BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF021D13

Length=577
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009801783.1|  PREDICTED: probable calcium-binding protein ...    227   7e-71   Nicotiana sylvestris
ref|XP_009619221.1|  PREDICTED: probable calcium-binding protein ...    223   2e-69   Nicotiana tomentosiformis
ref|XP_009619224.1|  PREDICTED: probable calcium-binding protein ...    217   4e-67   
ref|XP_009619226.1|  PREDICTED: probable calcium-binding protein ...    216   1e-66   
ref|XP_009619227.1|  PREDICTED: probable calcium-binding protein ...    214   5e-66   
ref|XP_009619225.1|  PREDICTED: probable calcium-binding protein ...    214   7e-66   
ref|XP_008380562.1|  PREDICTED: probable calcium-binding protein ...    201   8e-61   Malus domestica [apple tree]
ref|XP_009374596.1|  PREDICTED: probable calcium-binding protein ...    201   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_007034374.1|  Calcium-binding EF-hand family protein isofo...    198   6e-60   
ref|XP_004247862.1|  PREDICTED: probable calcium-binding protein ...    198   1e-59   Solanum lycopersicum
ref|XP_007223706.1|  hypothetical protein PRUPE_ppa010393mg             198   2e-59   Prunus persica
ref|XP_008224499.1|  PREDICTED: probable calcium-binding protein ...    196   6e-59   Prunus mume [ume]
ref|XP_002300172.2|  hypothetical protein POPTR_0001s32210g             196   6e-59   
ref|XP_007034373.1|  Calcium-binding EF-hand family protein isofo...    194   3e-58   
ref|XP_008380563.1|  PREDICTED: probable calcium-binding protein ...    194   3e-58   Malus domestica [apple tree]
ref|XP_004299109.1|  PREDICTED: probable calcium-binding protein ...    194   4e-58   Fragaria vesca subsp. vesca
ref|XP_007034372.1|  Calcium-binding EF-hand family protein isofo...    194   4e-58   
ref|XP_009374597.1|  PREDICTED: probable calcium-binding protein ...    193   7e-58   Pyrus x bretschneideri [bai li]
ref|XP_006366840.1|  PREDICTED: probable calcium-binding protein ...    194   1e-57   Solanum tuberosum [potatoes]
ref|XP_011045652.1|  PREDICTED: probable calcium-binding protein ...    191   6e-57   Populus euphratica
ref|XP_002266666.1|  PREDICTED: probable calcium-binding protein ...    190   2e-56   Vitis vinifera
gb|KJB72094.1|  hypothetical protein B456_011G158400                    187   3e-55   Gossypium raimondii
ref|XP_006493812.1|  PREDICTED: probable calcium-binding protein ...    184   3e-54   Citrus sinensis [apfelsine]
ref|XP_008438356.1|  PREDICTED: probable calcium-binding protein ...    182   2e-53   Cucumis melo [Oriental melon]
gb|KHG12326.1|  putative calcium-binding CML22 -like protein            182   2e-53   Gossypium arboreum [tree cotton]
ref|XP_006420904.1|  hypothetical protein CICLE_v10005743mg             181   3e-53   Citrus clementina [clementine]
ref|XP_004133997.1|  PREDICTED: probable calcium-binding protein ...    181   4e-53   
ref|XP_010023705.1|  PREDICTED: probable calcium-binding protein ...    181   6e-53   Eucalyptus grandis [rose gum]
gb|KDO61178.1|  hypothetical protein CISIN_1g0262681mg                  180   8e-53   Citrus sinensis [apfelsine]
ref|XP_010650355.1|  PREDICTED: probable calcium-binding protein ...    176   3e-51   Vitis vinifera
gb|KCW60054.1|  hypothetical protein EUGRSUZ_H02783                     174   2e-50   Eucalyptus grandis [rose gum]
ref|XP_010650356.1|  PREDICTED: probable calcium-binding protein ...    173   3e-50   Vitis vinifera
ref|XP_002518103.1|  conserved hypothetical protein                     171   2e-49   
gb|KJB72093.1|  hypothetical protein B456_011G158400                    171   3e-49   Gossypium raimondii
gb|KDP39372.1|  hypothetical protein JCGZ_01129                         168   4e-48   Jatropha curcas
ref|XP_006493813.1|  PREDICTED: probable calcium-binding protein ...    167   4e-48   
ref|XP_010241365.1|  PREDICTED: probable calcium-binding protein ...    166   3e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010107777.1|  putative calcium-binding protein CML22             160   5e-45   
ref|XP_010691273.1|  PREDICTED: probable calcium-binding protein ...    158   4e-44   
gb|EYU32662.1|  hypothetical protein MIMGU_mgv1a012635mg                157   6e-44   Erythranthe guttata [common monkey flower]
ref|XP_010691274.1|  PREDICTED: probable calcium-binding protein ...    157   1e-43   
ref|XP_010691270.1|  PREDICTED: probable calcium-binding protein ...    157   1e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010532790.1|  PREDICTED: probable calcium-binding protein ...    154   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_010532789.1|  PREDICTED: probable calcium-binding protein ...    153   5e-42   Tarenaya hassleriana [spider flower]
ref|XP_010326837.1|  PREDICTED: probable calcium-binding protein ...    150   2e-41   
gb|KFK39709.1|  hypothetical protein AALP_AA3G278300                    145   2e-39   Arabis alpina [alpine rockcress]
ref|XP_010691275.1|  PREDICTED: probable calcium-binding protein ...    144   9e-39   
ref|XP_006418801.1|  hypothetical protein EUTSA_v10002654mg             142   5e-38   
ref|XP_010909319.1|  PREDICTED: probable calcium-binding protein ...    142   6e-38   Elaeis guineensis
ref|XP_010421964.1|  PREDICTED: probable calcium-binding protein ...    139   9e-38   Camelina sativa [gold-of-pleasure]
emb|CDO99460.1|  unnamed protein product                                139   3e-37   Coffea canephora [robusta coffee]
ref|XP_010513185.1|  PREDICTED: probable calcium-binding protein ...    139   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009106153.1|  PREDICTED: probable calcium-binding protein ...    139   4e-37   Brassica rapa
ref|XP_002883485.1|  calcium-binding EF hand family protein             139   6e-37   
ref|XP_004509621.1|  PREDICTED: probable calcium-binding protein ...    139   7e-37   Cicer arietinum [garbanzo]
ref|XP_010466782.1|  PREDICTED: probable calcium-binding protein ...    139   8e-37   Camelina sativa [gold-of-pleasure]
gb|KJB11853.1|  hypothetical protein B456_002G104000                    138   1e-36   Gossypium raimondii
ref|XP_004509620.1|  PREDICTED: probable calcium-binding protein ...    138   1e-36   
gb|KHG01864.1|  putative calcium-binding CML21 -like protein            137   1e-36   Gossypium arboreum [tree cotton]
ref|XP_003563635.1|  PREDICTED: probable calcium-binding protein ...    138   1e-36   Brachypodium distachyon [annual false brome]
emb|CDY18071.1|  BnaA01g23320D                                          138   1e-36   Brassica napus [oilseed rape]
emb|CDY46335.1|  BnaC01g30350D                                          138   2e-36   Brassica napus [oilseed rape]
ref|XP_006584629.1|  PREDICTED: uncharacterized protein LOC100820...    137   2e-36   Glycine max [soybeans]
ref|XP_006370792.1|  hypothetical protein POPTR_0001s47510g             137   3e-36   Populus trichocarpa [western balsam poplar]
ref|XP_009409857.1|  PREDICTED: probable calcium-binding protein ...    136   6e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002300587.1|  calcium-binding EF hand family protein             137   7e-36   
ref|XP_011039863.1|  PREDICTED: probable calcium-binding protein ...    135   1e-35   Populus euphratica
emb|CDX85172.1|  BnaC07g07340D                                          140   2e-35   
ref|XP_003628952.1|  hypothetical protein MTR_8g070510                  135   2e-35   
ref|NP_189053.1|  putative calcium-binding protein CML22                134   4e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AET03429.2|  EF hand calcium-binding family protein                  134   5e-35   Medicago truncatula
ref|XP_003547815.1|  PREDICTED: probable calcium-binding protein ...    133   7e-35   Glycine max [soybeans]
ref|XP_010488497.1|  PREDICTED: probable calcium-binding protein ...    134   9e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009406355.1|  PREDICTED: probable calcium-binding protein ...    134   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002268527.1|  PREDICTED: probable calcium-binding protein ...    133   1e-34   Vitis vinifera
ref|NP_001242483.1|  uncharacterized protein LOC100820628               132   2e-34   Glycine max [soybeans]
ref|XP_009102544.1|  PREDICTED: probable calcium-binding protein ...    132   4e-34   
ref|XP_010644632.1|  PREDICTED: probable calcium-binding protein ...    131   5e-34   Vitis vinifera
gb|ACN85218.1|  calcium ion binding protein                             131   6e-34   Oryza punctata
ref|XP_006857595.1|  hypothetical protein AMTR_s00061p00095500          131   7e-34   Amborella trichopoda
gb|ACN85272.1|  calcium ion binding protein                             130   1e-33   Oryza alta
gb|KHG00196.1|  putative calcium-binding CML21 -like protein            130   1e-33   Gossypium arboreum [tree cotton]
gb|ACN85246.1|  calcium ion binding protein                             130   1e-33   Oryza officinalis
gb|EMT01046.1|  Putative calcium-binding protein CML21                  130   1e-33   
emb|CAN71481.1|  hypothetical protein VITISV_006244                     131   1e-33   Vitis vinifera
ref|XP_009102545.1|  PREDICTED: probable calcium-binding protein ...    130   2e-33   Brassica rapa
emb|CDX77458.1|  BnaA07g05960D                                          130   2e-33   
gb|ACN85259.1|  calcium ion binding protein                             130   2e-33   Oryza alta
gb|KDP36321.1|  hypothetical protein JCGZ_09536                         130   2e-33   Jatropha curcas
ref|XP_007156300.1|  hypothetical protein PHAVU_003G275000g             130   2e-33   Phaseolus vulgaris [French bean]
ref|XP_008794706.1|  PREDICTED: probable calcium-binding protein ...    129   2e-33   Phoenix dactylifera
ref|XP_010244812.1|  PREDICTED: probable calcium-binding protein ...    129   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_008782977.1|  PREDICTED: probable calcium-binding protein ...    129   3e-33   Phoenix dactylifera
gb|AFJ15127.1|  putative calcium-binding protein CML21                  129   5e-33   Camellia sinensis [black tea]
gb|KEH22471.1|  calcium-binding EF-hand protein                         128   7e-33   Medicago truncatula
ref|XP_004516273.1|  PREDICTED: probable calcium-binding protein ...    128   8e-33   
ref|XP_007020327.1|  Calcium-binding EF-hand family protein             128   1e-32   
ref|XP_006474771.1|  PREDICTED: probable calcium-binding protein ...    127   1e-32   Citrus sinensis [apfelsine]
ref|XP_006452756.1|  hypothetical protein CICLE_v10009385mg             127   1e-32   Citrus clementina [clementine]
gb|KEH22470.1|  calcium-binding EF-hand protein                         128   1e-32   Medicago truncatula
ref|XP_010063214.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    127   1e-32   Eucalyptus grandis [rose gum]
ref|XP_006656237.1|  PREDICTED: probable calcium-binding protein ...    127   1e-32   Oryza brachyantha
ref|XP_008219144.1|  PREDICTED: probable calcium-binding protein ...    127   1e-32   Prunus mume [ume]
gb|KCW70421.1|  hypothetical protein EUGRSUZ_F03649                     127   2e-32   Eucalyptus grandis [rose gum]
ref|XP_010092394.1|  putative calcium-binding protein CML21             127   2e-32   Morus notabilis
ref|XP_010928993.1|  PREDICTED: probable calcium-binding protein ...    127   2e-32   Elaeis guineensis
ref|XP_007140756.1|  hypothetical protein PHAVU_008G139100g             126   3e-32   Phaseolus vulgaris [French bean]
ref|NP_001058046.1|  Os06g0609600                                       126   3e-32   
gb|ACN85201.1|  calcium ion binding protein                             126   3e-32   Oryza glaberrima
gb|EMS55923.1|  putative calcium-binding protein CML21                  126   5e-32   Triticum urartu
ref|XP_002532937.1|  Troponin C, skeletal muscle, putative              126   5e-32   Ricinus communis
ref|XP_007205832.1|  hypothetical protein PRUPE_ppa010999mg             125   7e-32   Prunus persica
ref|XP_009346680.1|  PREDICTED: probable calcium-binding protein ...    125   7e-32   Pyrus x bretschneideri [bai li]
ref|XP_008805537.1|  PREDICTED: probable calcium-binding protein ...    125   8e-32   
gb|KEH22472.1|  calcium-binding EF-hand protein                         124   9e-32   Medicago truncatula
ref|XP_003530839.1|  PREDICTED: probable calcium-binding protein ...    125   1e-31   Glycine max [soybeans]
gb|ACN85332.1|  calcium ion binding protein                             125   1e-31   Oryza meyeriana var. granulata
ref|XP_010913274.1|  PREDICTED: probable calcium-binding protein ...    125   1e-31   
gb|KDO73987.1|  hypothetical protein CISIN_1g026998mg                   125   1e-31   Citrus sinensis [apfelsine]
gb|AFK36647.1|  unknown                                                 125   1e-31   Lotus japonicus
ref|XP_006647028.1|  PREDICTED: probable calcium-binding protein ...    124   2e-31   Oryza brachyantha
gb|KEH22469.1|  calcium-binding EF-hand protein                         124   2e-31   Medicago truncatula
ref|XP_010545296.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    124   2e-31   Tarenaya hassleriana [spider flower]
gb|ACN85168.1|  calcium ion binding protein                             124   2e-31   Oryza sativa f. spontanea
ref|XP_002862334.1|  predicted protein                                  122   3e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_002438663.1|  hypothetical protein SORBIDRAFT_10g023890          124   3e-31   Sorghum bicolor [broomcorn]
ref|XP_008353863.1|  PREDICTED: probable calcium-binding protein ...    123   5e-31   Malus domestica [apple tree]
ref|XP_003628953.1|  hypothetical protein MTR_8g070510                  122   6e-31   
ref|XP_010233984.1|  PREDICTED: probable calcium-binding protein ...    123   7e-31   Brachypodium distachyon [annual false brome]
ref|NP_001132390.1|  uncharacterized protein LOC100193836               123   7e-31   Zea mays [maize]
gb|EEC78513.1|  hypothetical protein OsI_18448                          123   8e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_010676135.1|  PREDICTED: probable calcium-binding protein ...    123   8e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008384627.1|  PREDICTED: probable calcium-binding protein ...    123   8e-31   Malus domestica [apple tree]
ref|XP_008358900.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    123   8e-31   
ref|XP_009379121.1|  PREDICTED: probable calcium-binding protein ...    122   9e-31   Pyrus x bretschneideri [bai li]
gb|AFW87515.1|  hypothetical protein ZEAMMB73_336887                    121   1e-30   
ref|NP_001046205.1|  Os02g0198200                                       122   1e-30   
ref|XP_003571276.1|  PREDICTED: probable calcium-binding protein ...    123   1e-30   Brachypodium distachyon [annual false brome]
gb|EEC72684.1|  hypothetical protein OsI_06250                          122   1e-30   Oryza sativa Indica Group [Indian rice]
ref|NP_001078450.1|  putative calcium-binding protein CML21             121   2e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CDP13649.1|  unnamed protein product                                121   3e-30   Coffea canephora [robusta coffee]
gb|EMT21140.1|  Putative calcium-binding protein CML21                  121   3e-30   
ref|XP_002869609.1|  calcium ion binding protein                        121   3e-30   
ref|XP_008778084.1|  PREDICTED: probable calcium-binding protein ...    121   4e-30   Phoenix dactylifera
ref|XP_002451725.1|  hypothetical protein SORBIDRAFT_04g006670          121   4e-30   Sorghum bicolor [broomcorn]
ref|XP_004965909.1|  PREDICTED: probable calcium-binding protein ...    121   4e-30   Setaria italica
ref|NP_194377.2|  putative calcium-binding protein CML21                121   4e-30   Arabidopsis thaliana [mouse-ear cress]
gb|EYU33744.1|  hypothetical protein MIMGU_mgv1a013136mg                121   4e-30   Erythranthe guttata [common monkey flower]
ref|XP_011097697.1|  PREDICTED: probable calcium-binding protein ...    121   4e-30   Sesamum indicum [beniseed]
ref|XP_004294881.1|  PREDICTED: probable calcium-binding protein ...    120   5e-30   Fragaria vesca subsp. vesca
ref|XP_006285834.1|  hypothetical protein CARUB_v10007314mg             121   5e-30   Capsella rubella
ref|XP_008449066.1|  PREDICTED: probable calcium-binding protein ...    120   5e-30   Cucumis melo [Oriental melon]
ref|XP_010327214.1|  PREDICTED: probable calcium-binding protein ...    120   6e-30   Solanum lycopersicum
emb|CAA18223.1|  putative protein                                       121   7e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004149571.1|  PREDICTED: probable calcium-binding protein ...    120   7e-30   Cucumis sativus [cucumbers]
ref|XP_006352556.1|  PREDICTED: probable calcium-binding protein ...    120   9e-30   Solanum tuberosum [potatoes]
ref|XP_009142368.1|  PREDICTED: probable calcium-binding protein ...    119   1e-29   Brassica rapa
ref|XP_006413177.1|  hypothetical protein EUTSA_v10026168mg             119   1e-29   Eutrema salsugineum [saltwater cress]
ref|XP_011095629.1|  PREDICTED: probable calcium-binding protein ...    119   2e-29   Sesamum indicum [beniseed]
ref|NP_001148425.1|  calcium ion binding protein                        119   3e-29   Zea mays [maize]
ref|XP_004951561.1|  PREDICTED: probable calcium-binding protein ...    119   3e-29   Setaria italica
gb|AFW66169.1|  calcium ion binding protein                             118   4e-29   
dbj|BAK07400.1|  predicted protein                                      118   4e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010448264.1|  PREDICTED: probable calcium-binding protein ...    118   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010433497.1|  PREDICTED: probable calcium-binding protein ...    118   5e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010438747.1|  PREDICTED: probable calcium-binding protein ...    118   6e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006654041.1|  PREDICTED: probable calcium-binding protein ...    118   7e-29   Oryza brachyantha
ref|XP_009608207.1|  PREDICTED: probable calcium-binding protein ...    117   1e-28   Nicotiana tomentosiformis
ref|XP_009776689.1|  PREDICTED: probable calcium-binding protein ...    117   1e-28   Nicotiana sylvestris
ref|NP_001131792.1|  calcium ion binding protein                        116   2e-28   Zea mays [maize]
ref|XP_010231716.1|  PREDICTED: probable calcium-binding protein ...    114   1e-27   Brachypodium distachyon [annual false brome]
ref|XP_003568950.2|  PREDICTED: probable calcium-binding protein ...    114   1e-27   Brachypodium distachyon [annual false brome]
gb|ABK22178.1|  unknown                                                 113   3e-27   Picea sitchensis
gb|ACR34117.1|  unknown                                                 112   3e-27   Zea mays [maize]
ref|XP_004960294.1|  PREDICTED: probable calcium-binding protein ...    114   4e-27   Setaria italica
gb|EMS52340.1|  putative calcium-binding protein CML22                  114   7e-27   Triticum urartu
ref|XP_002447440.1|  hypothetical protein SORBIDRAFT_06g001080          111   2e-26   
gb|KHN01846.1|  Putative calcium-binding protein CML22                  110   3e-26   Glycine soja [wild soybean]
gb|KJB63080.1|  hypothetical protein B456_009G454500                    106   2e-25   Gossypium raimondii
gb|EMS67685.1|  putative calcium-binding protein CML21                  110   2e-25   Triticum urartu
gb|KJB63081.1|  hypothetical protein B456_009G454500                    107   2e-25   Gossypium raimondii
gb|KJB63079.1|  hypothetical protein B456_009G454500                    107   9e-25   Gossypium raimondii
tpg|DAA38718.1|  TPA: calcium ion binding protein                       107   1e-24   
ref|NP_001148758.1|  calcium ion binding protein                        106   1e-24   Zea mays [maize]
ref|XP_008667961.1|  PREDICTED: calcium ion binding protein isofo...    107   2e-24   Zea mays [maize]
emb|CDY42732.1|  BnaA03g48070D                                          106   2e-24   Brassica napus [oilseed rape]
ref|XP_009137599.1|  PREDICTED: probable calcium-binding protein ...    106   2e-24   Brassica rapa
emb|CDX92818.1|  BnaC07g40760D                                          105   3e-24   
emb|CDX94327.1|  BnaC01g18570D                                        96.3    8e-21   
ref|XP_001784911.1|  predicted protein                                94.0    6e-20   
ref|XP_001775820.1|  predicted protein                                93.6    1e-19   
ref|XP_002323775.2|  hypothetical protein POPTR_0017s08200g           90.5    2e-19   
ref|XP_010691276.1|  PREDICTED: probable calcium-binding protein ...  91.3    7e-19   
ref|XP_006840146.1|  hypothetical protein AMTR_s00089p00059230        89.4    3e-18   
ref|XP_006299579.1|  hypothetical protein CARUB_v10015753mg           86.7    9e-18   
ref|XP_002990940.1|  hypothetical protein SELMODRAFT_132549           84.3    2e-16   
ref|XP_002982786.1|  hypothetical protein SELMODRAFT_422194           84.0    3e-16   
ref|XP_002990719.1|  hypothetical protein SELMODRAFT_429138           82.8    7e-16   
ref|XP_002986712.1|  hypothetical protein SELMODRAFT_425580           82.0    1e-15   
ref|XP_007224348.1|  hypothetical protein PRUPE_ppa020720mg           80.9    1e-15   
ref|XP_010468449.1|  PREDICTED: probable calcium-binding protein ...  67.0    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009040569.1|  hypothetical protein AURANDRAFT_66979            64.3    5e-09   Aureococcus anophagefferens
ref|XP_004691277.1|  PREDICTED: calmodulin-like protein 3             61.2    9e-09   
ref|XP_006088486.1|  PREDICTED: calmodulin-like protein 3             60.8    1e-08   Myotis lucifugus
ref|XP_002063560.1|  GK19414                                          60.8    1e-08   Drosophila willistoni
gb|ABF38946.2|  calmodulin                                            60.8    1e-08   Phytomonas serpens
gb|AHA51331.1|  EF-hand_1 domain-containing protein                   62.0    1e-08   Charistephane fugiens
ref|XP_004588547.1|  PREDICTED: calmodulin-like protein 3             60.5    1e-08   Ochotona princeps [southern American pika]
ref|XP_005869569.1|  PREDICTED: calmodulin-like protein 3             60.5    1e-08   Myotis brandtii
gb|AHA51329.1|  EF-hand_1 domain-containing protein                   61.2    1e-08   Charistephane fugiens
gb|AHA51330.1|  EF-hand_1 domain-containing protein                   61.6    2e-08   Charistephane fugiens
emb|CAB40133.1|  calmodulin-like protein                              60.1    2e-08   Branchiostoma floridae
ref|XP_004336073.1|  Calmodulin, putative                             59.7    2e-08   Acanthamoeba castellanii str. Neff
gb|AHA51333.1|  EF-hand_1 domain-containing protein                   61.6    3e-08   Charistephane fugiens
gb|AHA51332.1|  EF-hand_1 domain-containing protein                   61.6    3e-08   Charistephane fugiens
ref|XP_005617262.1|  PREDICTED: calmodulin-like protein 3             58.9    5e-08   
ref|XP_004806636.1|  PREDICTED: calmodulin-like protein 3             58.9    5e-08   
ref|XP_004757981.1|  PREDICTED: calmodulin-like protein 3             58.9    6e-08   Mustela putorius furo [black ferret]
gb|EPB84784.1|  calmodulin                                            58.5    7e-08   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN02697.1|  calmodulin                                           58.5    7e-08   Mucor ambiguus
gb|ELU09134.1|  hypothetical protein CAPTEDRAFT_228814                61.2    8e-08   Capitella teleta
ref|XP_010619737.1|  PREDICTED: calmodulin-like protein 3             58.2    9e-08   Fukomys damarensis [Damara mole rat]
ref|XP_002920391.1|  PREDICTED: calmodulin-like protein 3             58.2    1e-07   Ailuropoda melanoleuca
gb|ETI45580.1|  hypothetical protein F443_09884                       60.1    1e-07   Phytophthora parasitica P1569
ref|XP_008892917.1|  hypothetical protein PPTG_01392                  60.1    1e-07   Phytophthora parasitica INRA-310
gb|ETK85532.1|  hypothetical protein L915_09682                       60.1    1e-07   Phytophthora parasitica
ref|XP_008703623.1|  PREDICTED: calmodulin-like protein 3             57.8    1e-07   Ursus maritimus [white bear]
pdb|3WLC|A  Chain A, Crystal Structure Of Dimeric Gcamp6m             60.1    1e-07   Gallus gallus [bantam]
ref|XP_009526469.1|  hypothetical protein PHYSODRAFT_264348           59.7    2e-07   Phytophthora sojae
gb|EYB86371.1|  hypothetical protein Y032_0280g1224                   58.9    2e-07   Ancylostoma ceylanicum
