHEI ++SQA+FGELKK+L+  T
Sbjct  34   EWEVRPGGMLVQKRSPESDAPAAPVPTIRVKVKFNGVYHEIYVNSQASFGELKKLLSAQT  93

Query  514  GMHHEDXKLLF  546
            G+H ED K+++
Sbjct  94   GLHPEDQKIVY  104



>ref|XP_002304467.2| hypothetical protein POPTR_0003s12150g [Populus trichocarpa]
 gb|EEE79446.2| hypothetical protein POPTR_0003s12150g [Populus trichocarpa]
Length=302

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRS-PDSE-NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKR+  DS  N  P  NI+VRVKYGS+ HEISISSQA+FGELKKML   
Sbjct  32   EWEIRPGGMLVQKRTTADSNHNSVPVSNIKVRVKYGSLCHEISISSQASFGELKKMLAEH  91

Query  511  TGMHHEDXKLLF  546
            TG+H  D KL+F
Sbjct  92   TGVHPLDQKLIF  103



>ref|XP_008646348.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Zea 
mays]
 gb|AFW73730.1| hypothetical protein ZEAMMB73_962788 [Zea mays]
Length=320

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLP--PPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQ+RSPD++     P P IRV+VK+  +YHEI I+SQA+FGELKKML+  
Sbjct  35   EWEVRPGGMLVQRRSPDADAPAGAPVPTIRVKVKFNGVYHEIYINSQASFGELKKMLSVR  94

Query  511  TGMHHEDXKLLF  546
            TG+H ED KL++
Sbjct  95   TGLHPEDQKLVY  106



>ref|XP_010483939.1| PREDICTED: BAG family molecular chaperone regulator 2-like isoform 
X5 [Camelina sativa]
Length=202

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 58/70 (83%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            + E+RPGGM+VQKR+  S N+     IRVRVKYGS++HEISI+SQ++FGELKK L+G TG
Sbjct  17   DLELRPGGMVVQKRTDQSSNVSRV--IRVRVKYGSVHHEISINSQSSFGELKKKLSGATG  74

Query  517  MHHEDXKLLF  546
            +HH+D K+++
Sbjct  75   VHHQDMKIIY  84



>gb|EAZ43546.1| hypothetical protein OsJ_28168 [Oryza sativa Japonica Group]
Length=317

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 7/74 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-----PNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            WE+RPGGMLVQKRSP+SE  PPP     P IRV+VKY  +YHEI I+SQA+FGELKK+L+
Sbjct  14   WEVRPGGMLVQKRSPESE--PPPGGAPVPTIRVKVKYNGVYHEIYINSQASFGELKKLLS  71

Query  505  GPTGMHHEDXKLLF  546
              TG+H +D K+++
Sbjct  72   EKTGLHPDDQKVVY  85



>ref|XP_010919226.1| PREDICTED: BAG family molecular chaperone regulator 2-like isoform 
X2 [Elaeis guineensis]
Length=299

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            +WE+RPGGMLVQKR PDS      P IRVRVKYG+ YHEI +SSQ+TFGELKK+L+  +G
Sbjct  33   QWEVRPGGMLVQKRDPDSA--AAAPTIRVRVKYGAAYHEIYLSSQSTFGELKKLLSERSG  90

Query  517  MHHEDXKLLF  546
            +H ED K+++
Sbjct  91   LHPEDLKVVY  100



>ref|XP_010483934.1| PREDICTED: BAG family molecular chaperone regulator 2-like isoform 
X1 [Camelina sativa]
Length=290

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 58/70 (83%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            E E+RPGGM+VQKR+    N+P    IRVRVKYGS++HEISI+SQ++FGELKK L+G TG
Sbjct  17   ELELRPGGMVVQKRTDQISNVPRV--IRVRVKYGSVHHEISINSQSSFGELKKKLSGATG  74

Query  517  MHHEDXKLLF  546
            +HH+D K+++
Sbjct  75   VHHQDMKIIY  84



>ref|XP_009122361.1| PREDICTED: BAG family molecular chaperone regulator 3 [Brassica 
rapa]
Length=372

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 70/92 (76%), Gaps = 3/92 (3%)
 Frame = +1

Query  274  MLRMKTKTT-SPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYH  450
            M++M T TT S +    G S NEWE RPGGM+VQ+R+  + +   P  IRVRVKY S+YH
Sbjct  66   MMKMNTGTTPSLSVGGSGVSGNEWESRPGGMVVQRRTDLTSD--APRVIRVRVKYLSVYH  123

Query  451  EISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            EI+I+SQ++FGELKK+L+G TG+HHED K+L+
Sbjct  124  EININSQSSFGELKKVLSGQTGLHHEDMKILY  155



>ref|XP_002864772.1| BCL-2-associated athanogene 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41031.1| BCL-2-associated athanogene 2 [Arabidopsis lyrata subsp. lyrata]
Length=282

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 59/70 (84%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            E E+RPGGM+VQKR+  S  +P    IRVRVKYGS++HEISI+SQ+TFGELKK+L+G TG
Sbjct  14   ELELRPGGMVVQKRTEHSSGVPRV--IRVRVKYGSVHHEISINSQSTFGELKKILSGATG  71

Query  517  MHHEDXKLLF  546
            +HH+D K+++
Sbjct  72   VHHQDMKIIY  81



>tpg|DAA48370.1| TPA: hypothetical protein ZEAMMB73_960791 [Zea mays]
Length=180

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 59/74 (80%), Gaps = 7/74 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-----PNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            WE+RPGGMLVQKRSPD++  PPP     P IRV+VK+  +YHEI I+SQA+FGELKK+L+
Sbjct  27   WEVRPGGMLVQKRSPDAD--PPPGGAPVPTIRVKVKFNGVYHEIYINSQASFGELKKLLS  84

Query  505  GPTGMHHEDXKLLF  546
              TG+H +D K+++
Sbjct  85   EKTGLHPDDQKVVY  98



>ref|NP_001242681.1| uncharacterized protein LOC100792005 [Glycine max]
 gb|ACU18631.1| unknown [Glycine max]
Length=270

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPD-SENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGMLVQKR+ D ++N      I+V+VKY S YH+I ISS A+FGELKKMLT PT
Sbjct  20   EWELRPGGMLVQKRNLDLNQNSASKSTIKVKVKYSSSYHQIQISSHASFGELKKMLTEPT  79

Query  514  GMHHEDXKLLF  546
            G+H +D KL++
Sbjct  80   GLHIQDQKLIY  90



>ref|XP_008803268.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Phoenix 
dactylifera]
 ref|XP_008803269.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Phoenix 
dactylifera]
 ref|XP_008803270.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Phoenix 
dactylifera]
 ref|XP_008803272.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Phoenix 
dactylifera]
Length=299

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            +WE+RPGGMLVQKR PDS  +   P IRVRVKYG+ YHEI +SSQ+TFGELKK+L+   G
Sbjct  33   QWEVRPGGMLVQKRDPDS--VAAAPTIRVRVKYGAAYHEIYLSSQSTFGELKKLLSERIG  90

Query  517  MHHEDXKLLF  546
            +H ED K+++
Sbjct  91   LHPEDLKVVY  100



>ref|XP_010919225.1| PREDICTED: BAG family molecular chaperone regulator 2-like isoform 
X1 [Elaeis guineensis]
Length=304

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            +WE+RPGGMLVQKR PDS      P IRVRVKYG+ YHEI +SSQ+TFGELKK+L+  +G
Sbjct  33   QWEVRPGGMLVQKRDPDSA--AAAPTIRVRVKYGAAYHEIYLSSQSTFGELKKLLSERSG  90

Query  517  MHHEDXKLLF  546
            +H ED K+++
Sbjct  91   LHPEDLKVVY  100



>ref|NP_001150807.1| protein binding protein [Zea mays]
 gb|ACG40502.1| protein binding protein [Zea mays]
Length=308

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTGM  519
            WE+RPGGMLVQKRSPD++  PP P IRV+VK+  +YHEI I+SQA+FGELKK+++  TG+
Sbjct  27   WEVRPGGMLVQKRSPDADP-PPVPTIRVKVKFNGVYHEIYINSQASFGELKKLVSEKTGL  85

Query  520  HHEDXKLLF  546
            H +D K+++
Sbjct  86   HPDDQKVVY  94



>gb|AFW65014.1| protein binding protein [Zea mays]
Length=309

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTGM  519
            WE+RPGGMLVQKRSPD++  PP P IRV+VK+  +YHEI I+SQA+FGELKK+++  TG+
Sbjct  28   WEVRPGGMLVQKRSPDADP-PPVPTIRVKVKFNGVYHEIYINSQASFGELKKLVSEKTGL  86

Query  520  HHEDXKLLF  546
            H +D K+++
Sbjct  87   HPDDQKVVY  95



>dbj|BAK08177.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97784.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=349

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN--LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKR PDS+     P P +R++VK+  + HEI I+SQA+FGELKKM++  
Sbjct  33   EWEVRPGGMLVQKRGPDSDAPAGAPVPTVRLKVKFNGVSHEIYINSQASFGELKKMMSDK  92

Query  511  TGMHHEDXKLLF  546
            TG+HHED K+L+
Sbjct  93   TGLHHEDQKVLY  104



>ref|XP_010483940.1| PREDICTED: BAG family molecular chaperone regulator 2-like isoform 
X6 [Camelina sativa]
Length=290

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 58/70 (83%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            E E+RPGGM+VQKR+    N+P    IRVRVKYGS++HEISI+SQ++FGELKK L+G TG
Sbjct  17   ELELRPGGMVVQKRTDQISNVPRV--IRVRVKYGSVHHEISINSQSSFGELKKKLSGATG  74

Query  517  MHHEDXKLLF  546
            +HH+D K+++
Sbjct  75   VHHQDMKIIY  84



>ref|XP_003549864.2| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X1 [Glycine max]
 gb|KHN14122.1| BAG family molecular chaperone regulator 1 [Glycine soja]
Length=336

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPD-SENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGM+VQKR+ D ++N      I+V+VKYGS YH+I ISS A+FGELKKMLT PT
Sbjct  82   EWELRPGGMVVQKRNSDLNQNSASKFTIKVKVKYGSSYHQIQISSHASFGELKKMLTEPT  141

Query  514  GMHHEDXKLLF  546
            G+H +D KL++
Sbjct  142  GLHVQDQKLIY  152



>ref|XP_011014081.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Populus 
euphratica]
Length=260

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR+   + +PPP N+R+RV YG + +EIS++SQATFGE+KK+LTG  G
Sbjct  33   EWEMRPGGMLVQKRNEKDDGVPPPLNVRLRVLYGVLRYEISVNSQATFGEVKKVLTGKIG  92

Query  517  MHHEDXKLLF  546
            +   D K+++
Sbjct  93   LQIGDQKIIY  102



>ref|XP_010458257.1| PREDICTED: BAG family molecular chaperone regulator 2-like isoform 
X1 [Camelina sativa]
Length=295

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 58/70 (83%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            E E+RPGGM+VQKR+    N+P    IRVRVKYGS++HEISI+SQ++FGELKK L+G TG
Sbjct  17   ELELRPGGMVVQKRTDQISNVPRV--IRVRVKYGSVHHEISINSQSSFGELKKKLSGATG  74

Query  517  MHHEDXKLLF  546
            +HH+D K+++
Sbjct  75   VHHQDMKIIY  84



>ref|XP_002444634.1| hypothetical protein SORBIDRAFT_07g025170 [Sorghum bicolor]
 gb|EES14129.1| hypothetical protein SORBIDRAFT_07g025170 [Sorghum bicolor]
Length=329

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 59/74 (80%), Gaps = 7/74 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-----PNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            WE+RPGGMLVQKRSPD++  PPP     P IRV+VK+  +YHEI I+SQA+FGELKK+L+
Sbjct  29   WEVRPGGMLVQKRSPDTD--PPPGGAPVPTIRVKVKFNGVYHEIYINSQASFGELKKLLS  86

Query  505  GPTGMHHEDXKLLF  546
              TG+H +D K+++
Sbjct  87   EKTGLHPDDQKVVY  100



>gb|ADT78385.1| BCL-2-associated athanogene 3 [Triticum aestivum]
Length=353

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN--LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKR PDS+     P P +R++VK+  + HEI I+SQA+FGELKKM++  
Sbjct  36   EWEVRPGGMLVQKRDPDSDAPAGAPVPTVRLKVKFNGVSHEIYINSQASFGELKKMMSEK  95

Query  511  TGMHHEDXKLLF  546
            TG+HHED K+L+
Sbjct  96   TGLHHEDQKVLY  107



>ref|XP_008664486.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Zea 
mays]
Length=253

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN--LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPG MLVQ+RSPD++     P P IRV+VK+  +YHEI I SQA+FGELKKML+  
Sbjct  23   EWEVRPGRMLVQRRSPDADAPAGAPVPTIRVKVKFNGVYHEIYIKSQASFGELKKMLSAR  82

Query  511  TGMHHEDXKLLF  546
            TG+H ED KL++
Sbjct  83   TGLHPEDQKLVY  94



>ref|XP_008677333.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 gb|AFW65013.1| hypothetical protein ZEAMMB73_491693 [Zea mays]
Length=343

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTGM  519
            WE+RPGGMLVQKRSPD++  PP P IRV+VK+  +YHEI I+SQA+FGELKK+++  TG+
Sbjct  28   WEVRPGGMLVQKRSPDADP-PPVPTIRVKVKFNGVYHEIYINSQASFGELKKLVSEKTGL  86

Query  520  HHEDXKLLF  546
            H +D K+++
Sbjct  87   HPDDQKVVY  95



>gb|AFW21574.1| hypothetical protein ZEAMMB73_142939 [Zea mays]
Length=257

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN--LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPG MLVQ+RSPD++     P P IRV+VK+  +YHEI I SQA+FGELKKML+  
Sbjct  23   EWEVRPGRMLVQRRSPDADAPAGAPVPTIRVKVKFNGVYHEIYIKSQASFGELKKMLSAR  82

Query  511  TGMHHEDXKLLF  546
            TG+H ED KL++
Sbjct  83   TGLHPEDQKLVY  94



>ref|XP_010444072.1| PREDICTED: BAG family molecular chaperone regulator 2-like isoform 
X1 [Camelina sativa]
Length=293

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 69/91 (76%), Gaps = 7/91 (8%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHE  453
            M++M++ TT   + +G     E E+RPGGM+VQKR+  S N+P    IRVRVKYGS++HE
Sbjct  1    MMKMQSGTTGKTSGDG-----ELELRPGGMVVQKRTDQSSNVPRV--IRVRVKYGSVHHE  53

Query  454  ISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            ISI+SQ++FGELKK L+G  G+HH+D K+++
Sbjct  54   ISINSQSSFGELKKKLSGVLGVHHQDMKIIY  84



>ref|NP_568950.2| BCL-2-associated athanogene 2 [Arabidopsis thaliana]
 sp|Q0WPX7.1|BAG2_ARATH RecName: Full=BAG family molecular chaperone regulator 2; AltName: 
Full=Bcl-2-associated athanogene 2 [Arabidopsis thaliana]
 dbj|BAF00822.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97563.1| BCL-2-associated athanogene 2 [Arabidopsis thaliana]
Length=285

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 60/70 (86%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            E E+RPGGM+VQKR+  S ++P    IRVRVKYGS++HEISI+SQ+TFGELKK+L+G TG
Sbjct  15   EMELRPGGMVVQKRTDHSSSVPR--GIRVRVKYGSVHHEISINSQSTFGELKKILSGATG  72

Query  517  MHHEDXKLLF  546
            +HH+D ++++
Sbjct  73   VHHQDMQIIY  82



>ref|XP_004294033.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Fragaria 
vesca subsp. vesca]
Length=254

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR   S ++ P PN+R+R+ +G++ +EIS SSQ+TFGELKK+LT  TG
Sbjct  26   EWEMRPGGMLVQKRVDKSSDVVPAPNLRLRIAFGALRYEISASSQSTFGELKKVLTAETG  85

Query  517  MHHEDXKLLF  546
            +   D +L+F
Sbjct  86   LQPGDQRLIF  95



>gb|EMS50479.1| hypothetical protein TRIUR3_24271 [Triticum urartu]
Length=273

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSP--DSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKR P  D+    P P IR++VK+ ++ HEI ISSQA+FGE+KKM++  
Sbjct  22   EWEVRPGGMLVQKRDPGSDAPAGAPVPTIRLKVKFNAVSHEIYISSQASFGEVKKMMSEK  81

Query  511  TGMHHEDXKLLF  546
            TG+HHED K+L+
Sbjct  82   TGLHHEDQKVLY  93



>tpg|DAA48371.1| TPA: hypothetical protein ZEAMMB73_960791 [Zea mays]
Length=320

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 59/74 (80%), Gaps = 7/74 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-----PNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            WE+RPGGMLVQKRSPD++  PPP     P IRV+VK+  +YHEI I+SQA+FGELKK+L+
Sbjct  27   WEVRPGGMLVQKRSPDAD--PPPGGAPVPTIRVKVKFNGVYHEIYINSQASFGELKKLLS  84