ref|XP_004477431.1|  PREDICTED: calmodulin-like protein 3             57.0    2e-07   Dasypus novemcinctus
ref|XP_005320369.1|  PREDICTED: calmodulin-like protein 3             57.0    2e-07   Ictidomys tridecemlineatus
ref|XP_006933271.1|  PREDICTED: calmodulin-like protein 3             57.0    2e-07   Felis catus [cat]
emb|CDH56635.1|  calmodulin                                           57.0    3e-07   Lichtheimia corymbifera JMRC:FSU:9682
gb|ADN07535.1|  calmodulin 4                                          56.6    3e-07   Microtus ochrogaster [prairie voles]
gb|ADN07528.1|  calmodulin 4                                          56.6    3e-07   Microtus ochrogaster [prairie voles]
ref|XP_005354981.1|  PREDICTED: calmodulin-4-like                     56.6    3e-07   Microtus ochrogaster [prairie voles]
ref|XP_008835071.1|  PREDICTED: calmodulin-like protein 5             56.6    3e-07   Nannospalax galili
ref|XP_003939101.1|  PREDICTED: calmodulin-like protein 5             56.6    3e-07   Saimiri boliviensis boliviensis
gb|AHA51383.1|  EF-hand_1 domain-containing protein                   57.0    3e-07   Hormiphora californensis
ref|XP_004411877.1|  PREDICTED: calmodulin-like protein 3             56.6    3e-07   Odobenus rosmarus divergens
ref|XP_008583911.1|  PREDICTED: calmodulin-like protein 3             56.6    3e-07   Galeopterus variegatus [Malayan flying lemur]
gb|AJK93879.1|  calmodulin                                            55.8    4e-07   Trypanosoma cruzi
dbj|BAN00003.1|  photoactivatable calcium indicator PA-TNXL           59.3    4e-07   synthetic construct
sp|P11118.2|CALM_EUGGR  RecName: Full=Calmodulin; Short=CaM           56.2    4e-07   Euglena gracilis
ref|XP_007655162.1|  PREDICTED: calmodulin-A-like                     56.2    4e-07   
ref|XP_006158525.1|  PREDICTED: calmodulin-like protein 3             56.2    5e-07   Tupaia chinensis
gb|EYB86370.1|  hypothetical protein Y032_0280g1224                   57.0    5e-07   Ancylostoma ceylanicum
ref|XP_002016663.1|  GL11701                                          56.2    5e-07   Drosophila persimilis
ref|XP_008619093.1|  hypothetical protein SDRG_14719                  58.2    5e-07   Saprolegnia diclina VS20
ref|XP_005704341.1|  calmodulin isoform 1                             56.2    5e-07   Galdieria sulphuraria
gb|KDO27543.1|  hypothetical protein SPRG_06811                       57.8    6e-07   Saprolegnia parasitica CBS 223.65
ref|XP_007901645.1|  PREDICTED: calmodulin-alpha-like                 56.6    6e-07   Callorhinchus milii [Australian ghost shark]
gb|ELU15623.1|  hypothetical protein CAPTEDRAFT_154562                55.8    6e-07   Capitella teleta
ref|XP_002645274.1|  Hypothetical protein CBG00175                    57.4    6e-07   Caenorhabditis briggsae
ref|XP_003473474.1|  PREDICTED: calmodulin-like protein 3             55.8    6e-07   
gb|AJK93862.1|  calmodulin                                            55.5    6e-07   Trypanosoma cruzi
ref|XP_002739903.1|  PREDICTED: calmodulin-like                       55.8    6e-07   Saccoglossus kowalevskii
gb|AJK93511.1|  calmodulin                                            55.1    7e-07   Trypanosoma cruzi
dbj|BAE31439.1|  unnamed protein product                              55.8    7e-07   Mus musculus [mouse]
gb|AJK93530.1|  calmodulin                                            55.1    7e-07   Trypanosoma cruzi
ref|NP_509544.1|  Protein B0563.7                                     57.0    7e-07   Caenorhabditis elegans [roundworm]
ref|XP_001361466.1|  GA10810                                          55.5    7e-07   Drosophila pseudoobscura pseudoobscura
ref|XP_009243366.1|  PREDICTED: calmodulin-like protein 3             55.5    9e-07   
pdb|3SG5|A  Chain A, Crystal Structure Of Dimeric Gcamp3-d380y, Q...  57.8    9e-07   Gallus gallus [bantam]
pdb|3SG4|A  Chain A, Crystal Structure Of Gcamp3-d380y, Lp(linker 2)  57.8    9e-07   Gallus gallus [bantam]
emb|CCM43813.1|  Calmodulin                                           55.1    9e-07   Aspergillus uvarum
ref|XP_003101114.1|  hypothetical protein CRE_14767                   56.6    9e-07   Caenorhabditis remanei
emb|CCM43811.1|  Calmodulin                                           55.1    9e-07   Aspergillus uvarum
ref|XP_006101105.1|  PREDICTED: calmodulin-like                       56.2    1e-06   
pdb|4IK1|A  Chain A, High Resolution Structure Of Gcampj At Ph 8.5    57.8    1e-06   Entacmaea quadricolor
pdb|3SG3|A  Chain A, Crystal Structure Of Gcamp3-d380y                57.8    1e-06   Gallus gallus [bantam]
gb|AJK93872.1|  calmodulin                                            54.7    1e-06   Trypanosoma cruzi
gb|KDQ26002.1|  hypothetical protein PLEOSDRAFT_160601                55.1    1e-06   Pleurotus ostreatus PC15
gb|AJK93873.1|  calmodulin                                            54.7    1e-06   Trypanosoma cruzi
ref|XP_004712675.1|  PREDICTED: calmodulin-like protein 3             55.1    1e-06   Echinops telfairi [lesser hedgehog tenrec]
gb|KIV93842.1|  hypothetical protein PV10_05027                       55.8    1e-06   Exophiala mesophila
gb|KIH66928.1|  EF hand                                               55.8    1e-06   Ancylostoma duodenale
pdb|3SG2|A  Chain A, Crystal Structure Of Gcamp2-t116v,d381y          57.8    1e-06   Gallus gallus [bantam]
ref|XP_006734824.1|  PREDICTED: calmodulin-like protein 3             55.1    1e-06   
gb|KIV93843.1|  hypothetical protein, variant                         55.1    1e-06   
ref|XP_011426071.1|  PREDICTED: calmodulin-like                       55.1    1e-06   
ref|XP_005383897.1|  PREDICTED: calmodulin-like protein 3 isoform X1  55.1    1e-06   
ref|XP_004311487.1|  PREDICTED: calcium-binding protein LPS1-alph...  57.8    1e-06   
ref|NP_001167662.1|  calmodulin                                       55.5    1e-06   
ref|XP_008673387.1|  PREDICTED: uncharacterized protein LOC100502...  55.1    1e-06   
gb|KEQ66637.1|  EF-hand protein                                       55.1    1e-06   
ref|XP_011412832.1|  PREDICTED: calmodulin-like                       55.1    1e-06   
gb|EPB84209.1|  calmodulin                                            55.1    1e-06   
gb|EJY72659.1|  Protein kinase domain containing protein              57.4    1e-06   
ref|XP_008515097.1|  PREDICTED: calmodulin-like protein 3             55.1    1e-06   
gb|AJK93525.1|  calmodulin                                            54.3    1e-06   
ref|XP_005607013.1|  PREDICTED: calmodulin-like protein 3             55.1    1e-06   
gb|AJK93870.1|  calmodulin                                            54.3    1e-06   
gb|AJK93538.1|  calmodulin                                            54.3    1e-06   
gb|AEJ07961.1|  calmodulin                                            55.1    1e-06   
gb|AJK93474.1|  calmodulin                                            54.3    1e-06   
gb|AEO16865.1|  GEX-GECO1                                             57.4    1e-06   
gb|AJK93874.1|  calmodulin                                            54.3    1e-06   
emb|CEP07602.1|  hypothetical protein                                 54.7    1e-06   
gb|AJK93477.1|  calmodulin                                            54.3    1e-06   
pdb|3EKH|A  Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT M...  57.4    1e-06   
gb|KFH46306.1|  Calmodulin-like protein                               54.7    1e-06   
ref|XP_011414765.1|  PREDICTED: calmodulin-beta-like isoform X1       55.5    1e-06   
ref|XP_005071797.1|  PREDICTED: calmodulin-4-like                     54.7    1e-06   
ref|XP_011414766.1|  PREDICTED: calmodulin-beta-like isoform X2       55.1    2e-06   
ref|XP_004425517.1|  PREDICTED: calmodulin-like protein 3             54.7    2e-06   
ref|XP_006122412.1|  PREDICTED: calmodulin                            54.7    2e-06   
emb|CCM43809.1|  Calmodulin                                           54.3    2e-06   
ref|XP_010364795.1|  PREDICTED: calmodulin-like protein 3             54.7    2e-06   
gb|KHN81472.1|  Calmodulin-like protein                               55.1    2e-06   
emb|CEP11988.1|  hypothetical protein                                 54.7    2e-06   
dbj|BAQ56021.1|  yellow cameleon X 2.60                               57.0    2e-06   
ref|XP_007933651.1|  PREDICTED: calmodulin-like protein 3             54.7    2e-06   
gb|ADT61781.1|  calmodulin                                            54.7    2e-06   
ref|XP_007874813.1|  hypothetical protein PNEG_02782                  54.7    2e-06   
ref|XP_011434023.1|  PREDICTED: calmodulin-A-like isoform X2          54.7    2e-06   
gb|KIZ02811.1|  calmodulin                                            54.3    2e-06   
gb|AJK93488.1|  calmodulin                                            53.9    2e-06   
ref|XP_808090.1|  calmodulin                                          54.3    2e-06   
ref|XP_009022608.1|  hypothetical protein HELRODRAFT_138077           53.1    2e-06   
gb|KHJ97775.1|  EF hand                                               55.5    2e-06   
ref|XP_011434020.1|  PREDICTED: calmodulin-A-like isoform X1          54.7    2e-06   
gb|AHC56510.1|  calmodulin                                            54.3    2e-06   
gb|AJK93480.1|  calmodulin                                            53.9    2e-06   
emb|CCM43812.1|  Calmodulin                                           54.3    2e-06   
gb|AJK93519.1|  calmodulin                                            53.9    2e-06   
gb|AHJ60497.1|  calmodulin                                            54.3    2e-06   
gb|KIW82217.1|  hypothetical protein Z517_05244                       54.7    2e-06   
ref|XP_003410646.1|  PREDICTED: calmodulin-like protein 3             54.3    2e-06   
ref|XP_009840756.1|  hypothetical protein, variant                    56.6    2e-06   
ref|XP_008730011.1|  hypothetical protein G647_07474                  54.7    2e-06   
ref|NP_001183849.1|  uncharacterized protein LOC100502442             55.1    2e-06   
gb|AFV80091.1|  calmodulin                                            54.3    2e-06   
ref|XP_009840757.1|  hypothetical protein H257_14590                  56.6    2e-06   
ref|XP_805243.1|  calmodulin                                          54.3    2e-06   
ref|XP_002734090.1|  PREDICTED: calmodulin-like                       54.3    2e-06   
ref|XP_006043080.1|  PREDICTED: calmodulin-like                       54.3    2e-06   
gb|AHJ60495.1|  calmodulin                                            53.9    2e-06   
ref|XP_001749021.1|  hypothetical protein                             54.3    2e-06   
ref|NP_001103834.1|  neo-calmodulin                                   54.3    2e-06   
ref|XP_002049382.1|  GJ20779                                          53.5    2e-06   
ref|XP_006862796.1|  PREDICTED: calmodulin-like protein 3             54.3    2e-06   
gb|AJK93510.1|  calmodulin                                            53.5    2e-06   
gb|KIW33986.1|  hypothetical protein PV07_00792                       54.7    3e-06   
emb|CEP09792.1|  hypothetical protein                                 53.9    3e-06   
gb|AJK93522.1|  calmodulin                                            53.5    3e-06   
ref|XP_808089.1|  calmodulin                                          55.1    3e-06   
emb|CDJ00366.1|  CalModulin family member (cmd 1)                     53.9    3e-06   
ref|XP_829359.1|  calmodulin                                          53.9    3e-06   
emb|CCW64575.1|  unnamed protein product                              53.9    3e-06   
pdb|1F54|A  Chain A, Solution Structure Of The Apo N-Terminal Dom...  52.8    3e-06   
gb|AJK93493.1|  calmodulin                                            53.5    3e-06   
gb|AJK93544.1|  calmodulin                                            53.5    3e-06   
ref|XP_009056059.1|  hypothetical protein LOTGIDRAFT_216192           53.9    3e-06   
ref|XP_003473475.1|  PREDICTED: calmodulin-4-like                     53.9    3e-06   
dbj|GAN08323.1|  calmodulin                                           54.3    3e-06   
ref|XP_004662458.1|  PREDICTED: calmodulin-4-like                     53.9    3e-06   
ref|XP_009056060.1|  hypothetical protein LOTGIDRAFT_216194           53.9    3e-06   
pdb|1GGZ|A  Chain A, Crystal Structure Of The Calmodulin-Like Pro...  53.9    3e-06   
gb|EHH17309.1|  hypothetical protein EGK_13688                        53.9    3e-06   
sp|P41041.1|CALM_PNECA  RecName: Full=Calmodulin; Short=CaM           53.9    3e-06   
ref|XP_004897704.1|  PREDICTED: calmodulin-like protein 3             53.9    3e-06   
sp|P21251.2|CALM_STIJA  RecName: Full=Calmodulin; Short=CaM           53.9    3e-06   
emb|CAA56517.1|  calmodulin                                           53.5    3e-06   
emb|CEG63332.1|  Putative Calmodulin                                  53.1    3e-06   
emb|CBY09922.1|  unnamed protein product                              53.9    3e-06   
ref|NP_001104289.1|  calmodulin                                       53.9    3e-06   
emb|CEG69250.1|  Putative Calmodulin                                  53.9    3e-06   
ref|XP_004322571.1|  PREDICTED: calmodulin                            53.1    3e-06   
ref|XP_006048328.1|  PREDICTED: calmodulin-like                       53.9    3e-06   
gb|KIW64098.1|  hypothetical protein PV04_09056                       54.3    3e-06   
ref|XP_005068466.1|  PREDICTED: calmodulin isoform X1                 54.7    3e-06   
ref|NP_005176.1|  calmodulin-like protein 3                           53.9    3e-06   
gb|AAX36139.1|  calmodulin-like 3                                     53.9    3e-06   
ref|XP_010348000.1|  PREDICTED: calmodulin-like protein 3             53.9    3e-06   
ref|XP_003257649.1|  PREDICTED: calmodulin-like protein 3             53.9    3e-06   
sp|P02594.2|CALM_ELEEL  RecName: Full=Calmodulin; Short=CaM           53.9    3e-06   
ref|XP_780862.2|  PREDICTED: calmodulin-like                          53.5    4e-06   
gb|KFK30981.1|  hypothetical protein AALP_AA6G053300                  56.2    4e-06   
gb|EHL02509.1|  putative Calmodulin                                   53.5    4e-06   
gb|EPB83786.1|  calmodulin                                            53.5    4e-06   
ref|XP_002450213.1|  hypothetical protein SORBIDRAFT_05g002010        54.3    4e-06   
gb|AAX26683.2|  SJCHGC00574 protein                                   53.5    4e-06   
ref|XP_003704227.1|  PREDICTED: calmodulin-like                       55.5    4e-06   
ref|XP_002063306.1|  GK21454                                          53.5    4e-06   
ref|XP_005896150.1|  PREDICTED: calmodulin-like                       53.5    4e-06   
ref|XP_003903394.1|  PREDICTED: calmodulin-like protein 3             53.5    4e-06   
ref|XP_001638669.1|  predicted protein                                53.5    4e-06   
ref|XP_006891931.1|  PREDICTED: calmodulin-like protein 3 isoform X1  53.5    4e-06   
dbj|BAE40191.1|  unnamed protein product                              53.5    4e-06   
gb|EFX01025.1|  calmodulin                                            53.5    4e-06   
gb|ABY87953.1|  hypothetical protein                                  53.5    4e-06   
gb|KFO26283.1|  Calmodulin                                            53.9    4e-06   
gb|ACP18969.1|  calcium binding protein                               53.5    4e-06   
ref|XP_005889388.1|  PREDICTED: calmodulin-like                       53.5    4e-06   
dbj|GAN11834.1|  calmodulin                                           53.5    4e-06   
ref|XP_004648642.1|  PREDICTED: calmodulin-like                       53.5    4e-06   
ref|XP_002124710.1|  PREDICTED: calmodulin-beta-like                  53.5    4e-06   
sp|P05932.1|CALMB_ARBPU  RecName: Full=Calmodulin-beta; Short=Cam B   53.1    4e-06   
gb|ADX97191.1|  calmodulin                                            53.1    4e-06   
ref|XP_008119752.1|  PREDICTED: calmodulin                            54.7    4e-06   
ref|XP_005311526.1|  PREDICTED: calmodulin isoform X2                 53.5    4e-06   
gb|ERT02366.1|  calmodulin                                            53.5    4e-06   
gb|EHB00855.1|  Calmodulin                                            54.3    4e-06   
ref|XP_009315838.1|  calmodulin                                       53.5    5e-06   
sp|P11121.2|CALM_PYUSP  RecName: Full=Calmodulin; Short=CaM           53.5    5e-06   
ref|XP_006158060.1|  PREDICTED: calmodulin isoform X2                 53.5    5e-06   
ref|XP_005901002.1|  PREDICTED: calmodulin isoform X1                 53.9    5e-06   
emb|CBH18329.1|  calmodulin, putative, (fragment)                     53.5    5e-06   
gb|AJK93854.1|  calmodulin                                            52.8    5e-06   
gb|AJK93484.1|  calmodulin                                            52.8    5e-06   
ref|XP_004607860.1|  PREDICTED: calmodulin                            53.9    5e-06   
ref|XP_001514069.3|  PREDICTED: neo-calmodulin                        53.5    5e-06   
gb|ETN79443.1|  EF hand                                               53.1    5e-06   
gb|EOA93816.1|  Calmodulin                                            53.1    5e-06   
ref|XP_006213627.1|  PREDICTED: calcium-binding protein 7             54.3    5e-06   
sp|Q95NI4.3|CALM_HALOK  RecName: Full=Calmodulin; Short=CaM           53.5    5e-06   
gb|ADP20511.1|  calmodulin isoform 3                                  53.5    5e-06   
pdb|1AHR|A  Chain A, Calmodulin Mutant With A Two Residue Deletio...  53.1    5e-06   
ref|XP_004710659.1|  PREDICTED: calmodulin                            53.9    5e-06   
gb|ACO08608.1|  Calmodulin                                            53.5    5e-06   
emb|CCQ18612.1|  Calmodulin and related proteins                      53.5    5e-06   
gb|AII16520.1|  calmodulin                                            53.5    5e-06   
emb|CDQ82670.1|  unnamed protein product                              54.3    5e-06   
emb|CDQ63172.1|  unnamed protein product                              53.5    5e-06   
gb|ETE70432.1|  Calmodulin                                            53.9    5e-06   
gb|KFY83286.1|  hypothetical protein V498_08181                       53.9    5e-06   
gb|EGV91917.1|  Calmodulin                                            53.5    5e-06   
ref|XP_005483194.1|  PREDICTED: calmodulin                            53.9    5e-06   
gb|KFY20747.1|  hypothetical protein V491_03461                       53.9    5e-06   
gb|AIW62485.1|  hypothetical protein                                  53.1    5e-06   
sp|O96102.3|CALM_PHYPO  RecName: Full=Calmodulin; Short=CaM           53.1    5e-06   
gb|EGI70237.1|  Calmodulin                                            53.5    5e-06   
ref|XP_002738870.1|  PREDICTED: calmodulin-like                       53.1    5e-06   
ref|NP_001119640.2|  calmodulin                                       53.1    5e-06   
gb|EZA53913.1|  Calmodulin                                            53.5    5e-06   
ref|XP_006839639.1|  PREDICTED: calmodulin                            53.5    5e-06   
ref|NP_503386.1|  Protein CMD-1                                       53.1    5e-06   
gb|AEK21539.1|  calmodulin A                                          53.1    5e-06   
ref|XP_003787945.1|  PREDICTED: calmodulin-like isoform 3             53.5    5e-06   
ref|XP_004660259.1|  PREDICTED: calmodulin                            54.7    5e-06   
gb|KIW00696.1|  calmodulin, variant                                   52.8    5e-06   
tpg|DAA39264.1|  TPA: calmodulin                                      53.5    5e-06   
ref|XP_011436578.1|  PREDICTED: calmodulin isoform X1                 53.1    5e-06   
dbj|GAM85876.1|  hypothetical protein ANO11243_038860                 53.1    5e-06   
emb|CDS28106.1|  CalModulin family member (cmd 1)                     53.1    5e-06   
ref|NP_523710.1|  calmodulin, isoform A                               53.1    5e-06   
ref|NP_001271970.1|  uncharacterized protein LOC101865168             53.1    5e-06   
ref|XP_003787033.1|  PREDICTED: calmodulin-like isoform 3             53.5    5e-06   
emb|CDQ68710.1|  unnamed protein product                              53.9    5e-06   
dbj|BAE26689.1|  unnamed protein product                              53.9    5e-06   
ref|XP_001552123.1|  calmodulin                                       53.1    5e-06   
gb|EPQ02469.1|  Calmodulin                                            53.5    5e-06   
ref|XP_007750506.1|  calmodulin                                       52.8    5e-06   
gb|EFN84484.1|  Calmodulin                                            53.1    5e-06   
ref|XP_008668118.1|  PREDICTED: calmodulin isoform X1                 53.9    5e-06   
gb|EHB18285.1|  Calmodulin                                            53.9    5e-06   
gb|KFM12302.1|  Calmodulin                                            53.1    5e-06   
sp|P05934.1|CALM_STRPU  RecName: Full=Calmodulin; Short=CaM           52.0    5e-06   
ref|XP_008546587.1|  PREDICTED: calmodulin isoform X1                 53.1    5e-06   
gb|AID21732.1|  calmodulin                                            53.1    5e-06   
ref|XP_011170849.1|  PREDICTED: calmodulin                            53.1    5e-06   
gb|AGJ52108.1|  calmodulin isoform A                                  53.1    5e-06   
gb|EDL38633.1|  mCG15892                                              53.5    5e-06   
ref|XP_006909678.1|  PREDICTED: calmodulin isoform X1                 53.1    6e-06   
sp|O96081.3|CALMB_HALRO  RecName: Full=Calmodulin-B; Short=CaM B      53.1    6e-06   
dbj|BAE89379.1|  unnamed protein product                              53.1    6e-06   
gb|ACT88125.1|  AT15141p                                              53.5    6e-06   
ref|XP_005321404.1|  PREDICTED: calmodulin                            53.5    6e-06   
gb|AAY41437.1|  calmodulin 2                                          53.1    6e-06   
ref|XP_009929788.1|  PREDICTED: calmodulin-A                          53.5    6e-06   
emb|CAA64361.1|  calcium-binding protein                              51.6    6e-06   
ref|XP_001113485.1|  PREDICTED: calmodulin-like isoform 4             53.5    6e-06   
gb|KFO18269.1|  Calmodulin                                            53.5    6e-06   
ref|XP_005416368.1|  PREDICTED: calmodulin                            53.5    6e-06   
ref|XP_005983661.1|  PREDICTED: calmodulin-like                       53.1    6e-06   
ref|XP_006903691.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin 3...  53.5    6e-06   
gb|EFB29281.1|  hypothetical protein PANDA_012183                     53.1    6e-06   
ref|XP_009864485.1|  PREDICTED: calmodulin-A-like                     54.7    6e-06   
gb|EFB15999.1|  hypothetical protein PANDA_009631                     53.1    6e-06   
gb|EMP23892.1|  Calmodulin                                            53.1    6e-06   
ref|XP_003758346.1|  PREDICTED: calmodulin-like                       53.5    6e-06   
ref|XP_001177619.1|  PREDICTED: calmodulin-1-like isoform 1           53.1    6e-06   
gb|ELR03702.1|  calmodulin                                            53.1    6e-06   
ref|XP_007652432.1|  PREDICTED: calmodulin-like protein 5 isoform X2  52.8    6e-06   
gb|AAA33569.1|  calmodulin                                            53.1    6e-06   
ref|XP_007910199.1|  PREDICTED: calmodulin-A-like                     53.9    6e-06   
gb|EWC46978.1|  calmodulin                                            53.1    6e-06   
gb|EPQ10746.1|  Calmodulin                                            53.9    6e-06   
ref|XP_010392081.1|  PREDICTED: calmodulin                            53.5    6e-06   
gb|KFX94087.1|  hypothetical protein V490_04534                       54.3    6e-06   
gb|ADN68265.1|  calmodulin                                            52.8    6e-06   
gb|ADN68246.1|  calmodulin                                            52.8    6e-06   
pdb|2BBM|A  Chain A, Solution Structure Of A Calmodulin-Target Pe...  53.1    6e-06   
ref|XP_009061568.1|  hypothetical protein LOTGIDRAFT_219848           53.5    6e-06   
ref|XP_004977460.1|  PREDICTED: putative calmodulin-like protein ...  53.5    6e-06   
ref|XP_002185048.1|  calmodulin                                       53.1    6e-06   
pdb|2K7C|A  Chain A, Nmr Structure Of Mg2+-Bound Cabp1 C-Domain       51.6    6e-06   
gb|ACN10373.1|  Calmodulin                                            53.1    6e-06   