Query  505  GPTGMHHEDXKLLF  546
              TG+H +D K+++
Sbjct  85   EKTGLHPDDQKVVY  98



>gb|AAM62536.1| unknown [Arabidopsis thaliana]
Length=293

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 60/70 (86%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            E E+RPGGM+VQKR+  S ++P    IRVRVKYGS++HEISI+SQ+TFGELKK+L+G TG
Sbjct  12   EMELRPGGMVVQKRTDHSSSVPR--GIRVRVKYGSVHHEISINSQSTFGELKKILSGATG  69

Query  517  MHHEDXKLLF  546
            +HH+D ++++
Sbjct  70   VHHQDMQIIY  79



>ref|NP_851246.1| BCL-2-associated athanogene 2 [Arabidopsis thaliana]
 gb|AED97562.1| BCL-2-associated athanogene 2 [Arabidopsis thaliana]
Length=296

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 60/70 (86%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            E E+RPGGM+VQKR+  S ++P    IRVRVKYGS++HEISI+SQ+TFGELKK+L+G TG
Sbjct  15   EMELRPGGMVVQKRTDHSSSVPR--GIRVRVKYGSVHHEISINSQSTFGELKKILSGATG  72

Query  517  MHHEDXKLLF  546
            +HH+D ++++
Sbjct  73   VHHQDMQIIY  82



>gb|KEH31705.1| BAG family molecular chaperone regulator-like protein [Medicago 
truncatula]
Length=280

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE+RPGGMLVQKR+ D  N      I+V+VKYGS YH+I ISS A+FGELKKMLT  TG
Sbjct  32   EWELRPGGMLVQKRNSDVNN-NFSSIIKVKVKYGSSYHQIHISSHASFGELKKMLTESTG  90

Query  517  MHHEDXKLLF  546
            +H +D KL+F
Sbjct  91   LHVQDQKLIF  100



>ref|XP_010483936.1| PREDICTED: BAG family molecular chaperone regulator 2-like isoform 
X2 [Camelina sativa]
Length=290

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 58/70 (83%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            + E+RPGGM+VQKR+  S N+     IRVRVKYGS++HEISI+SQ++FGELKK L+G TG
Sbjct  17   DLELRPGGMVVQKRTDQSSNVSRV--IRVRVKYGSVHHEISINSQSSFGELKKKLSGATG  74

Query  517  MHHEDXKLLF  546
            +HH+D K+++
Sbjct  75   VHHQDMKIIY  84



>ref|NP_001062419.2| Os08g0546100 [Oryza sativa Japonica Group]
 dbj|BAF24333.2| Os08g0546100 [Oryza sativa Japonica Group]
Length=501

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 7/74 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-----PNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            WE+RPGGMLVQKRSP+SE  PPP     P IRV+VKY  +YHEI I+SQA+FGELKK+L+
Sbjct  210  WEVRPGGMLVQKRSPESE--PPPGGAPVPTIRVKVKYNGVYHEIYINSQASFGELKKLLS  267

Query  505  GPTGMHHEDXKLLF  546
              TG+H +D K+++
Sbjct  268  EKTGLHPDDQKVVY  281



>ref|XP_004957405.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Setaria 
italica]
Length=337

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSEN--LPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKRS D++     P P IRV+VK+  +YHEI I+SQA+FGELKK+L+  
Sbjct  36   EWEVRPGGMLVQKRSSDADAPAGAPVPTIRVKVKFNGVYHEIYINSQASFGELKKLLSTR  95

Query  511  TGMHHEDXKLLF  546
            TG+H ED KL++
Sbjct  96   TGLHPEDQKLVY  107



>gb|EMT32730.1| hypothetical protein F775_28565 [Aegilops tauschii]
Length=323

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 58/74 (78%), Gaps = 7/74 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-----PNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            WE+RP GMLVQKR+PDS+  PPP     P IRV+VKY  +YHE+ I+SQA+FGELKK+++
Sbjct  28   WEVRPSGMLVQKRTPDSD--PPPGGAPVPTIRVKVKYAGVYHEVYINSQASFGELKKLMS  85

Query  505  GPTGMHHEDXKLLF  546
              TG+H +D K+++
Sbjct  86   EKTGLHPDDQKVVY  99



>ref|XP_009391950.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Musa 
acuminata subsp. malaccensis]
Length=319

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-PNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            WE+RP GMLVQKR  D++    P P IRV+VK+GS+YHEI +SSQATFGELKK L+  TG
Sbjct  28   WEVRPCGMLVQKRGADADATAAPVPTIRVKVKHGSVYHEIYVSSQATFGELKKALSAKTG  87

Query  517  MHHEDXKLLF  546
            +H  D KLL+
Sbjct  88   LHPLDMKLLY  97



>dbj|BAJ89114.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 58/74 (78%), Gaps = 7/74 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-----PNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            WE+RP GMLVQKR+PDS+  PPP     P IRV+VKY  +YHE+ I+SQA+FGELKK+++
Sbjct  34   WEVRPSGMLVQKRTPDSD--PPPGGAPVPTIRVKVKYAGVYHEVYINSQASFGELKKLMS  91

Query  505  GPTGMHHEDXKLLF  546
              TG+H +D K+++
Sbjct  92   EKTGLHPDDQKVVY  105



>dbj|BAJ89060.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 58/74 (78%), Gaps = 7/74 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-----PNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            WE+RP GMLVQKR+PDS+  PPP     P IRV+VKY  +YHE+ I+SQA+FGELKK+++
Sbjct  34   WEVRPSGMLVQKRTPDSD--PPPGGAPVPTIRVKVKYAGVYHEVYINSQASFGELKKLMS  91

Query  505  GPTGMHHEDXKLLF  546
              TG+H +D K+++
Sbjct  92   EKTGLHPDDQKVVY  105



>dbj|BAB11054.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABN04779.1| At5g52060 [Arabidopsis thaliana]
Length=326

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 63/72 (88%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPN--IRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            + E+RPGGMLVQKR+PD + + PPP   IRVR+KYG++YHEI+IS QA+FGELKKMLTGP
Sbjct  23   DLEIRPGGMLVQKRNPDLDPVGPPPPPMIRVRIKYGAVYHEINISPQASFGELKKMLTGP  82

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  83   TGIHHQDQKLMY  94



>ref|XP_004974079.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Setaria 
italica]
Length=323

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 7/74 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-----PNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            WE+RPGGMLVQKRSPD++  PPP     P IRV+VK   +YHEI I+SQA+FGELKK+L+
Sbjct  29   WEVRPGGMLVQKRSPDAD--PPPGGAPVPTIRVKVKCNGVYHEIYINSQASFGELKKLLS  86

Query  505  GPTGMHHEDXKLLF  546
              TG+H +D K+++
Sbjct  87   EKTGLHPDDQKVVY  100



>gb|ACU29544.1| BCL-2-associated athanogene [Triticum aestivum]
Length=323

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 58/74 (78%), Gaps = 7/74 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-----PNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            WE+RP GMLVQKR+PDS+  PPP     P IRV+VKY S+YHE+  +SQA+FGELKK+++
Sbjct  28   WEVRPSGMLVQKRTPDSD--PPPGGAPVPTIRVKVKYASVYHEVYTNSQASFGELKKLMS  85

Query  505  GPTGMHHEDXKLLF  546
              TG+H +D K+++
Sbjct  86   EKTGLHPDDQKVVY  99



>ref|XP_004515797.1| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X2 [Cicer arietinum]
Length=227

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE+RPGGMLVQKR+ D  N      I+V+VKYGS Y++I ISS A+FGELKKMLT  TG
Sbjct  40   EWELRPGGMLVQKRNSDVNN--KTSTIKVKVKYGSSYYQIHISSHASFGELKKMLTEYTG  97

Query  517  MHHEDXKLLF  546
            +H  D KL+F
Sbjct  98   LHVLDQKLIF  107



>ref|NP_200019.2| BCL-2-associated athanogene 1 [Arabidopsis thaliana]
 sp|Q0WUQ1.1|BAG1_ARATH RecName: Full=BAG family molecular chaperone regulator 1; AltName: 
Full=Bcl-2-associated athanogene 1 [Arabidopsis thaliana]
 dbj|BAE99147.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96167.1| BCL-2-associated athanogene 1 [Arabidopsis thaliana]
Length=342

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 63/72 (88%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPN--IRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            + E+RPGGMLVQKR+PD + + PPP   IRVR+KYG++YHEI+IS QA+FGELKKMLTGP
Sbjct  39   DLEIRPGGMLVQKRNPDLDPVGPPPPPMIRVRIKYGAVYHEINISPQASFGELKKMLTGP  98

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  99   TGIHHQDQKLMY  110



>ref|XP_009392353.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Musa 
acuminata subsp. malaccensis]
Length=318