>ref|XP_009801783.1| PREDICTED: probable calcium-binding protein CML22 [Nicotiana 
sylvestris]
Length=247

 Score =   227 bits (578),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +3

Query  93   MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  272
            MK SVG ++ C  LKL+S+KVG++LC   +PNKY RLD+KLE K++E+KR++    + RS
Sbjct  1    MKDSVGSAQSCPVLKLLSNKVGNILCFWNAPNKYRRLDAKLEAKMMELKRSSSVQTNFRS  60

Query  273  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  452
            IN++ILKFP F+EGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEID+LF S
Sbjct  61   INSIILKFPQFKEGLKEIKGVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEIDDLFHS  120

Query  453  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSP  569
            CDVD+ E I+FNEFIVLLCLIYLL D+ SS +TSKIGSP
Sbjct  121  CDVDEKEGIQFNEFIVLLCLIYLLTDSSSSRNTSKIGSP  159



>ref|XP_009619221.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009619222.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Nicotiana tomentosiformis]
Length=248

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  93   MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  272
            MK SVG ++ C  LKL+S+KVG++LC   +P KY RLD+KLETK++E+KR++    + RS
Sbjct  1    MKDSVGSAQSCPVLKLLSNKVGNILCFRNAPKKYRRLDAKLETKMIELKRSSSGQTNFRS  60

Query  273  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  452
            IN++ILKFP FREGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEI++LF S
Sbjct  61   INSIILKFPQFREGLKEIKAVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEINDLFHS  120

Query  453  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSP  569
            CDVD+NE I+FNEFIVLLCLIYLL D+ SS  +T KIGSP
Sbjct  121  CDVDENEGIQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSP  160



>ref|XP_009619224.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Nicotiana tomentosiformis]
Length=246

 Score =   217 bits (553),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 132/160 (83%), Gaps = 3/160 (2%)
 Frame = +3

Query  93   MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  272
            MK SV  S  C  LKL+S+KVG++LC   +P KY RLD+KLETK++E+KR++    + RS
Sbjct  1    MKDSVAQS--CPVLKLLSNKVGNILCFRNAPKKYRRLDAKLETKMIELKRSSSGQTNFRS  58

Query  273  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  452
            IN++ILKFP FREGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEI++LF S
Sbjct  59   INSIILKFPQFREGLKEIKAVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEINDLFHS  118

Query  453  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSP  569
            CDVD+NE I+FNEFIVLLCLIYLL D+ SS  +T KIGSP
Sbjct  119  CDVDENEGIQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSP  158



>ref|XP_009619226.1| PREDICTED: probable calcium-binding protein CML22 isoform X4 
[Nicotiana tomentosiformis]
Length=245

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = +3

Query  108  GLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALI  287
            G ++ C  LKL+S+KVG++LC   +P KY RLD+KLETK++E+KR++    + RSIN++I
Sbjct  3    GSAQSCPVLKLLSNKVGNILCFRNAPKKYRRLDAKLETKMIELKRSSSGQTNFRSINSII  62

Query  288  LKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDD  467
            LKFP FREGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEI++LF SCDVD+
Sbjct  63   LKFPQFREGLKEIKAVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEINDLFHSCDVDE  122

Query  468  NEKIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSP  569
            NE I+FNEFIVLLCLIYLL D+ SS  +T KIGSP
Sbjct  123  NEGIQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSP  157



>ref|XP_009619227.1| PREDICTED: probable calcium-binding protein CML22 isoform X5 
[Nicotiana tomentosiformis]
Length=243

 Score =   214 bits (546),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +3

Query  114  SRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILK  293
            ++ C  LKL+S+KVG++LC   +P KY RLD+KLETK++E+KR++    + RSIN++ILK
Sbjct  3    AQSCPVLKLLSNKVGNILCFRNAPKKYRRLDAKLETKMIELKRSSSGQTNFRSINSIILK  62

Query  294  FPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNE  473
            FP FREGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEI++LF SCDVD+NE
Sbjct  63   FPQFREGLKEIKAVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEINDLFHSCDVDENE  122

Query  474  KIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSP  569
             I+FNEFIVLLCLIYLL D+ SS  +T KIGSP
Sbjct  123  GIQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSP  155



>ref|XP_009619225.1| PREDICTED: probable calcium-binding protein CML22 isoform X3 
[Nicotiana tomentosiformis]
Length=246

 Score =   214 bits (545),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 132/160 (83%), Gaps = 3/160 (2%)
 Frame = +3

Query  93   MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  272
            MK SVG ++ C  LKL+S+KVG++LC   +P KY RLD+KLETK++E+KR++    + RS
Sbjct  1    MKDSVGSAQSCPVLKLLSNKVGNILCFRNAPKKYRRLDAKLETKMIELKRSSSGQTNFRS  60

Query  273  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  452
            IN++ILKFP FREGLKEI+ VFEQF  DSNG IDREELKKC++KLQFHV EEEI++LF S
Sbjct  61   INSIILKFPQFREGLKEIKAVFEQF--DSNGTIDREELKKCVKKLQFHVKEEEINDLFHS  118

Query  453  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSP  569
            CDVD+NE I+FNEFIVLLCLIYLL D+ SS  +T KIGSP
Sbjct  119  CDVDENEGIQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSP  158



>ref|XP_008380562.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Malus domestica]
Length=253

 Score =   201 bits (512),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +3

Query  84   LKTMKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLS  263
            +KT   S G S     LK +S+KVG +LCC  SPNKYSRLD+KLE K++EVKR +    +
Sbjct  1    MKTSSPSAGTSHLRSQLKSMSNKVGGMLCCCSSPNKYSRLDAKLEKKMVEVKRGSLGRSN  60

Query  264  IRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDEL  443
             +SI+++I++FP FRE LK+IR VFEQ+DEDSNG IDREELKKCLQKLQ H+  EEI++L
Sbjct  61   FKSIDSIIMRFPQFREELKKIRDVFEQYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDL  120

Query  444  FRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSP  569
            F SCD+D +E I+FNEFIVLLCLIYLL +  SS + SKI SP
Sbjct  121  FHSCDMDGSEGIQFNEFIVLLCLIYLLKEPSSSHTISKINSP  162



>ref|XP_009374596.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Pyrus x bretschneideri]
Length=253

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = +3

Query  84   LKTMKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLS  263
            +KT   S G S     LK +S+KVG +LCC  SPNKYSRLD+KLE K++EVKR      +
Sbjct  1    MKTSSPSAGTSHLRSQLKSMSNKVGGMLCCCSSPNKYSRLDAKLEKKMVEVKRGYLGRSN  60

Query  264  IRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDEL  443
             +SI+++I++FP FRE LK+IR VFEQ+DEDSNG IDREELKKCLQKLQ H+  EEI++L
Sbjct  61   FKSIDSIIMRFPQFREELKKIRDVFEQYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDL  120

Query  444  FRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSP  569
            F SCD+D +E I+FNEFIVLLCLIYLL +  SS + SKI SP
Sbjct  121  FHSCDMDGSEGIQFNEFIVLLCLIYLLKEPSSSHTISKINSP  162



>ref|XP_007034374.1| Calcium-binding EF-hand family protein isoform 3 [Theobroma cacao]
 gb|EOY05300.1| Calcium-binding EF-hand family protein isoform 3 [Theobroma cacao]
Length=217

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 125/156 (80%), Gaps = 1/156 (1%)
 Frame = +3

Query  105  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  284
            +G  RPC SLK +S  +G +LC  GSPNKY +LDSKLE K++E+KR+A    + +SI+++
Sbjct  1    MGKCRPCPSLKSLSSTIGGMLCHCGSPNKYKKLDSKLERKMIEMKRSASGQSNFKSIDSI  60

Query  285  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  464
            I++FP FR+GLK +R VFEQ+DEDSNG IDREEL KCL+KLQFH+ +EE+++LF SCD+D
Sbjct  61   IVRFPQFRDGLKNLRGVFEQYDEDSNGTIDREELNKCLEKLQFHLTKEEVEDLFHSCDID  120

Query  465  DNEKIKFNEFIVLLCLIYLLMD-APSSGSTSKIGSP  569
             +E I+FNEFIVLLCLIYLLM  +PS  +T KI SP
Sbjct  121  GSEGIQFNEFIVLLCLIYLLMKPSPSPDTTLKIDSP  156



>ref|XP_004247862.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Solanum lycopersicum]
Length=252

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  108  GLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALI  287
            G ++PCL LKL+S+K+GSLLC   SP KY RLD+KLE K++E+KR++      RSIN +I
Sbjct  3    GSAQPCLVLKLLSNKIGSLLCFWNSPKKYRRLDTKLEMKMVELKRSSSGESKFRSINGII  62

Query  288  LKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDD  467
            LKFPHF+EGLKEI+ VFEQFDEDSNG IDR+ELKKC++KL FH  +EE+++LF SCDVD+
Sbjct  63   LKFPHFKEGLKEIKDVFEQFDEDSNGTIDRDELKKCVKKLHFHAKDEEVNDLFDSCDVDE  122

Query  468  NEKIKFNEFIVLLCLIYLLMD-APSSGSTSKIGSP  569
            NE I+FNEFIVLLCL+YLL+D + SSG+T+KIGSP
Sbjct  123  NEGIQFNEFIVLLCLLYLLIDSSSSSGNTTKIGSP  157



>ref|XP_007223706.1| hypothetical protein PRUPE_ppa010393mg [Prunus persica]
 gb|EMJ24905.1| hypothetical protein PRUPE_ppa010393mg [Prunus persica]
Length=251

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 125/160 (78%), Gaps = 1/160 (1%)
 Frame = +3

Query  93   MKGSVGL-SRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIR  269
            MKGS    +  C  LK +S+KVGS+LCC GS NKYSRLD+KLE K++E KR +    + +
Sbjct  1    MKGSTSTGTSHCPYLKSLSNKVGSMLCCRGSTNKYSRLDAKLEKKMVEFKRGSLGRSNFK  60

Query  270  SINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFR  449
            SI+++I++FP FRE LK+IR VFEQ+DEDSNG ID EELKKCLQKL+ H+  EEI++LF 
Sbjct  61   SIDSIIMRFPQFREELKKIRDVFEQYDEDSNGTIDLEELKKCLQKLELHLTAEEIEDLFH  120

Query  450  SCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSP  569
            SCD+D +E I+FNEFIVLLCLIYLL +  SS +TSKI SP
Sbjct  121  SCDMDGSEGIQFNEFIVLLCLIYLLKEPSSSHNTSKIDSP  160



>ref|XP_008224499.1| PREDICTED: probable calcium-binding protein CML22 [Prunus mume]
 ref|XP_008224500.1| PREDICTED: probable calcium-binding protein CML22 [Prunus mume]
Length=251

 Score =   196 bits (499),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 125/160 (78%), Gaps = 1/160 (1%)
 Frame = +3

Query  93   MKGSVGL-SRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIR  269
            MKGS    +  C  LK +S+KVGS+LCC  S NKYSRLD+KLE K++EVKR +    + +
Sbjct  1    MKGSTSTGTSHCPYLKSLSNKVGSMLCCRDSTNKYSRLDAKLEKKMVEVKRASLGRSNFK  60

Query  270  SINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFR  449
            SI+++I++FP FRE LK+IR VFEQ+DEDSNG ID EELKKCLQKL+ H+  EEI++LF 
Sbjct  61   SIDSIIMRFPQFREELKKIRDVFEQYDEDSNGTIDLEELKKCLQKLELHLTAEEIEDLFH  120

Query  450  SCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSP  569
            SCD+D +E I+FNEFIVLLCLIYLL +  SS +TSKI SP
Sbjct  121  SCDMDGSEGIQFNEFIVLLCLIYLLKEPSSSHNTSKIDSP  160



>ref|XP_002300172.2| hypothetical protein POPTR_0001s32210g [Populus trichocarpa]
 gb|EEE84977.2| hypothetical protein POPTR_0001s32210g [Populus trichocarpa]
Length=249

 Score =   196 bits (499),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 127/160 (79%), Gaps = 1/160 (1%)
 Frame = +3

Query  93   MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  272
            MK S+G S+PC SLK ++ K+G + C  GSPNKY RLD+KLE K++E+KR++    + +S
Sbjct  1    MKDSLGTSQPCPSLKSLTSKLGGMFCHCGSPNKYKRLDAKLEKKLIELKRSSSGKTNFKS  60

Query  273  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  452
            +N++I++FP F+E LK IR VFEQ+DED+NG ID EELKKCLQ LQ ++ EEE+++LF S
Sbjct  61   MNSIIMRFPQFKEELKHIRGVFEQYDEDANGNIDMEELKKCLQNLQLNLKEEEVEDLFHS  120

Query  453  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSP  569
            CD+D +E I+FNEFIVLLCLIYLL++  SS   TSK+GSP
Sbjct  121  CDIDQSEGIQFNEFIVLLCLIYLLVEHSSSPLRTSKMGSP  160



>ref|XP_007034373.1| Calcium-binding EF-hand family protein isoform 2 [Theobroma cacao]
 gb|EOY05299.1| Calcium-binding EF-hand family protein isoform 2 [Theobroma cacao]
Length=220

 Score =   194 bits (492),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 126/159 (79%), Gaps = 4/159 (3%)
 Frame = +3

Query  105  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  284
            +G  RPC SLK +S  +G +LC  GSPNKY +LDSKLE K++E+KR+A    + +SI+++
Sbjct  1    MGKCRPCPSLKSLSSTIGGMLCHCGSPNKYKKLDSKLERKMIEMKRSASGQSNFKSIDSI  60

Query  285  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  464
            I++FP FR+GLK +R VFEQ+DEDSNG IDREEL KCL+KLQFH+ +EE+++LF SCD+D
Sbjct  61   IVRFPQFRDGLKNLRGVFEQYDEDSNGTIDREELNKCLEKLQFHLTKEEVEDLFHSCDID  120

Query  465  DNEKIKFNEFIVLLCLIYLLMD---APSSGSTS-KIGSP  569
             +E I+FNEFIVLLCLIYLLM    +P + ST+ KI SP
Sbjct  121  GSEGIQFNEFIVLLCLIYLLMKPSPSPDTVSTTLKIDSP  159



>ref|XP_008380563.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Malus domestica]
Length=234

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +3

Query  141  VSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLK  320
            +S+KVG +LCC  SPNKYSRLD+KLE K++EVKR +    + +SI+++I++FP FRE LK
Sbjct  1    MSNKVGGMLCCCSSPNKYSRLDAKLEKKMVEVKRGSLGRSNFKSIDSIIMRFPQFREELK  60

Query  321  EIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIV  500
            +IR VFEQ+DEDSNG IDREELKKCLQKLQ H+  EEI++LF SCD+D +E I+FNEFIV
Sbjct  61   KIRDVFEQYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDLFHSCDMDGSEGIQFNEFIV  120

Query  501  LLCLIYLLMDAPSSGSTSKIGSP  569
            LLCLIYLL +  SS + SKI SP
Sbjct  121  LLCLIYLLKEPSSSHTISKINSP  143



>ref|XP_004299109.1| PREDICTED: probable calcium-binding protein CML22 [Fragaria vesca 
subsp. vesca]
Length=243

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 120/159 (75%), Gaps = 4/159 (3%)
 Frame = +3

Query  93   MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  272
            MK S G S  C S+K +SDKVG +LCC GS NKYSRLD+KLE ++ E KR +    + RS
Sbjct  1    MKAS-GTSHLCCSVKTLSDKVGGMLCCRGSANKYSRLDAKLEKRMAEFKRVSSGQSNFRS  59

Query  273  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  452
            I+++IL+FP FRE LK IR VF+ +DEDSNG IDREELKKCLQKLQ H+  EEI++LF S
Sbjct  60   IDSIILRFPQFREELKNIRNVFDLYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDLFHS  119

Query  453  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSP  569
            CD+D +E I+FNEFIVLLCLIYLL D     +TSKI  P
Sbjct  120  CDMDGSEGIQFNEFIVLLCLIYLLKDP---NTTSKIDCP  155



>ref|XP_007034372.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao]
 gb|EOY05298.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao]
Length=244

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 126/159 (79%), Gaps = 4/159 (3%)
 Frame = +3

Query  105  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  284
            +G  RPC SLK +S  +G +LC  GSPNKY +LDSKLE K++E+KR+A    + +SI+++
Sbjct  1    MGKCRPCPSLKSLSSTIGGMLCHCGSPNKYKKLDSKLERKMIEMKRSASGQSNFKSIDSI  60

Query  285  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  464
            I++FP FR+GLK +R VFEQ+DEDSNG IDREEL KCL+KLQFH+ +EE+++LF SCD+D
Sbjct  61   IVRFPQFRDGLKNLRGVFEQYDEDSNGTIDREELNKCLEKLQFHLTKEEVEDLFHSCDID  120