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE-NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGMLVQ R+PD++    P P IRV+VK+G++YHEI ISSQATFG+LK  ++  T
Sbjct  28   EWEVRPGGMLVQMRNPDADFTAAPVPTIRVKVKFGAVYHEIYISSQATFGDLKMAVSART  87

Query  514  GMHHEDXKLLF  546
            G+H  D KL++
Sbjct  88   GVHPLDMKLMY  98



>ref|XP_007023111.1| BCL-2-associated athanogene 1, putative [Theobroma cacao]
 gb|EOY25733.1| BCL-2-associated athanogene 1, putative [Theobroma cacao]
Length=297

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKR-SPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+ PGGMLVQKR S  +++  P P IRVRVK+GS YHEI +SSQA+FGELKKML   T
Sbjct  30   EWEVTPGGMLVQKRDSSSNQSSVPIPTIRVRVKHGSTYHEIRVSSQASFGELKKMLADHT  89

Query  514  GMHHEDXKLLF  546
            G+H  D KL++
Sbjct  90   GLHPLDQKLIY  100



>ref|XP_004515796.1| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X1 [Cicer arietinum]
Length=285

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE+RPGGMLVQKR+ D  N      I+V+VKYGS Y++I ISS A+FGELKKMLT  TG
Sbjct  40   EWELRPGGMLVQKRNSDVNN--KTSTIKVKVKYGSSYYQIHISSHASFGELKKMLTEYTG  97

Query  517  MHHEDXKLLF  546
            +H  D KL+F
Sbjct  98   LHVLDQKLIF  107



>ref|XP_011033801.1| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X2 [Populus euphratica]
Length=302

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKR-SPDSE-NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKR + DS  N  P  NI+VRVK GS  HEISISSQA+FGELKKML   
Sbjct  32   EWEIRPGGMLVQKRNTADSNHNSVPVSNIKVRVKCGSSCHEISISSQASFGELKKMLAEH  91

Query  511  TGMHHEDXKLLF  546
            TG+H  D KL+F
Sbjct  92   TGVHPLDQKLIF  103



>ref|XP_006280889.1| hypothetical protein CARUB_v10026882mg [Capsella rubella]
 gb|EOA13787.1| hypothetical protein CARUB_v10026882mg [Capsella rubella]
Length=296

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 57/70 (81%), Gaps = 1/70 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            E E+RPGGM+VQKR+ D  +   P  IRVRVKYGS++HEISI+SQ+TFGELKK L+G T 
Sbjct  17   ELELRPGGMVVQKRA-DQSSSNVPRVIRVRVKYGSVHHEISINSQSTFGELKKKLSGATR  75

Query  517  MHHEDXKLLF  546
            +HH+D K+++
Sbjct  76   VHHQDMKIIY  85



>ref|XP_009393412.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Musa 
acuminata subsp. malaccensis]
Length=297

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 5/73 (7%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPP---PNIRVRVKYGSIYHEISISSQATFGELKKMLTG  507
            EWE+ PGGM+VQKR P+S   PP    P IRV+VK+GS+YHEI I SQATFGELKKML+ 
Sbjct  21   EWEVTPGGMVVQKRDPESG--PPAAVVPTIRVKVKHGSVYHEIYIGSQATFGELKKMLSA  78

Query  508  PTGMHHEDXKLLF  546
              GMH  D KL++
Sbjct  79   RIGMHPLDQKLIY  91



>ref|XP_006853020.1| hypothetical protein AMTR_s00174p00056430 [Amborella trichopoda]
 gb|ERN14487.1| hypothetical protein AMTR_s00174p00056430 [Amborella trichopoda]
Length=161

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 60/98 (61%), Gaps = 7/98 (7%)
 Frame = +1

Query  274  MLRMKTKTTSPaaangggs-----anEWEMRPGGMLVQKRSPDSENL--PPPPNIRVRVK  432
            M+R++ KT  P   N   +       +WE+RP GMLVQKR   S  +   P P IRVR K
Sbjct  1    MMRIRAKTPGPMTMNESSTGNGSEKMDWELRPEGMLVQKRCLGSNQVSSAPTPTIRVRAK  60

Query  433  YGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            YG++ HEI ISSQA FGELKK L   T +H +D KLLF
Sbjct  61   YGALIHEIHISSQAAFGELKKFLALETKLHTQDQKLLF  98



>ref|XP_011033800.1| PREDICTED: BAG family molecular chaperone regulator 2-like isoform 
X1 [Populus euphratica]
Length=358

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKR-SPDSE-NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            EWE+RPGGMLVQKR + DS  N  P  NI+VRVK GS  HEISISSQA+FGELKKML   
Sbjct  32   EWEIRPGGMLVQKRNTADSNHNSVPVSNIKVRVKCGSSCHEISISSQASFGELKKMLAEH  91

Query  511  TGMHHEDXKLLF  546
            TG+H  D KL+F
Sbjct  92   TGVHPLDQKLIF  103



>gb|EMS57176.1| hypothetical protein TRIUR3_33832 [Triticum urartu]
Length=370

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 58/74 (78%), Gaps = 7/74 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-----PNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            WE+RP GMLVQKR+PDS+  PPP     P IRV+VKY  +YHE+ I+SQA+FGELKK+++
Sbjct  96   WEVRPSGMLVQKRTPDSD--PPPGGAPVPTIRVKVKYAGVYHEVYINSQASFGELKKLMS  153

Query  505  GPTGMHHEDXKLLF  546
              TG+H +D K+++
Sbjct  154  EKTGLHPDDQKVVY  167



>ref|XP_007210065.1| hypothetical protein PRUPE_ppa021099mg [Prunus persica]
 gb|EMJ11264.1| hypothetical protein PRUPE_ppa021099mg [Prunus persica]
Length=299

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 7/74 (9%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRS----PDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            + E+RPGGMLVQKR+    P S ++PP   I+VRVKYGS YHEI IS QA+FGELKKML 
Sbjct  30   DLEIRPGGMLVQKRNAEMNPSSVSIPP---IKVRVKYGSSYHEIRISPQASFGELKKMLA  86

Query  505  GPTGMHHEDXKLLF  546
             PT +HH D KL+F
Sbjct  87   EPTKLHHLDQKLIF  100



>ref|XP_008238779.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Prunus 
mume]
Length=299

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 7/74 (9%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRS----PDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            + E+RPGGMLVQKR+    P S ++PP   I+VRVKYGS YHEI IS QA+FGELKKML 
Sbjct  30   DLEIRPGGMLVQKRNAEMNPSSVSIPP---IKVRVKYGSSYHEIRISPQASFGELKKMLA  86

Query  505  GPTGMHHEDXKLLF  546
             PT +HH D KL+F
Sbjct  87   EPTKLHHLDQKLIF  100



>gb|ABK26055.1| unknown [Picea sitchensis]
Length=254

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPP-PNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            +WE+RPGGMLVQ+R PD++    P P I+VRV +GS  HE+S+S QATFGELKK+L   T
Sbjct  31   DWEVRPGGMLVQRRDPDADQESAPCPKIKVRVTHGSSLHEVSVSMQATFGELKKLLAPET  90

Query  514  GMHHEDXKLLF  546
            G+  +D KL+F
Sbjct  91   GLEPQDQKLIF  101



>ref|XP_010052010.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Eucalyptus 
grandis]
 gb|KCW75857.1| hypothetical protein EUGRSUZ_D00246 [Eucalyptus grandis]
Length=356

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE RPGGMLVQKR  ++ +LP  PN+RVRV YG I +EIS++SQATFGELKK+L   TG
Sbjct  121  EWERRPGGMLVQKRD-ENPDLPAAPNVRVRVAYGKIRYEISVNSQATFGELKKLLAAETG  179

Query  517  MHHEDXKLLF  546
            +   + +L F
Sbjct  180  LQAAEQRLAF  189



>ref|XP_006399203.1| hypothetical protein EUTSA_v10014190mg [Eutrema salsugineum]
 gb|ESQ40656.1| hypothetical protein EUTSA_v10014190mg [Eutrema salsugineum]
Length=306

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 6/94 (6%)
 Frame = +1

Query  274  MLRMKTKTT---SPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSI  444
            M++MKT TT   S     GG S NEWE RPGGM+VQ+R+  S ++P    IRVRVKYGSI
Sbjct  1    MMKMKTGTTPSVSGGGGGGGSSGNEWESRPGGMIVQRRTDQSSDVPRV--IRVRVKYGSI  58

Query  445  YHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            Y EI+I+SQ+TF ELKK+L+  T +HHED K+L+
Sbjct  59   YLEININSQSTF-ELKKLLSDQTRLHHEDMKILY  91



>ref|XP_011073883.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Sesamum 
indicum]
Length=285