Query  465  DNEKIKFNEFIVLLCLIYLLMD---APSSGSTS-KIGSP  569
             +E I+FNEFIVLLCLIYLLM    +P + ST+ KI SP
Sbjct  121  GSEGIQFNEFIVLLCLIYLLMKPSPSPDTVSTTLKIDSP  159



>ref|XP_009374597.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Pyrus x bretschneideri]
Length=234

 Score =   193 bits (490),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +3

Query  141  VSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLK  320
            +S+KVG +LCC  SPNKYSRLD+KLE K++EVKR      + +SI+++I++FP FRE LK
Sbjct  1    MSNKVGGMLCCCSSPNKYSRLDAKLEKKMVEVKRGYLGRSNFKSIDSIIMRFPQFREELK  60

Query  321  EIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIV  500
            +IR VFEQ+DEDSNG IDREELKKCLQKLQ H+  EEI++LF SCD+D +E I+FNEFIV
Sbjct  61   KIRDVFEQYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDLFHSCDMDGSEGIQFNEFIV  120

Query  501  LLCLIYLLMDAPSSGSTSKIGSP  569
            LLCLIYLL +  SS + SKI SP
Sbjct  121  LLCLIYLLKEPSSSHTISKINSP  143



>ref|XP_006366840.1| PREDICTED: probable calcium-binding protein CML22-like [Solanum 
tuberosum]
Length=262

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  108  GLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALI  287
            G ++PCL LKL+S+KVGSLLC   +P KY RLD+KLETK++E+KR++      RSIN++I
Sbjct  3    GSAQPCLVLKLLSNKVGSLLCFWNAPKKYRRLDTKLETKMVELKRSSSGQSKFRSINSII  62

Query  288  LKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDD  467
            LKFPHF+EGLKEI+ VFEQFDEDSNG IDR+ELKKC++KL FHV +EE+++LF SCDVD+
Sbjct  63   LKFPHFKEGLKEIKGVFEQFDEDSNGTIDRDELKKCVKKLHFHVKDEEVNDLFDSCDVDE  122

Query  468  NEKIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSP  569
             E I+FNEFIVLLCL+YLL+D+ SS  +TSKIGSP
Sbjct  123  KEGIQFNEFIVLLCLLYLLIDSSSSSENTSKIGSP  157



>ref|XP_011045652.1| PREDICTED: probable calcium-binding protein CML22 [Populus euphratica]
 ref|XP_011045653.1| PREDICTED: probable calcium-binding protein CML22 [Populus euphratica]
Length=248

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 127/160 (79%), Gaps = 1/160 (1%)
 Frame = +3

Query  93   MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  272
            MK S+G S+PC SLK ++ K+G +L   GSPNKY RLD+KLE K++E+KR++    + +S
Sbjct  1    MKDSLGTSQPCPSLKSLTSKLGGMLHRCGSPNKYKRLDAKLEKKLIELKRSSSGKTNFKS  60

Query  273  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  452
            +N++I++FP F+E LK IR VFEQ+DED+NG ID +ELKKCLQ LQ ++ EEE+++LF S
Sbjct  61   MNSIIMRFPQFKEELKHIRGVFEQYDEDANGNIDMKELKKCLQNLQLNLKEEEVEDLFHS  120

Query  453  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSP  569
            CD+D +E I+FNEFIVLLCLIYLL++  SS   TSK+GSP
Sbjct  121  CDIDQSEGIQFNEFIVLLCLIYLLVEHSSSPLRTSKMGSP  160



>ref|XP_002266666.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Vitis vinifera]
 emb|CBI17320.3| unnamed protein product [Vitis vinifera]
Length=248

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = +3

Query  93   MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  272
            MK SVG   P  +LK  S KVG +L   GS NKY +LD+KLE K++EVKRN     + RS
Sbjct  1    MKQSVGTFYPRTALKSFSSKVGVMLFRCGSSNKYKKLDAKLERKMMEVKRNTSGRNNFRS  60

Query  273  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  452
             +++I++FP F+EGLK IR VF Q+DEDSNG ID EELKKCLQKLQ H+ E+EID+LF S
Sbjct  61   FDSIIMRFPQFKEGLKNIRGVFAQYDEDSNGIIDHEELKKCLQKLQLHLTEQEIDDLFCS  120

Query  453  CDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSKIGSP  569
            CD D ++ I+FNEFIV+LCLIYLLM+ + S+  TSK+GSP
Sbjct  121  CDADGSQGIQFNEFIVILCLIYLLMEPSTSTHPTSKMGSP  160



>gb|KJB72094.1| hypothetical protein B456_011G158400 [Gossypium raimondii]
Length=244

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +3

Query  105  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  284
            +G   PC  LK +S ++G +LC +GS NKY +LDSKLE K++E+KR+A    + +SI+++
Sbjct  1    MGKCHPCPPLKSLSSRIGGMLCNYGSSNKYKKLDSKLERKMIEMKRSASGQSNFKSIDSI  60

Query  285  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  464
            IL+FP FREGL+ +R VFEQ+DEDSNG IDREEL +CL+KLQ H  +EE+++LF SCD+D
Sbjct  61   ILRFPQFREGLRNLRGVFEQYDEDSNGTIDREELNRCLEKLQLHFTKEEVEDLFHSCDID  120

Query  465  DNEKIKFNEFIVLLCLIYLLMDAPSS  542
             +E I+FNEFIVLLCLIYLLM   SS
Sbjct  121  GSEGIQFNEFIVLLCLIYLLMKPSSS  146



>ref|XP_006493812.1| PREDICTED: probable calcium-binding protein CML22-like isoform 
X1 [Citrus sinensis]
Length=241

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  105  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  284
            +G S PC  LK +S+KV  +LC  GS NKY+RLD+KLE K++EVK+++    + +SI+++
Sbjct  1    MGTSHPCPPLKYLSNKVRGMLCHCGSQNKYARLDAKLEKKMIEVKKSSSGHSNFKSIDSV  60

Query  285  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  464
            IL+FP F++GLK I++VFEQ+DEDSNG IDREELKKCL++LQ H+ EEEI++LF+SCD+D
Sbjct  61   ILRFPQFKDGLKNIKSVFEQYDEDSNGTIDREELKKCLEELQLHLKEEEIEDLFKSCDID  120

Query  465  DNEKIKFNEFIVLLCLIYLL  524
             +E I+FNEFIVLLCLIYLL
Sbjct  121  GSEGIQFNEFIVLLCLIYLL  140



>ref|XP_008438356.1| PREDICTED: probable calcium-binding protein CML22 [Cucumis melo]
 ref|XP_008438357.1| PREDICTED: probable calcium-binding protein CML22 [Cucumis melo]
Length=227

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = +3

Query  150  KVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            KVGS+  C  S NKY+RLD+KL  K++EVKRN+    + +S+N +IL+FP F+EGL+ IR
Sbjct  3    KVGSIFFCCSSSNKYNRLDAKLGRKMVEVKRNSAGHDNFKSLNGIILRFPQFKEGLQNIR  62

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             VFEQ+DEDSNG+IDREELKKCLQKLQ H+ EEE+++LF SCD+D +  I+FNEFIVLLC
Sbjct  63   GVFEQYDEDSNGSIDREELKKCLQKLQMHMTEEEVEDLFHSCDIDGSAGIQFNEFIVLLC  122

Query  510  LIYLLMDAPSSGSTSKIGSP  569
            LIYLL D  S  + SK+GSP
Sbjct  123  LIYLLKDEHSL-TKSKLGSP  141



>gb|KHG12326.1| putative calcium-binding CML22 -like protein [Gossypium arboreum]
Length=244

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +3

Query  105  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  284
            +G   PC SLK +S ++G +LC +GS +KY +LDSKLE K++E+K +A    + +SI+++
Sbjct  1    MGKCHPCPSLKSLSSRIGGMLCNYGSSSKYKKLDSKLERKMIEMKGSASGQSNFKSIDSI  60

Query  285  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  464
            IL+FP FREGL+ +R VF+Q+DEDSNG IDREEL +CL+KLQ H  +EE+++LF SCD+D
Sbjct  61   ILRFPQFREGLRNLRGVFKQYDEDSNGTIDREELNRCLEKLQLHFTKEEVEDLFHSCDID  120

Query  465  DNEKIKFNEFIVLLCLIYLLMDAPSS  542
             +E I+FNEFIVLLCLIYLLM   SS
Sbjct  121  GSEGIQFNEFIVLLCLIYLLMKPSSS  146



>ref|XP_006420904.1| hypothetical protein CICLE_v10005743mg [Citrus clementina]
 gb|ESR34144.1| hypothetical protein CICLE_v10005743mg [Citrus clementina]
Length=241

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  105  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  284
            +G S PC  LK +S+KV  +LC  GS NKY+RLD+KLE K++EVK+++    + +SI+++
Sbjct  1    MGTSHPCPPLKYLSNKVRGMLCHCGSQNKYARLDAKLEKKMIEVKKSSSGHSNFKSIDSV  60

Query  285  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  464
            I++FP F++GLK I++VFEQ+D+DSNG IDREELKKCL++LQ H+ EEEI++LF+SCD+D
Sbjct  61   IVRFPQFKDGLKNIKSVFEQYDKDSNGTIDREELKKCLEELQLHLKEEEIEDLFKSCDID  120

Query  465  DNEKIKFNEFIVLLCLIYLL  524
             +E I+FNEFIVLLCLIYLL
Sbjct  121  GSEGIQFNEFIVLLCLIYLL  140



>ref|XP_004133997.1| PREDICTED: probable calcium-binding protein CML22-like [Cucumis 
sativus]
 ref|XP_004157676.1| PREDICTED: probable calcium-binding protein CML22-like [Cucumis 
sativus]
 gb|KGN56734.1| hypothetical protein Csa_3G130890 [Cucumis sativus]
Length=227

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = +3

Query  150  KVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            KVGS+  C  S NKY+RLD+KL  K++EVKRN+    + +S+N +IL+FP F+EGL+ IR
Sbjct  3    KVGSIFFCCSSSNKYNRLDAKLGRKMVEVKRNSAGHDNFKSLNGIILRFPQFKEGLQNIR  62

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             VFEQ+DEDSNG+IDREELKKCLQ+LQ H+ EEE+++LF SCD+D +  I+FNEFIVLLC
Sbjct  63   GVFEQYDEDSNGSIDREELKKCLQQLQMHMTEEEVEDLFHSCDIDGSAGIQFNEFIVLLC  122

Query  510  LIYLLMDAPSSGSTSKIGSP  569
            LIYLL D  S  + SK+GSP
Sbjct  123  LIYLLKDEHSL-TKSKLGSP  141



>ref|XP_010023705.1| PREDICTED: probable calcium-binding protein CML22 [Eucalyptus 
grandis]
Length=260

 Score =   181 bits (460),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = +3

Query  93   MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLS-IR  269
            MK  +G S PC S K +S+KVG++LC   S  +Y RLD+KLE KVLEVK  + +  +  +
Sbjct  1    MKDQIGTSCPCPSFKSLSNKVGNILCHRPSQIRYKRLDTKLEKKVLEVKNTSSSRHNEFQ  60

Query  270  SINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFR  449
             I+++I+KFP F+EGLK I  V+ Q+DE+SNG ID+EELKKCL ++Q H+ E+++++LF 
Sbjct  61   RIDSIIMKFPQFKEGLKNIEAVYHQYDENSNGKIDKEELKKCLDEVQLHLSEKDMEDLFH  120

Query  450  SCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVV  575
            SCD+D+N++I+F EFIVLLCLIYLL ++ S+  T K+GSP +
Sbjct  121  SCDIDENQEIRFTEFIVLLCLIYLLKESSSTNETEKVGSPSI  162



>gb|KDO61178.1| hypothetical protein CISIN_1g0262681mg, partial [Citrus sinensis]
Length=239

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +3

Query  114  SRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILK  293
            S PC  LK +S+KV  +LC  GS NKY+RLD+KLE K++EVK+++    + +SI+++I++
Sbjct  2    SHPCPPLKYLSNKVRGMLCHCGSQNKYARLDAKLEKKMIEVKKSSSGHSNFKSIDSVIVR  61

Query  294  FPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNE  473
            FP F++GLK I++VFEQ+DEDSNG IDREELKKCL++LQ H+ EEEI++LF+SCD+D +E
Sbjct  62   FPQFKDGLKNIKSVFEQYDEDSNGTIDREELKKCLEELQLHLKEEEIEDLFKSCDIDGSE  121

Query  474  KIKFNEFIVLLCLIYLL  524
             I+FNEFIVLLCLIYLL
Sbjct  122  GIQFNEFIVLLCLIYLL  138



>ref|XP_010650355.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Vitis vinifera]
Length=242

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 117/160 (73%), Gaps = 7/160 (4%)
 Frame = +3

Query  93   MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  272
            MK SVG   P  +LK  S KVG +L   GS NKY +LD+KLE K++EVKRN     + RS
Sbjct  1    MKQSVGTFYPRTALKSFSSKVGVMLFRCGSSNKYKKLDAKLERKMMEVKRNTSGRNNFRS  60

Query  273  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  452
             +++I++FP F+EGLK IR      DEDSNG ID EELKKCLQKLQ H+ E+EID+LF S
Sbjct  61   FDSIIMRFPQFKEGLKNIR------DEDSNGIIDHEELKKCLQKLQLHLTEQEIDDLFCS  114

Query  453  CDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSKIGSP  569
            CD D ++ I+FNEFIV+LCLIYLLM+ + S+  TSK+GSP
Sbjct  115  CDADGSQGIQFNEFIVILCLIYLLMEPSTSTHPTSKMGSP  154



>gb|KCW60054.1| hypothetical protein EUGRSUZ_H02783, partial [Eucalyptus grandis]
Length=236

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +3

Query  120  PCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLS-IRSINALILKF  296
            PC S K +S+KVG++LC   S  +Y RLD+KLE KVLEVK  + +  +  + I+++I+KF
Sbjct  4    PCPSFKSLSNKVGNILCHRPSQIRYKRLDTKLEKKVLEVKNTSSSRHNEFQRIDSIIMKF  63

Query  297  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  476
            P F+EGLK I  V+ Q+DE+SNG ID+EELKKCL ++Q H+ E+++++LF SCD+D+N++
Sbjct  64   PQFKEGLKNIEAVYHQYDENSNGKIDKEELKKCLDEVQLHLSEKDMEDLFHSCDIDENQE  123

Query  477  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVV  575
            I+F EFIVLLCLIYLL ++ S+  T K+GSP +
Sbjct  124  IRFTEFIVLLCLIYLLKESSSTNETEKVGSPSI  156



>ref|XP_010650356.1| PREDICTED: probable calcium-binding protein CML22 isoform X3 
[Vitis vinifera]
Length=225

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 106/132 (80%), Gaps = 1/132 (1%)
 Frame = +3

Query  177  GSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDED  356
            GS NKY +LD+KLE K++EVKRN     + RS +++I++FP F+EGLK IR VF Q+DED
Sbjct  6    GSSNKYKKLDAKLERKMMEVKRNTSGRNNFRSFDSIIMRFPQFKEGLKNIRGVFAQYDED  65

Query  357  SNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-A  533
            SNG ID EELKKCLQKLQ H+ E+EID+LF SCD D ++ I+FNEFIV+LCLIYLLM+ +
Sbjct  66   SNGIIDHEELKKCLQKLQLHLTEQEIDDLFCSCDADGSQGIQFNEFIVILCLIYLLMEPS  125

Query  534  PSSGSTSKIGSP  569
             S+  TSK+GSP
Sbjct  126  TSTHPTSKMGSP  137



>ref|XP_002518103.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44236.1| conserved hypothetical protein [Ricinus communis]
Length=240

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +3

Query  114  SRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILK  293
            + P   LK  S K+  + C  GS NKY RLD+KLE K++E KR++    + +SI+++IL+
Sbjct  12   TSPFGLLKSYSSKIAGMFCHCGSQNKYKRLDAKLEKKMIEFKRSSSGPTNFKSIDSIILR  71

Query  294  FPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNE  473
            FP F+EGLK IR VFEQ+DED+NGAIDREELK+CLQKLQ ++ E+E+++LF SCD+D ++
Sbjct  72   FPRFKEGLKNIRGVFEQYDEDANGAIDREELKRCLQKLQINLKEQEVEDLFHSCDIDGSQ  131

Query  474  KIKFNEFIVLLCLIYLL  524
             I+FNEFIVLLCLIYLL
Sbjct  132  GIQFNEFIVLLCLIYLL  148



>gb|KJB72093.1| hypothetical protein B456_011G158400 [Gossypium raimondii]
Length=238

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 110/146 (75%), Gaps = 6/146 (4%)
 Frame = +3

Query  105  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  284
            +G   PC  LK +S ++G +LC +GS NKY +LDSKLE K++E+KR+A    + +SI+++
Sbjct  1    MGKCHPCPPLKSLSSRIGGMLCNYGSSNKYKKLDSKLERKMIEMKRSASGQSNFKSIDSI  60

Query  285  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  464
            IL+FP FREGL+ +R      DEDSNG IDREEL +CL+KLQ H  +EE+++LF SCD+D
Sbjct  61   ILRFPQFREGLRNLR------DEDSNGTIDREELNRCLEKLQLHFTKEEVEDLFHSCDID  114

Query  465  DNEKIKFNEFIVLLCLIYLLMDAPSS  542
             +E I+FNEFIVLLCLIYLLM   SS
Sbjct  115  GSEGIQFNEFIVLLCLIYLLMKPSSS  140



>gb|KDP39372.1| hypothetical protein JCGZ_01129 [Jatropha curcas]
Length=225

 Score =   168 bits (425),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 110/136 (81%), Gaps = 1/136 (1%)
 Frame = +3

Query  162  LLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  341
            + C  GS NKY RLD+KLE K++EVKR++    + +SI+++IL+FP F++GLK IR VFE
Sbjct  1    MFCHCGSQNKYKRLDAKLEKKMIEVKRSSTGHTNFKSIDSIILRFPQFKDGLKNIRGVFE  60

Query  342  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  521
             +DED+NG IDR ELK+CLQKLQ ++ E+EI++LF SCD+D ++ I+FNEFIVLLCLIYL
Sbjct  61   LYDEDANGIIDRGELKRCLQKLQLNLKEQEIEDLFHSCDIDGSQGIQFNEFIVLLCLIYL  120

Query  522  LMDAPSS-GSTSKIGS  566
            L++  SS  STSK+GS
Sbjct  121  LVEPSSSPHSTSKVGS  136



>ref|XP_006493813.1| PREDICTED: probable calcium-binding protein CML22-like isoform 
X2 [Citrus sinensis]
Length=222

 Score =   167 bits (424),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +3

Query  162  LLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  341
            +LC  GS NKY+RLD+KLE K++EVK+++    + +SI+++IL+FP F++GLK I++VFE
Sbjct  1    MLCHCGSQNKYARLDAKLEKKMIEVKKSSSGHSNFKSIDSVILRFPQFKDGLKNIKSVFE  60

Query  342  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  521
            Q+DEDSNG IDREELKKCL++LQ H+ EEEI++LF+SCD+D +E I+FNEFIVLLCLIYL
Sbjct  61   QYDEDSNGTIDREELKKCLEELQLHLKEEEIEDLFKSCDIDGSEGIQFNEFIVLLCLIYL  120

Query  522  L  524
            L
Sbjct  121  L  121



>ref|XP_010241365.1| PREDICTED: probable calcium-binding protein CML22 [Nelumbo nucifera]
Length=247

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 122/163 (75%), Gaps = 4/163 (2%)
 Frame = +3

Query  93   MKGSVGLSRPCLSLK-LVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLS  263
            MK S G    C +LK   ++KVG LL    S NKY +LD+KLE K++EV   + +    +
Sbjct  1    MKESPGKFHLCPTLKSFFTEKVGGLLSHCNSSNKYKKLDAKLEGKMIEVIKHKGSSEKKT  60

Query  264  IRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDEL  443
             +S+N++I++FP F+E ++ I+ VFEQ+DEDSNG+IDR+EL+KCL KLQ  + E+E+++L
Sbjct  61   FKSMNSIIMRFPQFKEEMRLIKDVFEQYDEDSNGSIDRDELRKCLGKLQVQLTEKEMEDL  120

Query  444  FRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGST-SKIGSP  569
            F+SCD+D NE I+FNEFIVLLCL+YLLM+  SS +T S++GSP
Sbjct  121  FQSCDIDKNEGIQFNEFIVLLCLVYLLMEPSSSSNTKSQMGSP  163



>ref|XP_010107777.1| putative calcium-binding protein CML22 [Morus notabilis]
 gb|EXC16942.1| putative calcium-binding protein CML22 [Morus notabilis]
Length=233

 Score =   160 bits (404),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = +3

Query  93   MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  272
            MK S G S  C SLK +S+KVG + C  GSPNKY RLD+KLE K++EVKR +    + +S
Sbjct  1    MKTSSGTSHLCPSLKSLSNKVGGMFCHCGSPNKYKRLDTKLEKKLVEVKRGSQGVGNFKS  60

Query  273  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  452
            IN++I+KFP FRE LK IR+VFEQ+DEDSNGAIDR ELK  LQ+LQ  + EEE+D+LF S
Sbjct  61   INSIIMKFPQFREELKRIRSVFEQYDEDSNGAIDRVELKNSLQQLQLQLSEEEVDDLFHS  120

Query  453  CDVDDNEKIKFNEFIV  500
            CD+D +E I+FNEFI+
Sbjct  121  CDIDGSEGIQFNEFIM  136



>ref|XP_010691273.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=250

 Score =   158 bits (399),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 113/164 (69%), Gaps = 9/164 (5%)
 Frame = +3

Query  105  VGLSRPCLSLKLVSDKVGSLL----CCHGSPNKYSRLDSKLETKVLEVKRNAPAT----L  260
             G SR C +LK +  KVGS+L    C   + NKY RLD+KLE K++E+KR A  +     
Sbjct  10   TGRSRSCPALKSICYKVGSMLWGCNCASSTTNKYRRLDAKLERKMIELKRQASTSGHTNK  69

Query  261  SIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDE  440
              RSIN++I+KFP  +E +K++R VFE +DED +G+IDREELK+C ++LQ ++  EE D+
Sbjct  70   KFRSINSVIMKFPQLKEQVKKLRGVFEHYDEDGDGSIDREELKQCFKELQVNLTVEEFDD  129