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTGM  519
             E+RPGGMLVQKR+ D+ N    P I+VRVKYGS +HEI++S +ATFGELKK+L GPTG+
Sbjct  34   LEIRPGGMLVQKRTSDA-NHNSNPKIKVRVKYGSSHHEIALSPEATFGELKKLLAGPTGL  92

Query  520  HHEDXKLLF  546
              +D KL+F
Sbjct  93   RPQDQKLVF  101



>ref|XP_006369981.1| hypothetical protein POPTR_0001s36860g [Populus trichocarpa]
 gb|ERP66550.1| hypothetical protein POPTR_0001s36860g [Populus trichocarpa]
Length=213

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR+   + +PP  N+R+R+ +G + +EIS++SQATFGE+KK+L G TG
Sbjct  33   EWEMRPGGMLVQKRNDKDDCVPPLLNVRLRILHGVLRYEISVNSQATFGEVKKVLMGKTG  92

Query  517  MHHEDXKLLF  546
            +   D K+++
Sbjct  93   LQIGDQKIIY  102



>ref|XP_002280537.1| PREDICTED: BAG family molecular chaperone regulator 3 [Vitis 
vinifera]
Length=256

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR+  S++L P  N+ +RV YG++ +EIS++SQATFGELKK+LT  TG
Sbjct  30   EWEMRPGGMLVQKRTEKSDSLAP--NLLIRVAYGALRYEISVNSQATFGELKKLLTAETG  87

Query  517  MHHEDXKLLF  546
            +   + +L+F
Sbjct  88   LQPGEQRLIF  97



>emb|CAN67094.1| hypothetical protein VITISV_016805 [Vitis vinifera]
Length=319

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR+  S++L P  N+ +RV YG++ +EIS++SQATFGELKK+LT  TG
Sbjct  31   EWEMRPGGMLVQKRTEKSDSLAP--NLLIRVAYGALRYEISVNSQATFGELKKLLTAETG  88

Query  517  MHHEDXKLLF  546
            +   + +L+F
Sbjct  89   LQPGEQRLIF  98



>ref|NP_001292194.1| BAG family molecular chaperone regulator 2 [Fragaria vesca]
 gb|AFK10142.1| BAG protein [Fragaria vesca]
Length=300

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE-NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            + E+RP GMLVQKR+ ++       P IRVRVKYGS YHEISISS A+FGELKKML  PT
Sbjct  30   DLEIRPCGMLVQKRNGETNPTSISIPIIRVRVKYGSSYHEISISSHASFGELKKMLARPT  89

Query  514  GMHHEDXKLLF  546
             +HHED KL++
Sbjct  90   KLHHEDQKLIY  100



>gb|KDP25508.1| hypothetical protein JCGZ_20664 [Jatropha curcas]
Length=306

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = +1

Query  271  RMLRMKTKTTSPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPP--NIRVRVKYGSI  444
            R  R  T   +P          + E+RPGGMLVQKR+ +S  + P P   I+V+VKYGS 
Sbjct  10   RTFRPPTNNKNPFDGRSNIKVEDMEIRPGGMLVQKRNSNSNQINPVPIPTIKVKVKYGSS  69

Query  445  YHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
             H+I ISSQA+FG+LKK+L   TG+HH+D KL++
Sbjct  70   THQICISSQASFGQLKKILAEHTGVHHQDQKLIY  103



>ref|XP_011085223.1| PREDICTED: BAG family molecular chaperone regulator 2-like [Sesamum 
indicum]
Length=257

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKRS +S+ L  PPN+R+RV YG+  ++IS +SQ+TFGELKK+L   TG
Sbjct  26   EWEMRPGGMLVQKRSDNSQ-LIAPPNLRIRVAYGAARYQISANSQSTFGELKKLLAVETG  84

Query  517  MHHEDXKLLF  546
            +   + +L+F
Sbjct  85   LEPGEQRLIF  94



>ref|XP_010933886.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Elaeis 
guineensis]
Length=301

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDS-ENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            WE+RPGGMLVQKR PDS     P   IR+RVKYG+ YHEI +SSQ+TFGELKK+L+   G
Sbjct  36   WEVRPGGMLVQKRDPDSTAAAAPASTIRLRVKYGAAYHEIYLSSQSTFGELKKLLSERIG  95

Query  517  MHHEDXKLLF  546
            +H +D K+++
Sbjct  96   LHPQDQKVMY  105



>gb|KCW75858.1| hypothetical protein EUGRSUZ_D00246 [Eucalyptus grandis]
Length=356

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWE RPGGMLVQKR  ++ +LP  PN+RVRV YG I +EIS++SQATFG LKK+L   TG
Sbjct  121  EWERRPGGMLVQKRD-ENPDLPAAPNVRVRVAYGKIRYEISVNSQATFGTLKKLLAAETG  179

Query  517  MHHEDXKLLF  546
            +   + +L F
Sbjct  180  LQAAEQRLAF  189



>ref|XP_006655733.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Oryza 
brachyantha]
Length=351

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 4/73 (5%)
 Frame = +1

Query  340  WEMRPGGMLVQKR--SPDSE--NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTG  507
            WE+RPGGMLVQKR  + D E  N+ P P IRV+VK+  I HEI I+SQA+FGELKKM+  
Sbjct  53   WEVRPGGMLVQKRGGAADEEPVNVKPVPTIRVKVKHAGITHEIYINSQASFGELKKMVAA  112

Query  508  PTGMHHEDXKLLF  546
             TG+H +D K+++
Sbjct  113  RTGLHPDDQKVMY  125



>ref|XP_004174122.1| PREDICTED: BAG family molecular chaperone regulator 3-like, partial 
[Cucumis sativus]
Length=176

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR+  SE+  PPP + +RV +G++  EISISS+ATFGELK++LT  TG
Sbjct  45   EWEMRPGGMLVQKRTDKSES--PPPTLHLRVAFGAVRVEISISSKATFGELKRVLTAETG  102

Query  517  MHHEDXKLLF  546
            +  E  K+++
Sbjct  103  LEVEAQKVIY  112



>ref|XP_004135718.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Cucumis 
sativus]
Length=324

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR+  SE+  PPP + +RV +G++  EISISS+ATFGELK++LT  TG
Sbjct  45   EWEMRPGGMLVQKRTDKSES--PPPTLHLRVAFGAVRVEISISSKATFGELKRVLTAETG  102

Query  517  MHHEDXKLLF  546
            +  E  K+++
Sbjct  103  LEVEAQKVIY  112



>gb|KGN65887.1| hypothetical protein Csa_1G537370 [Cucumis sativus]
Length=277

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR+  SE+  PPP + +RV +G++  EISISS+ATFGELK++LT  TG
Sbjct  45   EWEMRPGGMLVQKRTDKSES--PPPTLHLRVAFGAVRVEISISSKATFGELKRVLTAETG  102

Query  517  MHHEDXKLLF  546
            +  E  K+++
Sbjct  103  LEVEAQKVIY  112



>ref|XP_009377924.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Pyrus 
x bretschneideri]
Length=301

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 7/72 (10%)
 Frame = +1

Query  343  EMRPGGMLVQKRS----PDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            E+RPGGMLVQKR+    P S ++P    I++RV+YGS YHEI ISSQA+FGELKKML  P
Sbjct  33   EIRPGGMLVQKRTVEMNPSSVSIP---TIKIRVRYGSSYHEILISSQASFGELKKMLAEP  89

Query  511  TGMHHEDXKLLF  546
            T +HH D KL++
Sbjct  90   TKLHHLDQKLIY  101



>ref|XP_009344264.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Pyrus 
x bretschneideri]
Length=301

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 7/72 (10%)
 Frame = +1

Query  343  EMRPGGMLVQKRS----PDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            E+RPGGMLVQKR+    P S ++P    I++RV+YGS YHEI ISSQA+FGELKKML  P
Sbjct  33   EIRPGGMLVQKRTVEMNPSSVSIP---TIKIRVRYGSSYHEILISSQASFGELKKMLAEP  89

Query  511  TGMHHEDXKLLF  546
            T +HH D KL++
Sbjct  90   TKLHHLDQKLIY  101



>ref|XP_007041104.1| BCL-2-associated athanogene 3 [Theobroma cacao]
 gb|EOX96935.1| BCL-2-associated athanogene 3 [Theobroma cacao]
Length=262

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR+ +++     P+IR+RV YG++ +EIS++SQATFGE+KK+L   TG
Sbjct  36   EWEMRPGGMLVQKRTQNAD--VSAPDIRLRVAYGAVRYEISVNSQATFGEVKKLLRAETG  93

Query  517  MHHEDXKLLF  546
            +   + +++F
Sbjct  94   LQAGEQRVIF  103



>ref|XP_009398731.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Musa 
acuminata subsp. malaccensis]
Length=340

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPN-IRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGMLVQKR PD++ +  P   IRV+VKYG++YHEI ISSQATFGELKK+L+  T
Sbjct  30   EWELRPGGMLVQKRDPDADAVAAPVPAIRVKVKYGAVYHEIYISSQATFGELKKVLSART  89

Query  514  GMHHEDXKLLF  546
            G+H  D KL++
Sbjct  90   GLHPLDMKLMY  100



>ref|XP_008371808.1| PREDICTED: BAG family molecular chaperone regulator 2-like [Malus 
domestica]
Length=261

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 2/69 (3%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTGM  519
            WEMRPGGMLVQKR   S+   P PN+R+R+ +G++ +EIS S+Q+TFGELKK+LT  TG+
Sbjct  28   WEMRPGGMLVQKRGEKSD--APAPNLRLRIAFGALRYEISASAQSTFGELKKVLTAETGL  85

Query  520  HHEDXKLLF  546
               + +LLF
Sbjct  86   QPGEQRLLF  94



>ref|XP_004964389.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Setaria 
italica]
Length=335

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 6/75 (8%)
 Frame = +1

Query  340  WEMRPGGMLVQKRS---PDSE---NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKML  501
            WE+RPGGMLVQKRS    D E   N+ P P IRV+VK+  + HEI ISS+A+FGELKK++
Sbjct  42   WEVRPGGMLVQKRSGGVSDDEPSRNVKPVPTIRVKVKHAGVTHEIYISSEASFGELKKLV  101

Query  502  TGPTGMHHEDXKLLF  546
               TG+H +D K+L+
Sbjct  102  AAKTGLHPDDQKVLY  116



>dbj|BAA90810.1| BAG domain containing protein-like [Oryza sativa Japonica Group]
 dbj|BAD67924.1| BAG domain containing protein-like [Oryza sativa Japonica Group]
Length=321

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +1

Query  340  WEMRPGGMLVQKRS--PDSE--NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTG  507
            WE+RPGGMLVQKR    D E  N+ P P IRV+VK+  I HEI I+SQA+FGELKKM+  
Sbjct  31   WEVRPGGMLVQKRGGGADEEPVNVKPVPTIRVKVKHAGITHEIYINSQASFGELKKMVAA  90

Query  508  PTGMHHEDXKLLF  546
             TG+H +D K+++
Sbjct  91   RTGLHPDDQKVMY  103



>ref|NP_001056659.2| Os06g0126500 [Oryza sativa Japonica Group]
 gb|EEC79906.1| hypothetical protein OsI_21451 [Oryza sativa Indica Group]
 dbj|BAF18573.2| Os06g0126500 [Oryza sativa Japonica Group]
Length=339

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +1

Query  340  WEMRPGGMLVQKRS--PDSE--NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTG  507
            WE+RPGGMLVQKR    D E  N+ P P IRV+VK+  I HEI I+SQA+FGELKKM+  
Sbjct  49   WEVRPGGMLVQKRGGGADEEPVNVKPVPTIRVKVKHAGITHEIYINSQASFGELKKMVAA  108

Query  508  PTGMHHEDXKLLF  546
             TG+H +D K+++
Sbjct  109  RTGLHPDDQKVMY  121



>ref|XP_009362271.1| PREDICTED: BAG family molecular chaperone regulator 2-like [Pyrus 
x bretschneideri]
Length=265

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 2/69 (3%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTGM  519
            WEMRPGGMLVQKR   S+   P PN+R+R+ +G++ +EIS S+Q+TFGELKK+LT  TG+
Sbjct  32   WEMRPGGMLVQKRGEKSD--APAPNLRLRIAFGALRYEISASAQSTFGELKKVLTAETGL  89

Query  520  HHEDXKLLF  546
               + +LLF
Sbjct  90   QPGEQRLLF  98



>ref|XP_010054787.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Eucalyptus 
grandis]
 gb|KCW77606.1| hypothetical protein EUGRSUZ_D01920 [Eucalyptus grandis]
Length=115

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRS---PDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTG  507
            EWE+RPGGMLVQ R+    +  N     NIRV+VK+G   HE+ IS QA+F ELKK L  
Sbjct  28   EWEVRPGGMLVQTRASSEAEHRNQAQASNIRVKVKHGPSCHEVLISPQASFEELKKKLAE  87

Query  508  PTGMHHEDXKLLF  546
            PTG+HHED KL++
Sbjct  88   PTGLHHEDQKLIY  100



>ref|XP_010245179.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Nelumbo 
nucifera]
Length=257

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR   SE     P  RVR+ YG+  ++ISI+SQATFGELKK+L   TG
Sbjct  32   EWEMRPGGMLVQKRCEKSE--VSAPTFRVRIAYGAFRYDISINSQATFGELKKLLAAETG  89

Query  517  MHHEDXKLLF  546
            +   + +L+F
Sbjct  90   LQPGEQRLIF  99



>ref|XP_009803851.1| PREDICTED: BAG family molecular chaperone regulator 3-like isoform 
X2 [Nicotiana sylvestris]
Length=234

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +1

Query  292  KTTSPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQ  471
            KT+S AAA       EWEMRPGGMLVQ+RS D+ ++P   N+R+RV YG+  +EIS++  
Sbjct  18   KTSSTAAAAVKEEVIEWEMRPGGMLVQRRS-DNSDVPITLNLRIRVAYGAARYEISVNPH  76

Query  472  ATFGELKKMLTGPTGMHHEDXKLLF  546
            ATFGELKK+LT  TG+   + +L+ 
Sbjct  77   ATFGELKKLLTEETGLQPGEQRLII  101



>ref|XP_008225543.1| PREDICTED: BAG family molecular chaperone regulator 2-like [Prunus 
mume]
Length=256

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 2/69 (3%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTGM  519
            WEMRPGGMLVQKR   S+   P PN+R+R+ +G++ +EIS +SQ+TFGELKK+LT  TG+
Sbjct  31   WEMRPGGMLVQKRGEKSD--VPAPNLRLRIAFGALRYEISAASQSTFGELKKVLTAETGL  88

Query  520  HHEDXKLLF  546
               + +LLF
Sbjct  89   QPGEQRLLF  97



>ref|XP_003574879.1| PREDICTED: BAG family molecular chaperone regulator 2-like [Brachypodium 
distachyon]
Length=322

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 55/74 (74%), Gaps = 7/74 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPP-----PNIRVRVKYGSIYHEISISSQATFGELKKMLT  504
            WE+RP GMLVQKR+PDS+  PPP     P IRV+VK+  + HE+ ++SQA+FGELKK++ 
Sbjct  32   WEVRPSGMLVQKRTPDSD--PPPGGAPVPTIRVKVKFAGVTHEVYVNSQASFGELKKLMA  89

Query  505  GPTGMHHEDXKLLF  546
              TG H +D K+++
Sbjct  90   EKTGRHPDDLKVVY  103



>ref|XP_009414438.1| PREDICTED: BAG family molecular chaperone regulator 2-like [Musa 
acuminata subsp. malaccensis]
Length=407

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE-NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGG+LVQKR+P+++ +  P P + V+VK+G+  HEI ISSQATFGELKK L+  T
Sbjct  126  EWEVRPGGLLVQKRAPEADPSAAPVPTVCVKVKHGAGNHEIRISSQATFGELKKALSART  185

Query  514  GMHHEDXKLLF  546
            G+H  D KL++
Sbjct  186  GLHPLDMKLVY  196



>gb|EEE65009.1| hypothetical protein OsJ_19959 [Oryza sativa Japonica Group]
Length=339

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +1

Query  340  WEMRPGGMLVQKRS--PDSE--NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTG  507
            WE+RPGGMLVQKR    D E  N+ P P IRV+VK+  I HEI I+SQA+FGELKKM+  
Sbjct  49   WEVRPGGMLVQKRGGGADEEPVNVKPVPTIRVKVKHAGITHEIYINSQASFGELKKMVAA  108

Query  508  PTGMHHEDXKLLF  546
             TG+H +D K+++
Sbjct  109  RTGLHPDDQKVMY  121



>ref|XP_007211889.1| hypothetical protein PRUPE_ppa010271mg [Prunus persica]
 gb|EMJ13088.1| hypothetical protein PRUPE_ppa010271mg [Prunus persica]
Length=256

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 2/69 (3%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTGM  519
            WEMRPGGMLVQKR   S+   P PN+R+R+ +G++ +EIS +SQ+TFGELKK+LT  TG+
Sbjct  31   WEMRPGGMLVQKRGEKSD--VPAPNLRLRIAFGALRYEISAASQSTFGELKKVLTAETGL  88