Query  441  LFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSP  569
            LF SCDVD N +I+F EFIVLLCLIYL+    S + + S+  SP
Sbjct  130  LFESCDVDRNGRIQFREFIVLLCLIYLITKPSSPTDAVSRTESP  173



>gb|EYU32662.1| hypothetical protein MIMGU_mgv1a012635mg [Erythranthe guttata]
Length=244

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 107/144 (74%), Gaps = 6/144 (4%)
 Frame = +3

Query  93   MKGSVGLSRPCLSLKLVSDKVGSLLCCHGS-PNKYSRLDSKLETKVLEVKRNAPAT-LSI  266
            MK S G S     LK + DK   ++CCH   PN Y RLD+KLE K++E+K++  A  ++ 
Sbjct  1    MKDSQGTS----VLKSLYDKAQDIICCHVLLPNTYKRLDTKLERKMMEIKKSTSAHHINF  56

Query  267  RSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELF  446
            +SI+++I+KFP FR+GLKEIR VFE++DEDSNG ID +ELKKCL  L+F V ++EID+LF
Sbjct  57   KSIDSIIMKFPQFRDGLKEIRQVFEKYDEDSNGTIDNDELKKCLHALEFSVKDDEIDDLF  116

Query  447  RSCDVDDNEKIKFNEFIVLLCLIY  518
              CD+D+NE I+F EFIVLLCL Y
Sbjct  117  LYCDMDENEGIQFKEFIVLLCLNY  140



>ref|XP_010691274.1| PREDICTED: probable calcium-binding protein CML22 isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=247

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 113/164 (69%), Gaps = 9/164 (5%)
 Frame = +3

Query  105  VGLSRPCLSLKLVSDKVGSLL----CCHGSPNKYSRLDSKLETKVLEVKRNAPAT----L  260
             G SR C +LK +  KVGS+L    C   + NKY RLD+KLE K++E+KR A  +     
Sbjct  10   TGRSRSCPALKSICYKVGSMLWGCNCASSTTNKYRRLDAKLERKMIELKRQASTSGHTNK  69

Query  261  SIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDE  440
              RSIN++I+KFP  +E +K++R VFE +DED +G+IDREELK+C ++LQ ++  EE D+
Sbjct  70   KFRSINSVIMKFPQLKEQVKKLRGVFEHYDEDGDGSIDREELKQCFKELQVNLTVEEFDD  129

Query  441  LFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSP  569
            LF SCDVD N +I+F EFIVLLCLIYL+    S + + S+  SP
Sbjct  130  LFESCDVDRNGRIQFREFIVLLCLIYLITKPSSPTDAVSRTESP  173



>ref|XP_010691270.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010691272.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=264

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 113/164 (69%), Gaps = 9/164 (5%)
 Frame = +3

Query  105  VGLSRPCLSLKLVSDKVGSLL----CCHGSPNKYSRLDSKLETKVLEVKRNAPAT----L  260
             G SR C +LK +  KVGS+L    C   + NKY RLD+KLE K++E+KR A  +     
Sbjct  10   TGRSRSCPALKSICYKVGSMLWGCNCASSTTNKYRRLDAKLERKMIELKRQASTSGHTNK  69

Query  261  SIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDE  440
              RSIN++I+KFP  +E +K++R VFE +DED +G+IDREELK+C ++LQ ++  EE D+
Sbjct  70   KFRSINSVIMKFPQLKEQVKKLRGVFEHYDEDGDGSIDREELKQCFKELQVNLTVEEFDD  129

Query  441  LFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSP  569
            LF SCDVD N +I+F EFIVLLCLIYL+    S + + S+  SP
Sbjct  130  LFESCDVDRNGRIQFREFIVLLCLIYLITKPSSPTDAVSRTESP  173



>ref|XP_010532790.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Tarenaya hassleriana]
Length=228

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 104/136 (76%), Gaps = 2/136 (1%)
 Frame = +3

Query  162  LLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  341
            + CC  S NKY+ LD+KLE +++E +RN PA  S RS++++I+KFP  REGL+ IR VFE
Sbjct  1    MFCCCVSKNKYAELDAKLERRMVECRRNFPAHRSFRSLDSVIMKFPRLREGLRNIRGVFE  60

Query  342  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  521
             +D+D NG ID EELK CL++L  ++ EEE+++L+  CDVD ++ I+FNEFIVLLCLIYL
Sbjct  61   SYDKDGNGTIDLEELKNCLEELNLNMSEEEVEDLYGWCDVDGSKGIQFNEFIVLLCLIYL  120

Query  522  LMD--APSSGSTSKIG  563
            L +  +PS+ ++ +IG
Sbjct  121  LAEPSSPSNTTSPEIG  136



>ref|XP_010532789.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Tarenaya hassleriana]
Length=267

 Score =   153 bits (386),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 104/136 (76%), Gaps = 2/136 (1%)
 Frame = +3

Query  162  LLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  341
            + CC  S NKY+ LD+KLE +++E +RN PA  S RS++++I+KFP  REGL+ IR VFE
Sbjct  40   MFCCCVSKNKYAELDAKLERRMVECRRNFPAHRSFRSLDSVIMKFPRLREGLRNIRGVFE  99

Query  342  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  521
             +D+D NG ID EELK CL++L  ++ EEE+++L+  CDVD ++ I+FNEFIVLLCLIYL
Sbjct  100  SYDKDGNGTIDLEELKNCLEELNLNMSEEEVEDLYGWCDVDGSKGIQFNEFIVLLCLIYL  159

Query  522  LMD--APSSGSTSKIG  563
            L +  +PS+ ++ +IG
Sbjct  160  LAEPSSPSNTTSPEIG  175



>ref|XP_010326837.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Solanum lycopersicum]
Length=213

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +3

Query  222  KVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQ  401
            K++E+KR++      RSIN +ILKFPHF+EGLKEI+ VFEQFDEDSNG IDR+ELKKC++
Sbjct  2    KMVELKRSSSGESKFRSINGIILKFPHFKEGLKEIKDVFEQFDEDSNGTIDRDELKKCVK  61

Query  402  KLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSKIGSP  569
            KL FH  +EE+++LF SCDVD+NE I+FNEFIVLLCL+YLL+D + SSG+T+KIGSP
Sbjct  62   KLHFHAKDEEVNDLFDSCDVDENEGIQFNEFIVLLCLLYLLIDSSSSSGNTTKIGSP  118



>gb|KFK39709.1| hypothetical protein AALP_AA3G278300 [Arabis alpina]
Length=228

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 99/137 (72%), Gaps = 3/137 (2%)
 Frame = +3

Query  168  CCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  341
            CC  S N  KY+ LDSKLE K++E +RN P   S++S++++I+KFP  REGL+ IR VFE
Sbjct  4    CCVSSENNKKYAELDSKLERKMVESRRNYPGHRSLKSMDSIIMKFPTLREGLRNIRNVFE  63

Query  342  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  521
             +D+D NG ID EELKKCL++L+  + EEE+  L+  CDVD ++ I+FNEF+VLLCLIYL
Sbjct  64   SYDKDRNGTIDMEELKKCLEELKLSLSEEEVKGLYGWCDVDGSKGIQFNEFVVLLCLIYL  123

Query  522  LMD-APSSGSTSKIGSP  569
            L   +P S + S+   P
Sbjct  124  LAKPSPKSSAESREMGP  140



>ref|XP_010691275.1| PREDICTED: probable calcium-binding protein CML22 isoform X4 
[Beta vulgaris subsp. vulgaris]
Length=236

 Score =   144 bits (362),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 99/139 (71%), Gaps = 5/139 (4%)
 Frame = +3

Query  168  CCHGSPNKYSRLDSKLETKVLEVKRNAPAT----LSIRSINALILKFPHFREGLKEIRTV  335
            C   + NKY RLD+KLE K++E+KR A  +       RSIN++I+KFP  +E +K++R V
Sbjct  7    CASSTTNKYRRLDAKLERKMIELKRQASTSGHTNKKFRSINSVIMKFPQLKEQVKKLRGV  66

Query  336  FEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLI  515
            FE +DED +G+IDREELK+C ++LQ ++  EE D+LF SCDVD N +I+F EFIVLLCLI
Sbjct  67   FEHYDEDGDGSIDREELKQCFKELQVNLTVEEFDDLFESCDVDRNGRIQFREFIVLLCLI  126

Query  516  YLLMDAPS-SGSTSKIGSP  569
            YL+    S + + S+  SP
Sbjct  127  YLITKPSSPTDAVSRTESP  145



>ref|XP_006418801.1| hypothetical protein EUTSA_v10002654mg [Eutrema salsugineum]
 gb|ESQ37237.1| hypothetical protein EUTSA_v10002654mg [Eutrema salsugineum]
Length=226

 Score =   142 bits (357),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 2/123 (2%)
 Frame = +3

Query  162  LLCCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTV  335
            L CC  S N  KY+ LDSKLE K++E +RN P    ++S++++I+KFP  REGL+ IR+V
Sbjct  2    LCCCVKSENNKKYAELDSKLERKMVESRRNYPGHRRLKSMDSIIMKFPKLREGLRNIRSV  61

Query  336  FEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLI  515
            FE +D+D NG ID EELKKCL++L+  + EEE+  L+  CDVD ++ I+FNEFIVLLCLI
Sbjct  62   FESYDKDGNGTIDMEELKKCLEELKLSLSEEEVKGLYGWCDVDGSKGIEFNEFIVLLCLI  121

Query  516  YLL  524
            YLL
Sbjct  122  YLL  124



>ref|XP_010909319.1| PREDICTED: probable calcium-binding protein CML22 [Elaeis guineensis]
Length=249

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 111/165 (67%), Gaps = 4/165 (2%)
 Frame = +3

Query  93   MKGSVGLSRPCLSL-KLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLS  263
            MK + G   PC +L      K+G  L     PNKY R + KLE KV E   +R A    S
Sbjct  1    MKATSGSFHPCPALTSFFFHKLGGALIKCEFPNKYRRQNQKLEKKVTEAIKQRAASRKRS  60

Query  264  IRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDEL  443
             RS+N++I++FPHF++GL  I+ VFEQ+DEDSNG ID EELKKCL  LQ H+ EEEI+ L
Sbjct  61   FRSMNSIIMRFPHFKDGLGNIKDVFEQYDEDSNGTIDLEELKKCLSTLQVHLTEEEINGL  120

Query  444  FRSCDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVV  575
            +  CDVD NE I+ NEFI+LLCLIYLLM+ A ++   S+IGSP V
Sbjct  121  YHYCDVDGNEGIQVNEFIILLCLIYLLMEPASATDRMSRIGSPQV  165



>ref|XP_010421964.1| PREDICTED: probable calcium-binding protein CML22, partial [Camelina 
sativa]
Length=175

 Score =   139 bits (351),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 96/132 (73%), Gaps = 3/132 (2%)
 Frame = +3

Query  168  CCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  341
            CC  S N  KY+ LD+KL  K++E +R  P   S++S++++I+KFP  REGL+ IR VFE
Sbjct  4    CCVKSENNKKYAELDAKLARKMVESRRIYPGHKSLKSMDSIIMKFPKLREGLRNIRNVFE  63

Query  342  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  521
             +D DSNG ID EELKKCL++LQ  + +EE+  L+  CDVD ++ I+FNEFIVLLCLIYL
Sbjct  64   SYDNDSNGTIDIEELKKCLEELQLSLSDEEVKGLYGWCDVDGSKGIQFNEFIVLLCLIYL  123

Query  522  LMDAPSSGSTSK  557
            L   PSS S ++
Sbjct  124  L-SKPSSESNAE  134



>emb|CDO99460.1| unnamed protein product [Coffea canephora]
Length=204

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 90/116 (78%), Gaps = 1/116 (1%)
 Frame = +3

Query  225  VLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQK  404
            ++E+K++A    + RSIN++I+KFP F+EGLKEIR +F+Q+DED+N  I+REELKKC Q+
Sbjct  1    MIEIKKSASGQSNFRSINSIIMKFPQFKEGLKEIRDIFQQYDEDNNATIEREELKKCSQE  60

Query  405  LQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSKIGSP  569
            LQ  + EEEID+LF  CD+++NE I+ NEFIVLLCLIY L D +  S + S I SP
Sbjct  61   LQLTIREEEIDDLFYYCDINENEGIQLNEFIVLLCLIYFLTDYSIPSHTASDILSP  116



>ref|XP_010513185.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
Length=229

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 96/132 (73%), Gaps = 3/132 (2%)
 Frame = +3

Query  168  CCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  341
            CC  S N  KY+ LD+KL  K++E +R  P   S++S++++I+KFP  REGL+ IR VFE
Sbjct  4    CCVKSENNKKYAELDAKLARKMVESRRIYPGHKSLKSMDSIIMKFPKLREGLRNIRNVFE  63

Query  342  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  521
             +D DSNG ID EELKKCL++LQ  + +EE+  L+  CDVD ++ I+FNEFIVLLCLIYL
Sbjct  64   SYDNDSNGTIDIEELKKCLEELQLSLSDEEVKGLYGWCDVDGSKGIQFNEFIVLLCLIYL  123

Query  522  LMDAPSSGSTSK  557
            L   PSS S ++
Sbjct  124  L-SKPSSESNAE  134



>ref|XP_009106153.1| PREDICTED: probable calcium-binding protein CML22 [Brassica rapa]
Length=233

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 93/126 (74%), Gaps = 4/126 (3%)
 Frame = +3

Query  159  SLLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            S+LCC    GS  KY+ LD+KL  K++E +R  P   S++SI+++I+KFP  REGL++IR
Sbjct  3    SMLCCCVSSGSNKKYAELDAKLARKMVESRRYYPGHRSLKSIDSVIMKFPKLREGLRKIR  62

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNEFIVLL  506
            TVFE +D D NG ID EELKKCL +L+   + EEE+  L+  CDVD ++ I+FNEFIVLL
Sbjct  63   TVFESYDSDGNGTIDMEELKKCLVELELMSLSEEEVKGLYGWCDVDGSKGIQFNEFIVLL  122

Query  507  CLIYLL  524
            CLIYLL
Sbjct  123  CLIYLL  128



>ref|XP_002883485.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59744.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=217

 Score =   139 bits (349),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = +3

Query  162  LLCCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTV  335
            L CC  S N  KY+ LD+KL  K++E +R  P   S++S++++I+KFP  REGL+ IR+V
Sbjct  2    LCCCVNSENNRKYAELDAKLARKMVESRRIYPGHRSLKSMDSIIMKFPKLREGLRNIRSV  61

Query  336  FEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLI  515
            FE +D D NG ID EELKKCL++L+  + EEE+  L+  CDVD ++ I+FNEFIVLLCLI
Sbjct  62   FETYDSDKNGTIDIEELKKCLEELKLCLSEEEVKGLYGWCDVDGSKGIQFNEFIVLLCLI  121

Query  516  YLLMDAPSSGSTSK  557
            YLL   PSS S ++
Sbjct  122  YLL-SKPSSESNTE  134



>ref|XP_004509621.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X2 [Cicer arietinum]
Length=229

 Score =   139 bits (349),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 98/141 (70%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G  L    SP K    ++KLE K++E ++R      S++S N +ILKFP   E  ++ R
Sbjct  1    MGGALGKDESPKKSWTPETKLEAKMVEAMQRRECHGCSVKSFNTIILKFPKIDESFRKCR  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNGAID+EELKKC  KL+    EEEI++LF +CD++D+  +KFNEFIVLLC
Sbjct  61   AIFEQFDEDSNGAIDQEELKKCFSKLEISFSEEEINDLFEACDINDDLGMKFNEFIVLLC  120

Query  510  LIYLLMDAPSS-GSTSKIGSP  569
            L+YLL D P++  + S+IG P
Sbjct  121  LVYLLKDDPAALHAKSRIGMP  141



>ref|XP_010466782.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
 ref|XP_010466783.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
Length=229

 Score =   139 bits (349),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = +3

Query  168  CCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  341
            CC  S N  KY+ LD+KL  K++E +R  P   S++S++++I+KFP  REGL+ IR VFE
Sbjct  4    CCLNSENNKKYAELDAKLARKMVESRRIYPGHKSLKSMDSIIMKFPKLREGLRNIRNVFE  63

Query  342  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  521
             +D D NG ID EELKKCL++LQ  + +EE+  L+  CDVD ++ I+FNEFIVLLCLIYL
Sbjct  64   SYDNDKNGTIDIEELKKCLEELQLSLSDEEVKGLYGWCDVDGSKGIQFNEFIVLLCLIYL  123

Query  522  LMDAPSSGSTSK  557
            L   PSS S ++
Sbjct  124  L-SKPSSESNAE  134



>gb|KJB11853.1| hypothetical protein B456_002G104000 [Gossypium raimondii]
Length=215

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 89/124 (72%), Gaps = 2/124 (2%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E ++R A    +++S N++ILKFP   E L+  + VFEQFDEDSNGAID E
Sbjct  3    ETKLEAKMVEAMQRRASVGTAMKSFNSVILKFPKIDESLRNCKAVFEQFDEDSNGAIDNE  62

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSK  557
            ELKKC  KLQ    EEEI +LF++CD + N  IKFNEFIVLLCL+YLL D AP     S+
Sbjct  63   ELKKCFNKLQISFTEEEISDLFKACDFNQNMGIKFNEFIVLLCLVYLLKDNAPGHEGKSR  122

Query  558  IGSP  569
            +G P
Sbjct  123  MGMP  126



>ref|XP_004509620.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X1 [Cicer arietinum]
Length=233

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 98/141 (70%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G  L    SP K    ++KLE K++E ++R      S++S N +ILKFP   E  ++ R
Sbjct  1    MGGALGKDESPKKSWTPETKLEAKMVEAMQRRECHGCSVKSFNTIILKFPKIDESFRKCR  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNGAID+EELKKC  KL+    EEEI++LF +CD++D+  +KFNEFIVLLC
Sbjct  61   AIFEQFDEDSNGAIDQEELKKCFSKLEISFSEEEINDLFEACDINDDLGMKFNEFIVLLC  120

Query  510  LIYLLMDAPSS-GSTSKIGSP  569
            L+YLL D P++  + S+IG P
Sbjct  121  LVYLLKDDPAALHAKSRIGMP  141



>gb|KHG01864.1| putative calcium-binding CML21 -like protein [Gossypium arboreum]
Length=215

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 89/124 (72%), Gaps = 2/124 (2%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E ++R A    +++S N++ILKFP   E L+  + VFEQFDEDSNGAID E
Sbjct  3    ETKLEAKMVEAMQRRASEGTAMKSFNSIILKFPKIDESLRNCKAVFEQFDEDSNGAIDNE  62

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSK  557
            ELKKC  KLQ    EEEI +LF++CD + N  IKFNEFIVLLCL+YLL D AP     S+
Sbjct  63   ELKKCFNKLQISFTEEEISDLFKACDFNQNMGIKFNEFIVLLCLVYLLKDNAPGHEGKSR  122

Query  558  IGSP  569
            +G P
Sbjct  123  MGMP  126



>ref|XP_003563635.1| PREDICTED: probable calcium-binding protein CML21 [Brachypodium 
distachyon]
 ref|XP_010227514.1| PREDICTED: probable calcium-binding protein CML21 [Brachypodium 
distachyon]
Length=224

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 101/138 (73%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G +   H S +K S   SKLETK++E +++ A    S++S N++I+KFP   EGL++ +
Sbjct  1    MGGVFGRHDS-SKRSSHGSKLETKMVESMRQRAAHGTSVKSFNSIIMKFPKIDEGLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            T+FEQFDEDSNG ID++ELK C QKL+    EE+I +LF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKDELKHCFQKLEISFTEEDITDLFEACDINEHMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            ++YLL D P+S + +K+G
Sbjct  120  IVYLLNDPPASEAKAKMG  137



>emb|CDY18071.1| BnaA01g23320D [Brassica napus]
Length=229

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 92/125 (74%), Gaps = 4/125 (3%)
 Frame = +3

Query  162  LLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  332
            +LCC    GS  KY+ LD+KL  K++E +R  P   S++SI+++I+KFP  REGL++IRT
Sbjct  1    MLCCCVSSGSNKKYAELDAKLARKMVESRRYYPGHRSLKSIDSVIMKFPKLREGLRKIRT  60

Query  333  VFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            VFE +D D NG ID EELKKCL +L+   + EEE+  L+  CDVD ++ I+FNEFIVLLC
Sbjct  61   VFESYDSDGNGTIDMEELKKCLVELELMSLSEEEVKGLYGWCDVDGSKGIQFNEFIVLLC  120

Query  510  LIYLL  524
            LIYLL
Sbjct  121  LIYLL  125



>emb|CDY46335.1| BnaC01g30350D [Brassica napus]
 emb|CDY18072.1| BnaA01g23330D [Brassica napus]
Length=230

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 92/125 (74%), Gaps = 4/125 (3%)
 Frame = +3

Query  162  LLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  332
            +LCC    GS  KY+ LD+KL  K++E +R  P   S++SI+++I+KFP  REGL++IRT
Sbjct  1    MLCCCVSSGSNKKYAELDAKLARKMVESRRYYPGHRSLKSIDSVIMKFPKLREGLRKIRT  60

Query  333  VFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            VFE +D D NG ID EELKKCL +L+   + EEE+  L+  CDVD ++ I+FNEFIVLLC
Sbjct  61   VFESYDSDGNGTIDMEELKKCLVELELMSLSEEEVKGLYGWCDVDGSKGIQFNEFIVLLC  120

Query  510  LIYLL  524
            LIYLL
Sbjct  121  LIYLL  125



>ref|XP_006584629.1| PREDICTED: uncharacterized protein LOC100820628 isoform X1 [Glycine 
max]
 ref|XP_006584630.1| PREDICTED: uncharacterized protein LOC100820628 isoform X2 [Glycine 
max]
 gb|KHN31582.1| Putative calcium-binding protein CML21 [Glycine soja]
Length=229

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 100/141 (71%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G  L    SP K S  ++KLE K++E ++R      S++S N +ILKFP   E L++ +
Sbjct  1    MGGALGKSESPRKGSMPETKLEAKMVEAMQRRESQGSSVKSFNTIILKFPKIDESLRKCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNGAID+EELKKC  KL+    EEEI++LF +CD++++  +KFNEFIVLLC
Sbjct  61   AIFEQFDEDSNGAIDQEELKKCFSKLEISFSEEEINDLFEACDINEDMGMKFNEFIVLLC  120