Query  520  HHEDXKLLF  546
               + +LLF
Sbjct  89   QPGEQRLLF  97



>gb|KDP38026.1| hypothetical protein JCGZ_04669 [Jatropha curcas]
Length=262

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 54/70 (77%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR  + +N  PP  +R+R+ YG++ +EIS++SQATFGELKK+L   TG
Sbjct  35   EWEMRPGGMLVQKR--NGKNDIPPAILRLRIPYGALRYEISVNSQATFGELKKLLMAETG  92

Query  517  MHHEDXKLLF  546
            +   + +L+F
Sbjct  93   LQPSEQRLVF  102



>ref|XP_009803850.1| PREDICTED: BAG family molecular chaperone regulator 2-like isoform 
X1 [Nicotiana sylvestris]
Length=260

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +1

Query  292  KTTSPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQ  471
            KT+S AAA       EWEMRPGGMLVQ+RS D+ ++P   N+R+RV YG+  +EIS++  
Sbjct  18   KTSSTAAAAVKEEVIEWEMRPGGMLVQRRS-DNSDVPITLNLRIRVAYGAARYEISVNPH  76

Query  472  ATFGELKKMLTGPTGMHHEDXKLLF  546
            ATFGELKK+LT  TG+   + +L+ 
Sbjct  77   ATFGELKKLLTEETGLQPGEQRLII  101



>ref|XP_009364171.1| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364175.1| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=291

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE-NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            + E+RPGGMLVQKR+ ++  +    P I+VRVK+GS YHEI I+SQA+FGELKKML   T
Sbjct  21   DLEIRPGGMLVQKRTEETNPSAVSIPTIKVRVKHGSSYHEIQINSQASFGELKKMLAERT  80

Query  514  GMHHEDXKLLF  546
             +HH D KL++
Sbjct  81   KLHHLDQKLIY  91



>gb|KCW44531.1| hypothetical protein EUGRSUZ_L01966, partial [Eucalyptus grandis]
Length=249

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRS---PDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTG  507
            EWE+RPGGMLVQ R+    +  N     NIRV+VK+G   HE+ IS QA+F ELKK L  
Sbjct  28   EWEVRPGGMLVQTRASSEAEHRNQAQASNIRVKVKHGPSCHEVLISPQASFEELKKKLAE  87

Query  508  PTGMHHEDXKLLF  546
            PTG+HHED KL++
Sbjct  88   PTGLHHEDQKLIY  100



>gb|KHN06956.1| BAG family molecular chaperone regulator 2 [Glycine soja]
Length=252

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR+ ++ +     N+R+R+ YG++ +EI +SS ATFGE+KK+L+G TG
Sbjct  25   EWEMRPGGMLVQKRTANT-DAAVTRNLRLRIAYGALRYEICVSSIATFGEVKKVLSGETG  83

Query  517  MHHEDXKLLF  546
            +  ++ +LL+
Sbjct  84   LEVDEQRLLY  93



>ref|XP_006448982.1| hypothetical protein CICLE_v10016355mg [Citrus clementina]
 gb|ESR62222.1| hypothetical protein CICLE_v10016355mg [Citrus clementina]
Length=236

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            + E+RPGGMLVQKRS  ++   PPPN+R+R+ +G++  EIS++S+ATFGE+KK+LTG TG
Sbjct  29   DCELRPGGMLVQKRSEKTD--VPPPNLRLRIAFGALRKEISVNSRATFGEVKKVLTGETG  86

Query  517  MHHEDXKLLF  546
            +   D  L++
Sbjct  87   LQAGDQVLIY  96



>ref|NP_001149344.1| protein binding protein [Zea mays]
 gb|ACG35109.1| protein binding protein [Zea mays]
Length=324

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSP-DSE---NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTG  507
            WE+RPGGMLVQKR   D E   N+ P P IRV+VK+  + HEI ISS+A+FGELKK++  
Sbjct  44   WEVRPGGMLVQKRGGGDDEPSPNVKPVPTIRVKVKHAGVTHEIYISSEASFGELKKLVAA  103

Query  508  PTGMHHEDXKLLF  546
             TG+H +D K+L+
Sbjct  104  KTGLHPDDQKVLY  116



>ref|XP_008444790.1| PREDICTED: BAG family molecular chaperone regulator 3-like [Cucumis 
melo]
Length=275

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 54/70 (77%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR+  SE+  PPP + +RV +G++  EISISS+ATFGELK++LT  TG
Sbjct  43   EWEMRPGGMLVQKRTDKSES--PPPILHLRVAFGAVRLEISISSKATFGELKRVLTAETG  100

Query  517  MHHEDXKLLF  546
            +     K+++
Sbjct  101  LEVAAQKVIY  110



>ref|XP_002973687.1| hypothetical protein SELMODRAFT_99632 [Selaginella moellendorffii]
 gb|EFJ25347.1| hypothetical protein SELMODRAFT_99632 [Selaginella moellendorffii]
Length=282

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            +WEMRPGGMLVQKR   +E       IRV+V +G++YHE++IS  ATFG+LKK+L  PTG
Sbjct  12   DWEMRPGGMLVQKRDETAEQSMSGATIRVKVSHGAVYHEVTISPYATFGDLKKLLVQPTG  71

Query  517  MHHEDXKLLF  546
            +   + ++L+
Sbjct  72   LQAREQRILY  81



>ref|XP_010041222.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Eucalyptus 
grandis]
Length=279

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRS---PDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTG  507
            EWE+RPGGMLVQ R+    +  N     NIRV+VK+G   HE+ IS QA+F ELKK L  
Sbjct  28   EWEVRPGGMLVQTRASSEAEHRNQAQASNIRVKVKHGPSCHEVLISPQASFEELKKKLAE  87

Query  508  PTGMHHEDXKLLF  546
            PTG+HHED KL++
Sbjct  88   PTGLHHEDQKLIY  100



>ref|XP_003542946.1| PREDICTED: BAG family molecular chaperone regulator 2-like [Glycine 
max]
Length=253

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR+ ++ +     N+R+R+ YG++ +EI +SS ATFGE+KK+L G TG
Sbjct  26   EWEMRPGGMLVQKRTANT-DAAVTRNLRLRIAYGALRYEICVSSIATFGEVKKVLCGETG  84

Query  517  MHHEDXKLLF  546
            +  ++ KL++
Sbjct  85   LEVDEQKLVY  94



>ref|XP_009605457.1| PREDICTED: BAG family molecular chaperone regulator 2-like [Nicotiana 
tomentosiformis]
Length=286

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +1

Query  280  RMKTKTTSPaaangggsanEWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEIS  459
            R   +TTS AAA       EWEMRPGGMLVQ+RS D+ ++P   N+R+RV Y +  +EIS
Sbjct  40   RKADRTTSTAAAAVKEEVIEWEMRPGGMLVQRRS-DNSDVPITLNLRIRVAYAAARYEIS  98

Query  460  ISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            ++  ATFGELKK+LT  TG+   + +L+ 
Sbjct  99   VNPHATFGELKKLLTEETGLQPGEQRLIM  127



>gb|ACN25625.1| unknown [Zea mays]
 gb|ACN34565.1| unknown [Zea mays]
 gb|AFW86083.1| protein binding protein [Zea mays]
Length=322

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSP-DSE---NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTG  507
            WE+RPGGMLVQKR   D E   N+ P P IRV+VK+  + HEI ISS+A+FGELKK++  
Sbjct  42   WEVRPGGMLVQKRGGGDDEPSPNVKPVPTIRVKVKHAGVTHEIYISSEASFGELKKLVAA  101

Query  508  PTGMHHEDXKLLF  546
             TG+H +D K+L+
Sbjct  102  KTGLHPDDQKVLY  114



>dbj|BAB10172.1| unnamed protein product [Arabidopsis thaliana]
Length=302

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 19/87 (22%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFG-----------  483
            E E+RPGGM+VQKR+  S ++P    IRVRVKYGS++HEISI+SQ+TFG           
Sbjct  15   EMELRPGGMVVQKRTDHSSSVPR--GIRVRVKYGSVHHEISINSQSTFGKRHKTFRVIQY  72

Query  484  ------ELKKMLTGPTGMHHEDXKLLF  546
                  ELKK+L+G TG+HH+D ++++
Sbjct  73   FLYTIRELKKILSGATGVHHQDMQIIY  99



>ref|XP_003546074.1| PREDICTED: BAG family molecular chaperone regulator 2-like [Glycine 
max]
Length=251

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRPGGMLVQKR+ +++ +    N+R+R+ YG++ +EI +SS ATFGE+KK+L+G TG
Sbjct  25   EWEMRPGGMLVQKRTTNTDVVTR--NLRLRIAYGALRYEICVSSIATFGEVKKVLSGETG  82