Query  510  LIYLLMDAPSS-GSTSKIGSP  569
            ++YLL + P++  + S+IG P
Sbjct  121  VVYLLKNDPAALHAKSRIGMP  141



>ref|XP_006370792.1| hypothetical protein POPTR_0001s47510g [Populus trichocarpa]
 gb|ERP67361.1| hypothetical protein POPTR_0001s47510g [Populus trichocarpa]
Length=224

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 99/141 (70%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G  +   GSP K    ++K+ETKV+E ++R      SI+S N++ILKFP   E  ++ +
Sbjct  1    MGGAVGKAGSPQKAWIPETKIETKVVEAMRRRETHGSSIKSFNSIILKFPKIDESFRKCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
              FEQFDEDSNG+ID+EEL+KC  KL+    +EEI++LF +CDV+++  +KFNEFIVLLC
Sbjct  61   ATFEQFDEDSNGSIDKEELRKCFHKLETAFTDEEINDLFETCDVNEDMGMKFNEFIVLLC  120

Query  510  LIYLLMDAPS-SGSTSKIGSP  569
            L+YLL D P+   + S+IG P
Sbjct  121  LVYLLKDDPAIPQAKSRIGMP  141



>ref|XP_009409857.1| PREDICTED: probable calcium-binding protein CML21 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409859.1| PREDICTED: probable calcium-binding protein CML21 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409860.1| PREDICTED: probable calcium-binding protein CML21 [Musa acuminata 
subsp. malaccensis]
Length=223

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +3

Query  189  KYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNG  365
            + S  +SKLE K++E ++R A    S++S N++I+KFP   E L++ +++FEQFDEDSNG
Sbjct  12   RRSSPESKLEAKMVEAMQRRASEGTSVKSFNSIIMKFPKIDESLRKCKSIFEQFDEDSNG  71

Query  366  AIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG  545
            AID+EELK C QKL+    E+EI +LF +CD+D+N  +KFNEFIVLLCL+YLL +  +  
Sbjct  72   AIDQEELKHCFQKLEISFNEQEIGDLFLACDIDENMGMKFNEFIVLLCLVYLLKEPAAVQ  131

Query  546  STSKIGSP  569
            + S++G P
Sbjct  132  ANSRMGLP  139



>ref|XP_002300587.1| calcium-binding EF hand family protein [Populus trichocarpa]
 gb|EEE85392.1| calcium-binding EF hand family protein [Populus trichocarpa]
Length=248

 Score =   137 bits (344),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 99/141 (70%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G  +   GSP K    ++K+ETKV+E ++R      SI+S N++ILKFP   E  ++ +
Sbjct  1    MGGAVGKAGSPQKAWIPETKIETKVVEAMRRRETHGSSIKSFNSIILKFPKIDESFRKCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
              FEQFDEDSNG+ID+EEL+KC  KL+    +EEI++LF +CDV+++  +KFNEFIVLLC
Sbjct  61   ATFEQFDEDSNGSIDKEELRKCFHKLETAFTDEEINDLFETCDVNEDMGMKFNEFIVLLC  120

Query  510  LIYLLMDAPS-SGSTSKIGSP  569
            L+YLL D P+   + S+IG P
Sbjct  121  LVYLLKDDPAIPQAKSRIGMP  141



>ref|XP_011039863.1| PREDICTED: probable calcium-binding protein CML21 [Populus euphratica]
 ref|XP_011039864.1| PREDICTED: probable calcium-binding protein CML21 [Populus euphratica]
 ref|XP_011039865.1| PREDICTED: probable calcium-binding protein CML21 [Populus euphratica]
Length=229

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 99/141 (70%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G  +   GSP K    ++K+E KV+E ++R      SI+S N++ILKFP   E  ++ +
Sbjct  1    MGGAVGKAGSPKKAWIPETKIEAKVVEAMRRREIHGSSIKSFNSIILKFPKIDESFRKCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
              FEQFDEDSNG+ID+EEL+KC  KL+    +EEI++LF +CDV+++  +KFNEFIVLLC
Sbjct  61   ATFEQFDEDSNGSIDKEELRKCFHKLETAFTDEEINDLFETCDVNEDMGVKFNEFIVLLC  120

Query  510  LIYLLMDAPSS-GSTSKIGSP  569
            L+YLL D P++  + S+IG P
Sbjct  121  LVYLLKDDPATPQAKSRIGMP  141



>emb|CDX85172.1| BnaC07g07340D [Brassica napus]
Length=526

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 99/139 (71%), Gaps = 5/139 (4%)
 Frame = +3

Query  144  SDKVGSLLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREG  314
            S  +GS+LCC     S  KY+ LD+KLE K++E +R  P   S++S++++I+ FP  REG
Sbjct  291  SSTIGSMLCCCVNSESNKKYAELDAKLERKMVERRRYYPGHRSLKSMDSIIMMFPKLREG  350

Query  315  LKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNE  491
            L+ IR VFE +D+D NG ID EELKKCL++L+   + EEE+  L+  CDVD ++ I+FNE
Sbjct  351  LRNIRNVFESYDQDRNGTIDMEELKKCLEELKLMSLSEEEVKGLYGWCDVDGSKGIQFNE  410

Query  492  FIVLLCLIYLLMDAPSSGS  548
            FIVLLCLIYLL   PS+ S
Sbjct  411  FIVLLCLIYLLA-KPSAES  428



>ref|XP_003628952.1| hypothetical protein MTR_8g070510 [Medicago truncatula]
 gb|AET03428.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK43589.1| unknown [Medicago truncatula]
Length=227

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 97/141 (69%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G  +    SP K+   ++KLE K++E ++R      S++S N +ILKFP   E  ++ R
Sbjct  1    MGGAMGKGDSPKKFWVAETKLEAKMVEAMQRRECQGCSMKSFNTIILKFPKIDESFRKCR  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNG ID+EELKKC  KL+    EEE ++LF +CD++D+  +KF+EFIVLLC
Sbjct  61   AIFEQFDEDSNGTIDQEELKKCFSKLEISFSEEETNDLFEACDINDDLGMKFSEFIVLLC  120

Query  510  LIYLLMDAPSS-GSTSKIGSP  569
            L+YLL D P++  + S+IG P
Sbjct  121  LVYLLKDDPAALHAKSRIGMP  141



>ref|NP_189053.1| putative calcium-binding protein CML22 [Arabidopsis thaliana]
 sp|Q9LRN6.1|CML22_ARATH RecName: Full=Probable calcium-binding protein CML22; AltName: 
Full=Calmodulin-like protein 22 [Arabidopsis thaliana]
 dbj|BAB01352.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76858.1| putative calcium-binding protein CML22 [Arabidopsis thaliana]
Length=229

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 91/123 (74%), Gaps = 2/123 (2%)
 Frame = +3

Query  162  LLCCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTV  335
            L CC  S N  KY+ LD+KL  K++E +   P   S++S++++I+KFP  REGL+ IR+V
Sbjct  2    LCCCVNSENNKKYAELDAKLARKMVESRSIYPGHRSLKSMDSIIMKFPKLREGLRNIRSV  61

Query  336  FEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLI  515
            FE +D D+NG ID EELKKCL++L+  + +EE+  L+  CDVD ++ I+FNEFIVLLCLI
Sbjct  62   FESYDNDTNGTIDIEELKKCLEELKLSLSDEEVKGLYSWCDVDGSKGIQFNEFIVLLCLI  121

Query  516  YLL  524
            YLL
Sbjct  122  YLL  124



>gb|AET03429.2| EF hand calcium-binding family protein [Medicago truncatula]
Length=223

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 94/132 (71%), Gaps = 2/132 (2%)
 Frame = +3

Query  180  SPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDED  356
            SP K+   ++KLE K++E ++R      S++S N +ILKFP   E  ++ R +FEQFDED
Sbjct  6    SPKKFWVAETKLEAKMVEAMQRRECQGCSMKSFNTIILKFPKIDESFRKCRAIFEQFDED  65

Query  357  SNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAP  536
            SNG ID+EELKKC  KL+    EEE ++LF +CD++D+  +KF+EFIVLLCL+YLL D P
Sbjct  66   SNGTIDQEELKKCFSKLEISFSEEETNDLFEACDINDDLGMKFSEFIVLLCLVYLLKDDP  125

Query  537  SS-GSTSKIGSP  569
            ++  + S+IG P
Sbjct  126  AALHAKSRIGMP  137



>ref|XP_003547815.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X1 [Glycine max]
 ref|XP_006599197.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X2 [Glycine max]
 ref|XP_006599198.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X3 [Glycine max]
 gb|KHN14062.1| Putative calcium-binding protein CML21 [Glycine soja]
Length=229

 Score =   133 bits (335),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 98/141 (70%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLEVK-RNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G  L    SP K S  ++KLE K++E   R      S++S N +ILKFP   E L++ +
Sbjct  1    MGGALGKIESPKKGSVPETKLEAKMVEAMLRRESQGSSVKSFNTIILKFPKIDESLRKCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNGAID+EELKKC  KL+    EEEI++LF +CD++++  +KF+EFIVLLC
Sbjct  61   AIFEQFDEDSNGAIDQEELKKCFSKLEISFTEEEINDLFEACDINEDMVMKFSEFIVLLC  120

Query  510  LIYLLMDAPSS-GSTSKIGSP  569
            ++YLL D P++  + S+IG P
Sbjct  121  VVYLLKDDPAALHAKSRIGMP  141



>ref|XP_010488497.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
 ref|XP_010488498.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
Length=240

 Score =   134 bits (336),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 96/133 (72%), Gaps = 4/133 (3%)
 Frame = +3

Query  168  CCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  341
            CC  S N  KY+ LD+KL  K++E +R  P   S++S++++I+KFP  REGL+ IR+VFE
Sbjct  4    CCVKSENNKKYAELDAKLARKMVESRRIYPGHKSLKSMDSIIMKFPKLREGLRNIRSVFE  63

Query  342  QFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIY  518
             +D D NG ID EELKKCL++LQ   + +EE+  L+  CDVD ++ I+FNEFIVLLCLIY
Sbjct  64   SYDNDKNGTIDIEELKKCLEELQLISLSDEEVKGLYGWCDVDGSKGIQFNEFIVLLCLIY  123

Query  519  LLMDAPSSGSTSK  557
            LL   PSS S ++
Sbjct  124  LL-SKPSSESNAE  135



>ref|XP_009406355.1| PREDICTED: probable calcium-binding protein CML22 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406356.1| PREDICTED: probable calcium-binding protein CML22 [Musa acuminata 
subsp. malaccensis]
Length=291

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = +3

Query  90   TMKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLS  263
            +MK + GL R   +LK  SDKVG       S  K+ +    L+ ++LE   +R      +
Sbjct  37   SMKETSGLLRSFSALKSFSDKVGDAFAKLSSSIKHRKDHQNLKRRLLEAMKQRGYSNQNT  96

Query  264  IRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDEL  443
             RSIN++I+ FPHF+EGL+ I+ +FE++DEDSNG +  EELKKCL+ LQ  + E++ID L
Sbjct  97   FRSINSIIMWFPHFKEGLQNIKNIFEKYDEDSNGTMHHEELKKCLRMLQIQLSEKDIDRL  156

Query  444  FRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTS  554
            +  C +D+N+ I+++EFIVLLC  YLL   P S + +
Sbjct  157  YHYCGMDENKGIQYHEFIVLLCFAYLLA-GPDSATNN  192



>ref|XP_002268527.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Vitis vinifera]
 emb|CBI39804.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 100/141 (71%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++    SP K    ++KLE K++E ++R A    +++S N++ILKFP   E L+  +
Sbjct  1    MGGVVGKGDSPRKAWVPETKLEAKMVEAMQRRASEGSTMKSFNSIILKFPKIDESLRNCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +F+QFDEDSNGAID EELK+C  KL+    EEEI++LF +CD++++  +KFNEFIVLLC
Sbjct  61   AIFQQFDEDSNGAIDHEELKRCFLKLEISFSEEEINDLFEACDINEDMGMKFNEFIVLLC  120

Query  510  LIYLLMDAPSS-GSTSKIGSP  569
            L+YLL + P++  + S++G P
Sbjct  121  LVYLLKEDPAALQAKSRMGMP  141



>ref|NP_001242483.1| uncharacterized protein LOC100820628 [Glycine max]
 gb|ACU21290.1| unknown [Glycine max]
Length=229

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 98/141 (70%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G  L    SP K S  ++KLE K++E ++R      S++S N +ILKFP   E L++ +
Sbjct  1    MGGTLGKSESPRKGSMPETKLEAKMVEAMQRRESQGSSVKSFNTIILKFPKIDESLRKCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FE FD DSNGAID+EELKKC  KL+    EEEI++LF +CD++++  +KFNEFIVLLC
Sbjct  61   AIFEPFDGDSNGAIDQEELKKCFSKLEISFSEEEINDLFEACDINEDMGMKFNEFIVLLC  120

Query  510  LIYLLMDAPSS-GSTSKIGSP  569
            ++YLL + P++  + S+IG P
Sbjct  121  VVYLLKNDPAALHAKSRIGMP  141



>ref|XP_009102544.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Brassica rapa]
Length=246

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 93/128 (73%), Gaps = 4/128 (3%)
 Frame = +3

Query  153  VGSLLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKE  323
            + S+LCC     S  KY+ LD+KLE K++E +R  P   S++S++++I+ FP  +EGL+ 
Sbjct  14   IRSMLCCCVNSESNKKYAELDAKLERKMVESRRYYPGHRSLKSMDSIIMMFPKLKEGLRN  73

Query  324  IRTVFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNEFIV  500
            IR VFE +D+D NG ID EELKKCL++L+   + +EE+  L+  CDVD ++ I+FNEFIV
Sbjct  74   IRNVFESYDQDGNGTIDMEELKKCLEELKLMSLSDEEVKGLYGWCDVDGSKGIQFNEFIV  133

Query  501  LLCLIYLL  524
            LLCLIYLL
Sbjct  134  LLCLIYLL  141



>ref|XP_010644632.1| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Vitis vinifera]
 ref|XP_010644633.1| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Vitis vinifera]
 ref|XP_010644634.1| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Vitis vinifera]
Length=235

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 99/144 (69%), Gaps = 5/144 (3%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++    SP K    ++KLE K++E ++R A    +++S N++ILKFP   E L+  +
Sbjct  1    MGGVVGKGDSPRKAWVPETKLEAKMVEAMQRRASEGSTMKSFNSIILKFPKIDESLRNCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +F+QFDEDSNGAID EELK+C  KL+    EEEI++LF +CD++++  +KFNEFIVLLC
Sbjct  61   AIFQQFDEDSNGAIDHEELKRCFLKLEISFSEEEINDLFEACDINEDMGMKFNEFIVLLC  120

Query  510  LIYLLMDAPSS----GSTSKIGSP  569
            L+YLL + P++       S++G P
Sbjct  121  LVYLLKEDPAALQAVSKKSRMGMP  144



>gb|ACN85218.1| calcium ion binding protein [Oryza punctata]
Length=224

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 99/138 (72%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G +L  H +  + S   SKLETK++E +++ A    S++S++++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTMKRSSH-GSKLETKMVESMQQRASHGTSLKSLDSIIMKFPKIDESLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            T+FEQFDEDSNG ID++ELK C QKL+    EEEI+ELF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINELFEACDINEDMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            LIYLL +   S +  K+G
Sbjct  120  LIYLLNEPAVSEAKIKMG  137



>ref|XP_006857595.1| hypothetical protein AMTR_s00061p00095500 [Amborella trichopoda]
 gb|ERN19062.1| hypothetical protein AMTR_s00061p00095500 [Amborella trichopoda]
Length=226

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 94/140 (67%), Gaps = 1/140 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++    SP +     SKLE K++E ++R A    +++S N++I+KFP   E L+ ++
Sbjct  1    MGGVIGKCDSPRRQGLPISKLEAKMVEAMRRKAAEGTTVKSFNSIIMKFPKIDENLRNVK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            T+FEQFDEDSNG+ID EELK C  KLQ    EEE+ +LF +CD+ + + +KFNEFIVLLC
Sbjct  61   TIFEQFDEDSNGSIDPEELKHCFNKLQISFTEEEVSDLFEACDISETQGMKFNEFIVLLC  120

Query  510  LIYLLMDAPSSGSTSKIGSP  569
            L+YLL +     +  K+G P
Sbjct  121  LVYLLKEPAVLPAKLKLGLP  140



>gb|ACN85272.1| calcium ion binding protein [Oryza alta]
Length=216

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 98/138 (71%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G +L  H +  + S   SKLETK++E +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTMKRSSH-GSKLETKMVESMQQRASHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            T+FEQFDEDSNG ID++ELK C QKL+    EEEI+ELF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINELFEACDINEDMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            LIYLL +   S +  K+G
Sbjct  120  LIYLLNEPAVSEAKIKMG  137



>gb|KHG00196.1| putative calcium-binding CML21 -like protein [Gossypium arboreum]
Length=220

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +3

Query  177  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  353
            G   K    ++KLE K++E ++  A    +I+S N++ILKFP     L++ + +FEQFDE
Sbjct  3    GVVGKSESPETKLEAKMVEAMQHRASKGTTIKSFNSIILKFPKIDHTLRKCKAIFEQFDE  62

Query  354  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-  530
            DSNGAID EELKKCL KLQ    EEEI++LF++CD++++  IKFNEFIVLLCL+YLL D 
Sbjct  63   DSNGAIDHEELKKCLHKLQVCFTEEEIEDLFKACDMNEDMGIKFNEFIVLLCLVYLLKDN  122

Query  531  APSSGSTSKIGSP  569
            A    + S++G P
Sbjct  123  ATEFEAKSRMGVP  135



>gb|ACN85246.1| calcium ion binding protein [Oryza officinalis]
Length=224

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 99/138 (72%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G++L  H +  + S   SKLETK++E +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGAILGRHDTLKRSSH-GSKLETKMVESMQQRASHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            T+FEQFDEDSNG ID++ELK C QKL+    EEEI+ELF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINELFEACDINEDMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            LIYLL +   S +  K+G
Sbjct  120  LIYLLNEPAVSEAKIKMG  137



>gb|EMT01046.1| Putative calcium-binding protein CML21 [Aegilops tauschii]
Length=224

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +3

Query  210  KLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREEL  386
            KLE++++E +K+ A    S++S N++I+KFP   EGL++ +T+FEQFDEDSNG ID+EEL
Sbjct  19   KLESRMVESMKQRAAHGTSVKSFNSIIMKFPKIDEGLRKCKTIFEQFDEDSNGEIDKEEL  78

Query  387  KKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIG  563
            K C  KL+    EEEI +LF +CD++++  +K+NEFIV LCL+YLL D  +S + +K+G
Sbjct  79   KNCFHKLEISFTEEEISDLFEACDINEDMGMKYNEFIVFLCLVYLLNDPAASEAKTKMG  137



>emb|CAN71481.1| hypothetical protein VITISV_006244 [Vitis vinifera]
Length=257

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 99/144 (69%), Gaps = 5/144 (3%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++    SP K    ++KLE K++E ++R A    +++S N++ILKFP   E L+  +
Sbjct  1    MGGVVGKGDSPRKAWVPETKLEAKMVEAMQRRASEGSTMKSFNSIILKFPKIDESLRNCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +F+QFDEDSNGAID EELK+C  KL+    EEEI++LF +CD++++  +KFNEFIVLLC
Sbjct  61   AIFQQFDEDSNGAIDHEELKRCFLKLEISFSEEEINDLFEACDINEDMGMKFNEFIVLLC  120

Query  510  LIYLLMDAPSS----GSTSKIGSP  569
            L+YLL + P++       S++G P
Sbjct  121  LVYLLKEDPTALQAVSKKSRMGMP  144



>ref|XP_009102545.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Brassica rapa]
Length=230

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = +3

Query  162  LLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  332
            +LCC     S  KY+ LD+KLE K++E +R  P   S++S++++I+ FP  +EGL+ IR 
Sbjct  1    MLCCCVNSESNKKYAELDAKLERKMVESRRYYPGHRSLKSMDSIIMMFPKLKEGLRNIRN  60

Query  333  VFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            VFE +D+D NG ID EELKKCL++L+   + +EE+  L+  CDVD ++ I+FNEFIVLLC
Sbjct  61   VFESYDQDGNGTIDMEELKKCLEELKLMSLSDEEVKGLYGWCDVDGSKGIQFNEFIVLLC  120

Query  510  LIYLL  524
            LIYLL
Sbjct  121  LIYLL  125



>emb|CDX77458.1| BnaA07g05960D [Brassica napus]
Length=230

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = +3

Query  162  LLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  332
            +LCC     S  KY+ LD+KLE K++E +R  P   S++S++++I+ FP  +EGL+ IR 
Sbjct  1    MLCCCVNSESNKKYAELDAKLERKMVESRRYYPGHRSLKSMDSIIMMFPKLKEGLRNIRN  60

Query  333  VFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            VFE +D+D NG ID EELKKCL++L+   + +EE+  L+  CDVD ++ I+FNEFIVLLC
Sbjct  61   VFESYDQDGNGTIDMEELKKCLEELKLMSLSDEEVKGLYGWCDVDGSKGIQFNEFIVLLC  120

Query  510  LIYLL  524
            LIYLL
Sbjct  121  LIYLL  125



>gb|ACN85259.1| calcium ion binding protein [Oryza alta]
Length=224

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 98/138 (71%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G +L  H +  + S   SKLETK++E +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTLKRSSH-GSKLETKMVESMQQRASHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            T+FEQFDEDSNG ID++ELK C QKL+    EEEI+ELF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINELFEACDINEDMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            LIYLL +   S +  K+G
Sbjct  120  LIYLLNEPAVSEAKIKMG  137



>gb|KDP36321.1| hypothetical protein JCGZ_09536 [Jatropha curcas]
Length=222

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 98/141 (70%), Gaps = 3/141 (2%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +GS+     SP +Y   ++KLE K++E ++R      +I+S N++ILKFP   E L++ +
Sbjct  1    MGSVKVQDDSP-RYWIPETKLEAKMVEAMQRREAEGCAIKSFNSIILKFPKIDESLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNG IDREEL+KC  KL+    EEEID+LF +CD +++  ++FNEFIVLLC
Sbjct  60   DIFEQFDEDSNGIIDREELRKCFHKLELSFTEEEIDDLFLACDFNEDMGMEFNEFIVLLC  119

Query  510  LIYLL-MDAPSSGSTSKIGSP  569
            L+YLL  D  +  S S++G P
Sbjct  120  LVYLLKYDTAAVHSKSRMGMP  140



>ref|XP_007156300.1| hypothetical protein PHAVU_003G275000g [Phaseolus vulgaris]
 gb|ESW28294.1| hypothetical protein PHAVU_003G275000g [Phaseolus vulgaris]
Length=228

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 99/141 (70%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G+ L    SP K    ++K+E K++E ++R      S++S N +ILKFP   E L++ +
Sbjct  3    MGATLGKSDSPKKGWMPETKIEAKMVEAMQRRESHGSSVKSFNTIILKFPKIDESLRKCK  62

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNG I++EELKK   KL+  + EEEI++LF +CD++D+  ++F+EFIVLLC
Sbjct  63   AIFEQFDEDSNGTIEKEELKKSFSKLEIPLTEEEINDLFEACDINDDMGMEFSEFIVLLC  122

Query  510  LIYLLMDAPSSG-STSKIGSP  569
            L+YLL D P++  + S++G P
Sbjct  123  LVYLLKDDPAAAHAKSQVGMP  143



>ref|XP_008794706.1| PREDICTED: probable calcium-binding protein CML21 [Phoenix dactylifera]
Length=226

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            +SKLE K++E +++ A    S++S N++I+KF    E L+  +T+FE+FDEDSNGAID E
Sbjct  17   ESKLEAKMVEAMQKRASEGSSMKSFNSIIMKFSKIDESLRNCKTIFERFDEDSNGAIDPE  76

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKI  560
            ELK+C Q L+    EEEI++LF++CD+++N  IKFNEFIVLLCL+YLL +  ++   S +
Sbjct  77   ELKRCFQNLEISATEEEINDLFKACDINENMGIKFNEFIVLLCLVYLLKEPAAARVKSSM  136

Query  561  GSP  569
            G P
Sbjct  137  GLP  139



>ref|XP_010244812.1| PREDICTED: probable calcium-binding protein CML21 [Nelumbo nucifera]
 ref|XP_010244813.1| PREDICTED: probable calcium-binding protein CML21 [Nelumbo nucifera]
 ref|XP_010244814.1| PREDICTED: probable calcium-binding protein CML21 [Nelumbo nucifera]
 ref|XP_010244815.1| PREDICTED: probable calcium-binding protein CML21 [Nelumbo nucifera]
Length=230

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 94/141 (67%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G  L    SP K    ++KLE K++E ++R A     ++S ++++LKFP   E  +  +
Sbjct  1    MGGTLGKGDSPRKGWTPETKLEAKMVEAMQRRASKGCVMKSFDSIVLKFPKIDESFRNCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            T+FEQFDEDSNGAID EELK C  KL+    EEEI +LF +CD+ +N  +KFNEFIVLLC
Sbjct  61   TIFEQFDEDSNGAIDPEELKHCFHKLEISFTEEEISDLFEACDIHENMGMKFNEFIVLLC  120

Query  510  LIYLLMDAPSS-GSTSKIGSP  569
            L+YLL + P++    SK+G P
Sbjct  121  LVYLLKEDPAALQFKSKMGFP  141



>ref|XP_008782977.1| PREDICTED: probable calcium-binding protein CML21 [Phoenix dactylifera]
Length=226

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +3

Query  189  KYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNG  365
            + S  +SKLE K++E +++ A    S++S N++I+KFP   E L+  +T+FEQFDEDSNG
Sbjct  12   RRSAPESKLEAKMVEAMQKRASEGTSMKSFNSIIMKFPKIDESLRNCKTIFEQFDEDSNG  71

Query  366  AIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG  545
            AID EELK C QKL+    EEEI +LF++CD++++  I F+EFIVLLCL+YLL +  +  
Sbjct  72   AIDPEELKHCFQKLEISATEEEISDLFKACDINESMGINFSEFIVLLCLVYLLKEPAAVQ  131

Query  546  STSKIGSP  569
              S++G P
Sbjct  132  VKSRMGLP  139



>gb|AFJ15127.1| putative calcium-binding protein CML21 [Camellia sinensis]
Length=230

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 101/141 (72%), Gaps = 3/141 (2%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G  L    +P K +  ++KLE K++E ++R A    S++S N++ILKFP   E L++ +
Sbjct  1    MGGALSTGDAP-KDNITETKLEAKMVEAMQRRASEGSSMKSFNSIILKFPKIDESLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDED+NG ID EELK+C  KL+ ++ EEEI++LF +CD+ +N  +KFNEFIVLLC
Sbjct  60   AIFEQFDEDANGTIDPEELKRCFLKLEINLPEEEINDLFEACDIYENLGMKFNEFIVLLC  119

Query  510  LIYLLMDAPSS-GSTSKIGSP  569
            L+YLL + P++  + S++G P
Sbjct  120  LVYLLKENPTALHAKSRMGMP  140



>gb|KEH22471.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=219

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = +3

Query  138  LVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGL  317
             +++K+G+++CC     +   L+ KLE K+ E++RN      ++SI+++++ FP F+E L
Sbjct  14   FLANKMGAVICCISEQGEKKSLERKLEKKIAEIRRNKFGQTKLKSIDSIVMLFPMFKERL  73

Query  318  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  497
            K +R +FEQ+DEDSN +I+  EL+  L+ LQ H+ E EI+  F+ CD+D ++ I+FNEFI
Sbjct  74   KTLRGMFEQYDEDSNESIEPHELQTFLEDLQLHLPENEIENFFQYCDIDGSKGIQFNEFI  133

Query  498  VLLCLIYLLMDAPSSGSTSK  557
            VLLCLI++L +  SS ++ K
Sbjct  134  VLLCLIHILTEPLSSDNSPK  153



>ref|XP_004516273.1| PREDICTED: probable calcium-binding protein CML22-like [Cicer 
arietinum]
Length=216

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  332
            +G+++CC    ++   L+ KLE K+ E++RN      ++SI+++++ FP F+E LK +R 
Sbjct  1    MGAIICCISKSSEKKSLERKLEKKIAEIRRNKFGQSKLKSIDSIVMLFPMFKERLKTLRG  60

Query  333  VFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  512
            +FEQ+DEDSNG+I+  EL+  L+ LQ H+ E+EI+ +F  CD+D ++ I+FNEFIVLLCL
Sbjct  61   MFEQYDEDSNGSIEPHELEIFLEHLQLHLQEQEIESIFHYCDIDGSKGIQFNEFIVLLCL  120

Query  513  IYLLMDAPSSGSTSK  557
            I++L +  SS ++ K
Sbjct  121  IHILTEPLSSDNSPK  135



>ref|XP_007020327.1| Calcium-binding EF-hand family protein [Theobroma cacao]
 gb|EOY11852.1| Calcium-binding EF-hand family protein [Theobroma cacao]
Length=230

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = +3

Query  180  SPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDED  356
            SP      ++KLE K++E ++R A    +++S N++ILKFP   E L++ + +FEQFDED
Sbjct  10   SPEMVWVPETKLEAKMVEAMQRRASKGTAMKSFNSIILKFPKIDENLRKCKAIFEQFDED  69

Query  357  SNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-A  533
            SNGAID EELKKCL KL+    EEEI++LF +CD++++  +KFNEFIVLLCL++L  D A
Sbjct  70   SNGAIDHEELKKCLNKLEVSFTEEEINDLFNACDINEDMGMKFNEFIVLLCLVHLFKDNA  129

Query  534  PSSGSTSKIG  563
             S  + S++G
Sbjct  130  TSLEAKSRMG  139



>ref|XP_006474771.1| PREDICTED: probable calcium-binding protein CML21-like [Citrus 
sinensis]
Length=229

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 91/124 (73%), Gaps = 2/124 (2%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E ++R A    +++S N++ILKFP   + L+  + +FE+FDEDSNG ID E
Sbjct  18   ETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCKAIFEKFDEDSNGTIDHE  77

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  557
            ELKKC  KL+    EEEI++LF +CD++ +  +KFNEFIVLLCL+YLL D P++  + S+
Sbjct  78   ELKKCFHKLEIKFTEEEINDLFEACDINKDMGMKFNEFIVLLCLVYLLKDDPTALRAKSR  137

Query  558  IGSP  569
            +G P
Sbjct  138  MGMP  141



>ref|XP_006452756.1| hypothetical protein CICLE_v10009385mg [Citrus clementina]
 gb|ESR65996.1| hypothetical protein CICLE_v10009385mg [Citrus clementina]
 gb|KDO73986.1| hypothetical protein CISIN_1g026998mg [Citrus sinensis]
Length=229

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 91/124 (73%), Gaps = 2/124 (2%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E ++R A    +++S N++ILKFP   + L+  + +FE+FDEDSNG ID E
Sbjct  18   ETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCKAIFEKFDEDSNGTIDHE  77

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  557
            ELKKC  KL+    EEEI++LF +CD++ +  +KFNEFIVLLCL+YLL D P++  + S+
Sbjct  78   ELKKCFHKLEIKFTEEEINDLFEACDINKDMGMKFNEFIVLLCLVYLLKDDPTALRAKSR  137

Query  558  IGSP  569
            +G P
Sbjct  138  MGMP  141



>gb|KEH22470.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=238

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = +3

Query  138  LVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGL  317
             +++K+G+++CC     +   L+ KLE K+ E++RN      ++SI+++++ FP F+E L
Sbjct  14   FLANKMGAVICCISEQGEKKSLERKLEKKIAEIRRNKFGQTKLKSIDSIVMLFPMFKERL  73

Query  318  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  497
            K +R +FEQ+DEDSN +I+  EL+  L+ LQ H+ E EI+  F+ CD+D ++ I+FNEFI
Sbjct  74   KTLRGMFEQYDEDSNESIEPHELQTFLEDLQLHLPENEIENFFQYCDIDGSKGIQFNEFI  133

Query  498  VLLCLIYLLMDAPSSGSTSK  557
            VLLCLI++L +  SS ++ K
Sbjct  134  VLLCLIHILTEPLSSDNSPK  153



>ref|XP_010063214.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML21 [Eucalyptus grandis]
Length=235

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 98/141 (70%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++    +P K    ++KLE K++E ++R A     ++S N++ILKFP   +  ++ +
Sbjct  1    MGGVIGKGDAPKKAWVPETKLEAKMVEAMQRRASGGSKMKSFNSIILKFPKIDKSFRKCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            ++FEQFDEDSN  ID+EEL+ C  KL+    +EEI++LF +CD++D+  IKFNEFIVLLC
Sbjct  61   SIFEQFDEDSNHVIDKEELRHCFNKLEISFSDEEINDLFEACDINDDMGIKFNEFIVLLC  120

Query  510  LIYLLMDAPSSG-STSKIGSP  569
            L++LL D P++  + SK+G P
Sbjct  121  LVHLLKDDPTAQLAKSKMGMP  141



>ref|XP_006656237.1| PREDICTED: probable calcium-binding protein CML21-like [Oryza 
brachyantha]
Length=225

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 97/138 (70%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G +L  H +  + S   SKLE K++E +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTMKRNSH-GSKLEAKMVEAIQQRAAHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            T+FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            LIYLL +   S +  K+G
Sbjct  120  LIYLLNEPAVSEAKLKMG  137



>ref|XP_008219144.1| PREDICTED: probable calcium-binding protein CML21 [Prunus mume]
 ref|XP_008219151.1| PREDICTED: probable calcium-binding protein CML21 [Prunus mume]
Length=227

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G+++    SP ++S  ++KLE K++E +KR A     ++S N+LILKF    E L++ +
Sbjct  1    MGAVVGKGDSPRQFSIHETKLEAKMVEAMKRRAVKGSVMKSFNSLILKFRKIDESLRKCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNGAID+EE+KKC  KL+    +EEI +LF +CD++++  IKFNEFIVL+C
Sbjct  61   AIFEQFDEDSNGAIDQEEMKKCFYKLEVSFTDEEISDLFEACDINEDMGIKFNEFIVLIC  120

Query  510  LIYLLMD  530
            L+YLL D
Sbjct  121  LVYLLKD  127



>gb|KCW70421.1| hypothetical protein EUGRSUZ_F03649 [Eucalyptus grandis]
Length=223

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 98/141 (70%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++    +P K    ++KLE K++E ++R A     ++S N++ILKFP   +  ++ +
Sbjct  1    MGGVIGKGDAPKKAWVPETKLEAKMVEAMQRRASGGSKMKSFNSIILKFPKIDKSFRKCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            ++FEQFDEDSN  ID+EEL+ C  KL+    +EEI++LF +CD++D+  IKFNEFIVLLC
Sbjct  61   SIFEQFDEDSNHVIDKEELRHCFNKLEISFSDEEINDLFEACDINDDMGIKFNEFIVLLC  120

Query  510  LIYLLMDAPSSG-STSKIGSP  569
            L++LL D P++  + SK+G P
Sbjct  121  LVHLLKDDPTAQLAKSKMGMP  141



>ref|XP_010092394.1| putative calcium-binding protein CML21 [Morus notabilis]
 gb|EXB51070.1| putative calcium-binding protein CML21 [Morus notabilis]
Length=229

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++    SP K    ++KLE K++E +KR A    S++S + +ILKFP   E L+  +
Sbjct  1    MGGIVGKSESPKKVCTPETKLEAKIVEAMKRRAIQGTSMKSFDNIILKFPKIDESLRNCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FE FDEDSNGAID+EE+KKC  KL     EEEI + F +CD++++  IKFNEFIVLLC
Sbjct  61   AIFELFDEDSNGAIDQEEMKKCFHKLGISFTEEEISDFFNACDINEDMGIKFNEFIVLLC  120

Query  510  LIYLLMDAPSSGST  551
            L+YLL D  ++  T
Sbjct  121  LVYLLKDGQTAIHT  134



>ref|XP_010928993.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
Length=226

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = +3

Query  189  KYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNG  365
            + S  +SKLE K++E +++ A    S++S N++I+KFP   E L+  +T+FEQFDEDSNG
Sbjct  12   RRSAPESKLEVKMVEAMQKRASEGTSMKSFNSIIMKFPKIDESLRNCKTIFEQFDEDSNG  71

Query  366  AIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG  545
            AID EELK C QKL+    EEEI +LF +CD++++  I F+EFIVLLCL+YLL +  +  
Sbjct  72   AIDPEELKHCFQKLEISAMEEEISDLFMACDINESMGINFSEFIVLLCLVYLLKEPAALQ  131

Query  546  STSKIGSP  569
              S++G P
Sbjct  132  VKSRMGLP  139



>ref|XP_007140756.1| hypothetical protein PHAVU_008G139100g [Phaseolus vulgaris]
 gb|ESW12750.1| hypothetical protein PHAVU_008G139100g [Phaseolus vulgaris]
Length=220

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 98/137 (72%), Gaps = 0/137 (0%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  332
            +G +L C G  +K   LD K+E K++E++R+      ++S++ +++ FP F+E LK +R 
Sbjct  1    MGVILSCIGKSSKSMSLDDKIERKIVEMRRHKFGESKLKSVDGIVMMFPMFKEKLKTLRG  60

Query  333  VFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  512
            +FEQ+DEDSNG+I+  ELKK L+ L  H+ E+EI+ LF  CD+D ++ I+FNEFIVLLCL
Sbjct  61   MFEQYDEDSNGSIEPNELKKFLEHLDLHLKEKEIETLFEYCDIDGSKGIQFNEFIVLLCL  120

Query  513  IYLLMDAPSSGSTSKIG  563
            I+LL +  SS ++SK G
Sbjct  121  IHLLEEPSSSNNSSKAG  137



>ref|NP_001058046.1| Os06g0609600 [Oryza sativa Japonica Group]
 dbj|BAD35633.1| calcium-binding EF hand-like protein [Oryza sativa Japonica Group]
 dbj|BAD35476.1| calcium-binding EF hand-like protein [Oryza sativa Japonica Group]
 dbj|BAF19960.1| Os06g0609600 [Oryza sativa Japonica Group]
 gb|EAZ01634.1| hypothetical protein OsI_23671 [Oryza sativa Indica Group]
 gb|EAZ37606.1| hypothetical protein OsJ_21942 [Oryza sativa Japonica Group]
 dbj|BAG93019.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 97/138 (70%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G +L  H +  + S   SKLETK++E +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTMKRSSH-GSKLETKMVESMQQRASHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  +KFNEFIV LC
Sbjct  60   IIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            LIYLL +   S +  K+G
Sbjct  120  LIYLLNEPAVSEAKIKMG  137



>gb|ACN85201.1| calcium ion binding protein [Oryza glaberrima]
Length=224

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 97/138 (70%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G +L  H +  + S   SKLETK++E +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTMKRSSH-GSKLETKMVESMQQRASHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  +KFNEFIV LC
Sbjct  60   IIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            LIYLL +   S +  K+G
Sbjct  120  LIYLLNEPAVSEAKIKMG  137



>gb|EMS55923.1| putative calcium-binding protein CML21 [Triticum urartu]
Length=223

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +3

Query  210  KLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREEL  386
            KLE+K++E +K+ A    S++S N +I+KFP   EGL++ +T+FEQFDEDSNG ID+EEL
Sbjct  19   KLESKMVESMKQRAAHGTSVKSFNTIIMKFPKIDEGLRKCKTIFEQFDEDSNGEIDKEEL  78

Query  387  KKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIG  563
            K C QKL+     EEI +LF +CD++++  +K+NEFIV LCL+YLL D  +S + +K+G
Sbjct  79   KHCFQKLEISF-TEEIGDLFEACDINEDMGMKYNEFIVFLCLVYLLNDPTASEAKTKMG  136



>ref|XP_002532937.1| Troponin C, skeletal muscle, putative [Ricinus communis]
 gb|EEF29441.1| Troponin C, skeletal muscle, putative [Ricinus communis]
Length=227

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 91/124 (73%), Gaps = 2/124 (2%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E ++R      SI+S N++ILKFP   E L++ + +FEQFDEDSNG ID+E
Sbjct  16   ETKLEAKMVEAMRRRGAEGCSIKSFNSIILKFPKIDESLRKCKAIFEQFDEDSNGTIDQE  75

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLM-DAPSSGSTSK  557
            EL+KC  KL+    EEE ++LF +CD++++  +KFNEFIVLLCL+YLL  D+ +  + SK
Sbjct  76   ELRKCFCKLEISFTEEETNDLFEACDINEDMGMKFNEFIVLLCLVYLLKDDSAAVHAKSK  135

Query  558  IGSP  569
            +G P
Sbjct  136  MGMP  139



>ref|XP_007205832.1| hypothetical protein PRUPE_ppa010999mg [Prunus persica]
 gb|EMJ07031.1| hypothetical protein PRUPE_ppa010999mg [Prunus persica]
Length=227

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G+++    SP ++S  ++KLE K++E +KR A     ++S ++LILKF    E L++ +
Sbjct  1    MGAVVGKGDSPRQFSIHETKLEAKMVEAMKRRAVKGSVMKSFDSLILKFRKIDESLRKCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNGAID+EE+KKC  KL+    +EEI +LF +CD++++  IKFNEFIVL+C
Sbjct  61   AIFEQFDEDSNGAIDQEEMKKCFYKLEVSFTDEEISDLFEACDINEDMGIKFNEFIVLIC  120

Query  510  LIYLLMD  530
            L+YLL D
Sbjct  121  LVYLLKD  127



>ref|XP_009346680.1| PREDICTED: probable calcium-binding protein CML21 [Pyrus x bretschneideri]
Length=227

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 97/141 (69%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSI-RSINALILKFPHFREGLKEIR  329
            +G+++    +  ++S  ++KLE K++E  +   A  SI +S N+LILKFP   E L+  +
Sbjct  1    MGAVVGKSENARRFSIHETKLEAKMVEAMQRRAAKGSIMKSFNSLILKFPKIDESLRNCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNG ID+EE+KKC  KL+    +EEID+LF +CD++++  IKFNEFIVL+C
Sbjct  61   AIFEQFDEDSNGMIDQEEMKKCFYKLEVSFTDEEIDDLFEACDINEDMGIKFNEFIVLIC  120

Query  510  LIYLLMDAPSSGSTS-KIGSP  569
            L++LL D   +  T  ++G P
Sbjct  121  LVHLLKDDNKAVHTKLQLGMP  141



>ref|XP_008805537.1| PREDICTED: probable calcium-binding protein CML21 [Phoenix dactylifera]
 ref|XP_008805538.1| PREDICTED: probable calcium-binding protein CML21 [Phoenix dactylifera]
Length=227

 Score =   125 bits (315),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = +3

Query  180  SPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDED  356
            + +K+   +S LE K++E ++R A    +I+S N++ILKFP   E L+  + +F+QFDED
Sbjct  9    ASSKHCLPESNLEVKIVEAIRRKASKGSAIKSFNSIILKFPKIDESLRNCKAIFDQFDED  68

Query  357  SNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAP  536
            SNG ID EELK+C  KL+    EEEI +LF +CD+ +N  ++FNEFIVLLCL+YLL +  
Sbjct  69   SNGMIDPEELKRCFHKLEISCTEEEISDLFEACDIRENMGMRFNEFIVLLCLVYLLKEPA  128

Query  537  SSGSTSKIGSP  569
            +  + S +G P
Sbjct  129  ALQAKSGMGLP  139



>gb|KEH22472.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=201

 Score =   124 bits (312),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 94/135 (70%), Gaps = 0/135 (0%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  332
            +G+++CC     +   L+ KLE K+ E++RN      ++SI+++++ FP F+E LK +R 
Sbjct  1    MGAVICCISEQGEKKSLERKLEKKIAEIRRNKFGQTKLKSIDSIVMLFPMFKERLKTLRG  60

Query  333  VFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  512
            +FEQ+DEDSN +I+  EL+  L+ LQ H+ E EI+  F+ CD+D ++ I+FNEFIVLLCL
Sbjct  61   MFEQYDEDSNESIEPHELQTFLEDLQLHLPENEIENFFQYCDIDGSKGIQFNEFIVLLCL  120

Query  513  IYLLMDAPSSGSTSK  557
            I++L +  SS ++ K
Sbjct  121  IHILTEPLSSDNSPK  135



>ref|XP_003530839.1| PREDICTED: probable calcium-binding protein CML22-like [Glycine 
max]
Length=216

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = +3

Query  165  LCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQ  344
            + C G  +K   LD KLE K+ E++R       ++S++++++ FP F+E LK +R +FEQ
Sbjct  1    MSCIGISSKKMCLDDKLERKIAEMRRYKFGQSKLKSVDSVVMLFPMFKERLKTLRGMFEQ  60

Query  345  FDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLL  524
            +DEDSNG+I+  ELKK L+ L+ H+ E+EI+ LF+ CD+D ++ I+FNEFIVLLCLI+LL
Sbjct  61   YDEDSNGSIEPNELKKFLEHLELHLKEQEIEHLFQYCDLDGSKGIQFNEFIVLLCLIHLL  120