Query  517  MHHEDXKLLF  546
            +  ++ +LL+
Sbjct  83   LEVDEQRLLY  92



>gb|AFW86084.1| hypothetical protein ZEAMMB73_238582 [Zea mays]
Length=202

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 53/73 (73%), Gaps = 4/73 (5%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSPDSE----NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTG  507
            WE+RPGGMLVQKR    +    N+ P P IRV+VK+  + HEI ISS+A+FGELKK++  
Sbjct  42   WEVRPGGMLVQKRGGGDDEPSPNVKPVPTIRVKVKHAGVTHEIYISSEASFGELKKLVAA  101

Query  508  PTGMHHEDXKLLF  546
             TG+H +D K+L+
Sbjct  102  KTGLHPDDQKVLY  114



>ref|XP_008454738.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Cucumis 
melo]
Length=297

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            E ++RPGGMLVQKR  +S   P  P I+V+VK+GS YH I I+S A+FGELKK+L  PTG
Sbjct  41   ELDIRPGGMLVQKRDFNSN--PSFPTIKVKVKFGSSYHHIQINSHASFGELKKLLAEPTG  98

Query  517  MHHEDXKLLF  546
            +H E+ KL++
Sbjct  99   LHPEEQKLIY  108



>ref|XP_010275914.1| PREDICTED: BAG family molecular chaperone regulator 2-like [Nelumbo 
nucifera]
Length=260

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            EWEMRP GMLVQKR   SE     P++R+R+ YG+  ++ISISSQATFGELKK+L+  TG
Sbjct  35   EWEMRPSGMLVQKRCEKSE--VSAPSLRLRIAYGAFRYDISISSQATFGELKKLLSAETG  92

Query  517  MHHEDXKLLF  546
            +   + +L+F
Sbjct  93   LQPGEQRLIF  102



>ref|XP_009407955.1| PREDICTED: BAG family molecular chaperone regulator 2-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=316

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPP-NIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGM VQKR PD++    P   IRV+VKYG++YHE  +SSQATFGELKK L+  T
Sbjct  27   EWEVRPGGMFVQKRDPDADAAAAPVPTIRVKVKYGAVYHEAYVSSQATFGELKKALSART  86

Query  514  GMHHEDXKLLF  546
            G+H  D KLL+
Sbjct  87   GLHPLDMKLLY  97



>ref|XP_006448983.1| hypothetical protein CICLE_v10016355mg [Citrus clementina]
 gb|ESR62223.1| hypothetical protein CICLE_v10016355mg [Citrus clementina]
Length=255

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            + E+RPGGMLVQKRS  ++   PPPN+R+R+ +G++  EIS++S+ATFGE+KK+LTG TG
Sbjct  29   DCELRPGGMLVQKRSEKTD--VPPPNLRLRIAFGALRKEISVNSRATFGEVKKVLTGETG  86

Query  517  MHHEDXKLLF  546
            +   D  L++
Sbjct  87   LQAGDQVLIY  96



>ref|XP_002436384.1| hypothetical protein SORBIDRAFT_10g001600 [Sorghum bicolor]
 gb|EER87751.1| hypothetical protein SORBIDRAFT_10g001600 [Sorghum bicolor]
Length=347

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 9/78 (12%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSP------DSE---NLPPPPNIRVRVKYGSIYHEISISSQATFGELK  492
            WE+RPGGMLVQKR        D E   N+ P P IRV+VK+  + HEI ISS+A+FGELK
Sbjct  47   WEVRPGGMLVQKRGGIGGGAGDDEPSPNVKPVPTIRVKVKHAGVTHEIYISSEASFGELK  106

Query  493  KMLTGPTGMHHEDXKLLF  546
            K++   TG+H +D K+L+
Sbjct  107  KLVAAKTGLHPDDQKVLY  124



>ref|XP_009407954.1| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=327

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPP-NIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWE+RPGGM VQKR PD++    P   IRV+VKYG++YHE  +SSQATFGELKK L+  T
Sbjct  27   EWEVRPGGMFVQKRDPDADAAAAPVPTIRVKVKYGAVYHEAYVSSQATFGELKKALSART  86

Query  514  GMHHEDXKLLF  546
            G+H  D KLL+
Sbjct  87   GLHPLDMKLLY  97



>ref|XP_009339651.1| PREDICTED: BAG family molecular chaperone regulator 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=291

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSE-NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            + E+RPGGMLVQKR+ ++  +    P I+VRVK+GS  HEI I+SQA+FGELKKML   T
Sbjct  21   DLEIRPGGMLVQKRTDETNPSAVSIPTIKVRVKHGSSCHEIQINSQASFGELKKMLAERT  80

Query  514  GMHHEDXKLLF  546
             +HH D KL++
Sbjct  81   KLHHLDQKLIY  91



>ref|NP_001151280.1| protein binding protein [Zea mays]
 gb|ACG42216.1| protein binding protein [Zea mays]
Length=320

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +1

Query  340  WEMRPGGMLVQKRSP-DSE---NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTG  507
            WE+RPGGMLVQKR   D E   N+ P P IRV+VK+  + HE+ ISS+A+FGELKK++  
Sbjct  42   WEVRPGGMLVQKRGGGDDEPSPNVKPVPTIRVKVKHAGVTHEMYISSEASFGELKKLVAA  101

Query  508  PTGMHHEDXKLLF  546
             TG+H +D K+L+
Sbjct  102  KTGLHPDDQKVLY  114



>gb|EYU43246.1| hypothetical protein MIMGU_mgv1a012035mg [Erythranthe guttata]
Length=263

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDS-ENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPT  513
            EWEMRPGGMLVQKRS +       PPN+R+RV +G+  ++I ++SQ+TFGELKK++   T
Sbjct  29   EWEMRPGGMLVQKRSDNCGAAAVSPPNLRIRVAHGAARYQIQVNSQSTFGELKKLVAAET  88

Query  514  GMHHEDXKLLF  546
            G+   + +L+F
Sbjct  89   GLQPGEQRLIF  99



>ref|XP_002509707.1| protein binding protein, putative [Ricinus communis]
 gb|EEF51094.1| protein binding protein, putative [Ricinus communis]
Length=301

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDS--ENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGP  510
            E E+RPGGMLVQKR  +S  +N  P P I+VRVKYGS  H I ISSQA+FGELKKML   
Sbjct  28   ELEIRPGGMLVQKRDSNSNNQNYVPIPTIKVRVKYGSSSHHICISSQASFGELKKMLVEQ  87

Query  511  TGMHHEDXKLLF  546
            TG+HH+D KL++
Sbjct  88   TGIHHQDQKLIY  99



>ref|XP_004165671.1| PREDICTED: BAG family molecular chaperone regulator 1-like [Cucumis 
sativus]
 gb|KGN49684.1| hypothetical protein Csa_5G066660 [Cucumis sativus]
Length=269

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  EWEMRPGGMLVQKRSPDSENLPPPPNIRVRVKYGSIYHEISISSQATFGELKKMLTGPTG  516
            E E+RPGGMLVQKR  +S   P  P I+V+VK+GS YH I I+S A+FGELKK++  PTG
Sbjct  13   ELEIRPGGMLVQKRDFNSN--PSFPTIKVKVKFGSSYHHIQINSHASFGELKKLMAEPTG  70

Query  517  MHHEDXKLLF  546
            +H  + KL++
Sbjct  71   LHPAEQKLIY  80



>pdb|4HWI|B Chain B, Crystal Structure Of Atbag1 In Complex With Hsp70
Length=178

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  415  IRVRVKYGSIYHEISISSQATFGELKKMLTGPTGMHHEDXKLLF  546
            IRVR+KYG++YHEI+IS QA+FGELKKMLTGPTG+HH+D KL++
Sbjct  3    IRVRIKYGAVYHEINISPQASFGELKKMLTGPTGIHHQDQKLMY  46



>ref|NP_001147497.1| protein binding protein [Zea mays]
 gb|ACG27733.1| protein binding protein [Zea mays]
Length=317

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 53/76 (70%), Gaps = 7/76 (9%)
 Frame = +1

Query  340  WEMRPGGMLVQKR----SPDSE---NLPPPPNIRVRVKYGSIYHEISISSQATFGELKKM  498
            WE+RPGGMLVQKR    + D E    + P P IRV+ K+  + HEI +SS+A+FGELKK+
Sbjct  44   WEVRPGGMLVQKRGGGGAADDEPSPGVKPVPTIRVKAKHAGVTHEIYVSSEASFGELKKL  103

Query  499  LTGPTGMHHEDXKLLF  546
            +   TG+H +D K+L+
Sbjct  104  VAAKTGLHPDDQKVLY  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335