Query  525  MDAPSSGSTSK  557
             +  SS  +SK
Sbjct  121  AEPSSSDISSK  131



>gb|ACN85332.1| calcium ion binding protein [Oryza granulata]
Length=224

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 97/138 (70%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G +L  H +  + S   SKLETK+++ +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTLKRSSH-GSKLETKMVQAIQQRALHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  +KFNEFIV LC
Sbjct  60   AIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            LIYLL +   S +  K+G
Sbjct  120  LIYLLNEPAVSEAKIKMG  137



>ref|XP_010913274.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
 ref|XP_010913275.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
 ref|XP_010913276.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
 ref|XP_010913277.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
 ref|XP_010913278.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
Length=227

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            +SKLE +++E ++R A    +I+S N++ILKFP   E L+  +T+F+QFDEDSNG ID E
Sbjct  17   ESKLEAEMVEAIRRKASKGSAIKSFNSIILKFPKIDESLRNCKTIFDQFDEDSNGMIDPE  76

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKI  560
            ELK C  KL+    EEEI +LF +CD+ +N  +KFNEFIVLLCL+YLL +  +  + S +
Sbjct  77   ELKHCFHKLEISCPEEEISDLFEACDIRENMGMKFNEFIVLLCLVYLLKEPAALQAKSGM  136

Query  561  GSP  569
            G P
Sbjct  137  GLP  139



>gb|KDO73987.1| hypothetical protein CISIN_1g026998mg [Citrus sinensis]
Length=221

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E ++R A    +++S N++ILKFP   + L+  + +FE+FDEDSNG ID E
Sbjct  18   ETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCKAIFEKFDEDSNGTIDHE  77

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS  542
            ELKKC  KL+    EEEI++LF +CD++ +  +KFNEFIVLLCL+YLL D P++
Sbjct  78   ELKKCFHKLEIKFTEEEINDLFEACDINKDMGMKFNEFIVLLCLVYLLKDDPTA  131



>gb|AFK36647.1| unknown [Lotus japonicus]
Length=220

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  332
            +G+ +CC    ++   LD KL  K+ E++RN      +++++++++ FP F E LK +R 
Sbjct  1    MGATMCCITKSSERKSLDGKLGKKIAEIRRNKFGQSRLKTVDSIVMLFPMFHERLKTLRG  60

Query  333  VFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  512
            +FEQFDEDSNG+I+  ELK  L  L+ H+ E+EI+ LF  CD+D ++ I+FNEFIVLLCL
Sbjct  61   MFEQFDEDSNGSIEPNELKGFLDHLELHLPEQEIENLFHYCDIDGSKGIQFNEFIVLLCL  120

Query  513  IYLLMDAPSSGSTSK  557
            I+LL +  S  ++ K
Sbjct  121  IHLLTEPLSYDTSPK  135



>ref|XP_006647028.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006647029.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X2 [Oryza brachyantha]
Length=227

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 95/138 (69%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++    SP ++S   SKLE K++E +++ A    S++S N++I+KFP   E L+  R
Sbjct  1    MGGVIGRGDSP-RHSSPASKLEKKMVEAMQQRAQQGTSVKSFNSVIMKFPKIDESLRNCR  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            T+F+QFDEDSNG ID+EELK C QKL     +EEI +LF++CD+ ++  +KFNEFIV LC
Sbjct  60   TIFQQFDEDSNGEIDQEELKHCFQKLGIAFTDEEIKDLFQACDIYEHMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            L+YLL D   S +  ++G
Sbjct  120  LVYLLNDPLVSEARKRMG  137



>gb|KEH22469.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=220

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 94/135 (70%), Gaps = 0/135 (0%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  332
            +G+++CC     +   L+ KLE K+ E++RN      ++SI+++++ FP F+E LK +R 
Sbjct  1    MGAVICCISEQGEKKSLERKLEKKIAEIRRNKFGQTKLKSIDSIVMLFPMFKERLKTLRG  60

Query  333  VFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  512
            +FEQ+DEDSN +I+  EL+  L+ LQ H+ E EI+  F+ CD+D ++ I+FNEFIVLLCL
Sbjct  61   MFEQYDEDSNESIEPHELQTFLEDLQLHLPENEIENFFQYCDIDGSKGIQFNEFIVLLCL  120

Query  513  IYLLMDAPSSGSTSK  557
            I++L +  SS ++ K
Sbjct  121  IHILTEPLSSDNSPK  135



>ref|XP_010545296.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML21 [Tarenaya hassleriana]
Length=230

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K+ E ++R A    S++S N+++LKFP   +GL+  R++F QFDEDSNG ID E
Sbjct  17   ETKLEAKISEAMQRRASRGTSMKSFNSIVLKFPKIDDGLRNCRSIFHQFDEDSNGWIDHE  76

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS  542
            ELKK  +KL+  + EEEI +LF  CD++D+  I F EFIVLLCL+YLL D PS+
Sbjct  77   ELKKSFEKLEISMTEEEIRDLFEGCDINDDMGITFKEFIVLLCLVYLLKDDPST  130



>gb|ACN85168.1| calcium ion binding protein [Oryza nivara]
 gb|ACN85185.1| calcium ion binding protein [Oryza rufipogon]
Length=224

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 96/138 (70%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G +L  H +  + S   SKLE K++E +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTMKRSSH-GSKLEMKMVESMQQRASHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  +KFNEFIV LC
Sbjct  60   IIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            LIYLL +   S +  K+G
Sbjct  120  LIYLLNEPAVSEAKIKMG  137



>ref|XP_002862334.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38592.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=142

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E V+R A    +++S N+++LKFP   +GL+  + +F++FDEDSNG+ID  
Sbjct  18   ETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHT  77

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS  542
            ELK C++KL+    EEEI++LF++CD++++  I F EFIVLLCL+YLL D  S+
Sbjct  78   ELKNCIKKLEISFDEEEINDLFKACDINEDMGITFTEFIVLLCLVYLLKDDSST  131



>ref|XP_002438663.1| hypothetical protein SORBIDRAFT_10g023890 [Sorghum bicolor]
 gb|EER90030.1| hypothetical protein SORBIDRAFT_10g023890 [Sorghum bicolor]
Length=224

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 98/138 (71%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G++L  H + +K S   SKLE+K+++ +++ A    S++S +++I+KFP   E  ++ +
Sbjct  1    MGAVLGRHDT-HKRSFHGSKLESKMVDAMQKRALHGTSLKSFDSIIMKFPKIDESFRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            T+FEQFDEDSNG ID+EELK C QKL+    EEEI +LF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKEELKHCFQKLEISFTEEEISDLFEACDINEDMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            L+YLL +   S +  K+G
Sbjct  120  LVYLLNEPAVSEAKIKMG  137



>ref|XP_008353863.1| PREDICTED: probable calcium-binding protein CML21 [Malus domestica]
 ref|XP_008353869.1| PREDICTED: probable calcium-binding protein CML21 [Malus domestica]
Length=227

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 96/141 (68%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++    S  K+S  ++KLE K++E ++R A     ++S N+LILKFP   E L+  +
Sbjct  1    MGGVVGKSESYRKFSIHETKLEAKMVEAMQRRAAKGSVMKSFNSLILKFPKIDESLRNCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNG ID+EE+KKC  KL+    +EEI +LF +CD++++  IKFNEFIVL+C
Sbjct  61   AIFEQFDEDSNGMIDQEEMKKCFSKLEVSFTDEEIIDLFEACDINEDMGIKFNEFIVLIC  120

Query  510  LIYLLMDAPSSGSTS-KIGSP  569
            L++LL D   +  T  ++G P
Sbjct  121  LVHLLKDDNKAVHTKLQLGMP  141



>ref|XP_003628953.1| hypothetical protein MTR_8g070510 [Medicago truncatula]
Length=203

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = +3

Query  234  VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF  413
            ++R      S++S N +ILKFP   E  ++ R +FEQFDEDSNG ID+EELKKC  KL+ 
Sbjct  5    MQRRECQGCSMKSFNTIILKFPKIDESFRKCRAIFEQFDEDSNGTIDQEELKKCFSKLEI  64

Query  414  HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSP  569
               EEE ++LF +CD++D+  +KF+EFIVLLCL+YLL D P++  + S+IG P
Sbjct  65   SFSEEETNDLFEACDINDDLGMKFSEFIVLLCLVYLLKDDPAALHAKSRIGMP  117



>ref|XP_010233984.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Brachypodium distachyon]
Length=226

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 89/131 (68%), Gaps = 7/131 (5%)
 Frame = +3

Query  174  HGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFD  350
            HGSP       SKLE K++E +++ A    +++S N++I+KFP   E L++ R +F+QFD
Sbjct  13   HGSPA------SKLEQKMVEAMQQRAQQGTTMKSFNSVIMKFPKIDESLRKCRIIFQQFD  66

Query  351  EDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD  530
            EDSNG ID+EELK C QKL     +EEI +LF +CD+ ++  +KFNEFIV LCL+YLL D
Sbjct  67   EDSNGEIDQEELKHCFQKLDISFTDEEIKDLFEACDIYEHMGMKFNEFIVFLCLVYLLND  126

Query  531  APSSGSTSKIG  563
               S +  ++G
Sbjct  127  PAVSEARKRMG  137



>ref|NP_001132390.1| uncharacterized protein LOC100193836 [Zea mays]
 gb|ACF81210.1| unknown [Zea mays]
 gb|ACG46514.1| calcium ion binding protein [Zea mays]
 gb|AFW87516.1| calcium ion binding protein [Zea mays]
Length=226

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 97/138 (70%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G++L  H + +K S   SKLE K+++ +++ A    S++S +++I+KFP   E  ++ +
Sbjct  1    MGAVLGRHDT-HKRSSHGSKLEVKMVDAMQQRASHGTSLKSFDSIIMKFPKIDESFRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            T+FEQFDEDSNG ID+EELK C QKL+    EEEI +LF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKEELKHCFQKLEISFTEEEICDLFEACDINEDMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            L+YLL +A    +  K+G
Sbjct  120  LVYLLNEAAVLEAKIKMG  137



>gb|EEC78513.1| hypothetical protein OsI_18448 [Oryza sativa Indica Group]
 gb|EEE62320.1| hypothetical protein OsJ_17109 [Oryza sativa Japonica Group]
Length=231

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 2/129 (2%)
 Frame = +3

Query  189  KYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSN  362
            KY R++  L+ KV E   +R      + RS+N++ +  P F+EGL+ IR VF+Q+DEDSN
Sbjct  13   KYRRVEKDLDKKVAEALKERTKSKKKTFRSVNSITMGLPRFKEGLRNIRDVFDQYDEDSN  72

Query  363  GAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS  542
            G ID EEL+ CL KLQ  + EEEID + R CD+D+ + I+F EF+V LCL+YLL  +  +
Sbjct  73   GTIDNEELRNCLNKLQVQMSEEEIDNIHRYCDIDNRKGIQFPEFVVFLCLMYLLFGSDVT  132

Query  543  GSTSKIGSP  569
               S+  S 
Sbjct  133  YRVSEFESA  141



>ref|XP_010676135.1| PREDICTED: probable calcium-binding protein CML21 [Beta vulgaris 
subsp. vulgaris]
Length=230

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 91/141 (65%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G  L    SP +    ++KLE K++E ++  A     ++S N +ILKFP   +  ++ +
Sbjct  2    MGGALGVPESPKRGYLPETKLEAKMVEAMQERASKGTVMKSFNTIILKFPKIDQSFRKCK  61

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FE+FDED N  ID  ELK C +KL+    EEE+D+ F++CD+++N  +KFNEFIVLLC
Sbjct  62   AIFEEFDEDKNEVIDHNELKHCFRKLEISFTEEEVDDFFKACDINENMGMKFNEFIVLLC  121

Query  510  LIYLLM-DAPSSGSTSKIGSP  569
            L+YLL  D P +G  S++G P
Sbjct  122  LVYLLQEDQPKTGVKSRMGLP  142



>ref|XP_008384627.1| PREDICTED: probable calcium-binding protein CML21 [Malus domestica]
 ref|XP_008384628.1| PREDICTED: probable calcium-binding protein CML21 [Malus domestica]
Length=227

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 95/141 (67%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSI-RSINALILKFPHFREGLKEIR  329
            +G+++    +  ++S  ++KLE K++E  +   A  SI +S N LILKFP   E  +  +
Sbjct  1    MGAVVGKSENARRFSIHETKLEAKMVEAMQRRAAKGSIMKSFNNLILKFPKIDESFRNCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNG ID+EE+KKC  KL+    +EEID+LF +CD++++  IKFNEFIVL+C
Sbjct  61   AIFEQFDEDSNGMIDQEEMKKCFYKLEVSFTDEEIDDLFEACDINEDMGIKFNEFIVLIC  120

Query  510  LIYLLMDAPSSGSTS-KIGSP  569
            L++LL D   +  T  ++G P
Sbjct  121  LVHLLKDDNKAVHTKLQLGLP  141



>ref|XP_008358900.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML21 [Malus domestica]
Length=227

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 95/141 (67%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSI-RSINALILKFPHFREGLKEIR  329
            +G+++    +  ++S  ++KLE K++E  +   A  SI +S N LILKFP   E  +  +
Sbjct  1    MGAVVGKSENARRFSIHETKLEAKMVEAMQRRAAKGSIMKSFNNLILKFPKIDESFRNCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNG ID+EE+KKC  KL+    +EEID+LF +CD++++  IKFNEFIVL+C
Sbjct  61   AIFEQFDEDSNGMIDQEEMKKCFYKLEVSFTDEEIDDLFEACDINEDMGIKFNEFIVLIC  120

Query  510  LIYLLMDAPSSGSTS-KIGSP  569
            L++LL D   +  T  ++G P
Sbjct  121  LVHLLKDDNKAVHTKLQLGLP  141



>ref|XP_009379121.1| PREDICTED: probable calcium-binding protein CML21 [Pyrus x bretschneideri]
 ref|XP_009379122.1| PREDICTED: probable calcium-binding protein CML21 [Pyrus x bretschneideri]
Length=227

 Score =   122 bits (307),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 90/127 (71%), Gaps = 1/127 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++    S  K+S  ++KLE K++E ++R A     ++S N+LILKFP   E L+  +
Sbjct  1    MGGVVGKSESSRKFSIHETKLEAKMVEAMQRRAAKGSVMKSFNSLILKFPKIDESLRNCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +FEQFDEDSNG ID+EE+KKC  KL+    +EEI +LF +CD++++  IKFNEFIVL+C
Sbjct  61   AIFEQFDEDSNGMIDQEEMKKCFSKLEVSFTDEEIIDLFEACDINEDMGIKFNEFIVLIC  120

Query  510  LIYLLMD  530
            L++LL D
Sbjct  121  LVHLLKD  127



>gb|AFW87515.1| hypothetical protein ZEAMMB73_336887 [Zea mays]
Length=165

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 96/138 (70%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G++L  H + +K S   SKLE K+++ +++ A    S++S +++I+KFP   E  ++ +
Sbjct  1    MGAVLGRHDT-HKRSSHGSKLEVKMVDAMQQRASHGTSLKSFDSIIMKFPKIDESFRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            T+FEQFDEDSNG ID+EELK C QKL+    EEEI +LF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKEELKHCFQKLEISFTEEEICDLFEACDINEDMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            L+YLL +A    + S I 
Sbjct  120  LVYLLNEAAVLEAVSFIS  137



>ref|NP_001046205.1| Os02g0198200 [Oryza sativa Japonica Group]
 dbj|BAD25460.1| calcium-binding EF hand-like protein [Oryza sativa Japonica Group]
 dbj|BAF08119.1| Os02g0198200 [Oryza sativa Japonica Group]
 dbj|BAG86728.1| unnamed protein product [Oryza sativa Japonica Group]
Length=228

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 94/138 (68%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++    SP +++   SKLE K++E +++ A    S++S N++I+KFP   E L+  R
Sbjct  1    MGGIVGRGDSP-RHTSPASKLERKMVEAMQQRAQKGTSVKSFNSVIMKFPKIDESLRNCR  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +F+QFDEDSNG ID++ELK C QKL     +EEI +LF++CD+ +N  +KFNEFIV LC
Sbjct  60   IIFQQFDEDSNGEIDQQELKHCFQKLDISFTDEEIKDLFQACDIYENMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            L+YLL D   S +  ++G
Sbjct  120  LVYLLNDPLVSEARKRMG  137



>ref|XP_003571276.1| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Brachypodium distachyon]
Length=265

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 89/131 (68%), Gaps = 7/131 (5%)
 Frame = +3

Query  174  HGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFD  350
            HGSP       SKLE K++E +++ A    +++S N++I+KFP   E L++ R +F+QFD
Sbjct  52   HGSPA------SKLEQKMVEAMQQRAQQGTTMKSFNSVIMKFPKIDESLRKCRIIFQQFD  105

Query  351  EDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD  530
            EDSNG ID+EELK C QKL     +EEI +LF +CD+ ++  +KFNEFIV LCL+YLL D
Sbjct  106  EDSNGEIDQEELKHCFQKLDISFTDEEIKDLFEACDIYEHMGMKFNEFIVFLCLVYLLND  165

Query  531  APSSGSTSKIG  563
               S +  ++G
Sbjct  166  PAVSEARKRMG  176



>gb|EEC72684.1| hypothetical protein OsI_06250 [Oryza sativa Indica Group]
Length=228

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 94/138 (68%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++    SP +++   SKLE K++E +++ A    S++S N++I+KFP   E L+  R
Sbjct  1    MGGVVGRGDSP-RHTSPASKLERKMVEAMQQRAQKGTSVKSFNSVIMKFPKIDESLRNCR  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +F+QFDEDSNG ID++ELK C QKL     +EEI +LF++CD+ +N  +KFNEFIV LC
Sbjct  60   IIFQQFDEDSNGEIDQQELKHCFQKLDISFTDEEIKDLFQACDIYENMGMKFNEFIVFLC  119

Query  510  LIYLLMDAPSSGSTSKIG  563
            L+YLL D   S +  ++G
Sbjct  120  LVYLLNDPLVSEARKRMG  137



>ref|NP_001078450.1| putative calcium-binding protein CML21 [Arabidopsis thaliana]
 dbj|BAE99871.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85205.1| putative calcium-binding protein CML21 [Arabidopsis thaliana]
Length=211

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E V+R A    +++S N+++LKFP   +GL+  + +F++FDEDSNG+ID  
Sbjct  18   ETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHT  77

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS  542
            ELK C++KL+    EEEI++LF++CD++++  I F EFIVLLCL+YLL D  S+
Sbjct  78   ELKNCIRKLEISFDEEEINDLFKACDINEDMGITFTEFIVLLCLVYLLKDDSST  131



>emb|CDP13649.1| unnamed protein product [Coffea canephora]
Length=229

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 97/141 (69%), Gaps = 3/141 (2%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVL-EVKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G +L    SP  Y   ++KLE K++  ++R      S +S N++ILKFP   E L++ +
Sbjct  1    MGGVLQKGESPKAYLP-ETKLEAKIIGAMQRRESEGSSAKSFNSIILKFPKIDENLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +F++FD D NGAID +ELK+C +KL+    +EEI++LF +CD++D+  +KFNEFIVLLC
Sbjct  60   AIFQEFDMDGNGAIDPQELKQCFRKLEISFSDEEINDLFEACDINDDMGMKFNEFIVLLC  119

Query  510  LIYLLMDAPSS-GSTSKIGSP  569
            L+YLL + P++  + S+IG P
Sbjct  120  LVYLLKNDPAAEHAKSRIGLP  140



>gb|EMT21140.1| Putative calcium-binding protein CML21 [Aegilops tauschii]
Length=226

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 87/130 (67%), Gaps = 1/130 (1%)
 Frame = +3

Query  177  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  353
            G   +YS   +KLE K+++ +++ A    S+RS N++I+KFP   E L+  R +F+QFDE
Sbjct  8    GDTPRYSSAATKLEQKMVDAMQQRAQQGTSLRSFNSVIMKFPKIDESLRNCRIIFQQFDE  67

Query  354  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  533
            DSNG ID+ ELK C QKL     +EEI +LF +CD+ ++  +KFNEFIV LCL+YLL D 
Sbjct  68   DSNGEIDQLELKHCFQKLDISFTDEEIKDLFEACDIYEHMGMKFNEFIVFLCLVYLLNDP  127

Query  534  PSSGSTSKIG  563
              S +  ++G
Sbjct  128  AVSEARKRMG  137



>ref|XP_002869609.1| calcium ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45868.1| calcium ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E V+R A    +++S N+++LKFP   +GL+  + +F++FDEDSNG+ID  
Sbjct  18   ETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHT  77

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS  542
            ELK C++KL+    EEEI++LF++CD++++  I F EFIVLLCL+YLL D  S+
Sbjct  78   ELKNCIKKLEISFDEEEINDLFKACDINEDMGITFTEFIVLLCLVYLLKDDSST  131



>ref|XP_008778084.1| PREDICTED: probable calcium-binding protein CML22 [Phoenix dactylifera]
Length=227

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +3

Query  207  SKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            S L  K++E   +R+A      RS+N++I++FPHF++GL  I+ VFEQ+DEDSNG IDRE
Sbjct  18   SLLREKLIEAIKQRSASRKQPFRSMNSIIMRFPHFKDGLGNIKDVFEQYDEDSNGTIDRE  77

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSK  557
            ELKKCL  LQ H+ EEEI+ L+  CDVD NE ++FNEFI+LLCLIYLLM+ A ++ +  +
Sbjct  78   ELKKCLSTLQVHLTEEEINGLYHYCDVDGNEGMQFNEFIILLCLIYLLMEPASATDNMPR  137

Query  558  IGSP  569
            IGSP
Sbjct  138  IGSP  141



>ref|XP_002451725.1| hypothetical protein SORBIDRAFT_04g006670 [Sorghum bicolor]
 gb|EES04701.1| hypothetical protein SORBIDRAFT_04g006670 [Sorghum bicolor]
Length=228

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +3

Query  177  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  353
            G   ++S   SKLE K++E +K+ A    S++S N++I+KFP   E L+  RT+F+QFDE
Sbjct  7    GDSPRHSSPASKLEKKMVEAMKQRALKGTSMKSFNSVIMKFPKIDENLRNCRTIFQQFDE  66

Query  354  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  533
            DSNG ID+ ELK C QKL     +EEI  LF++CD+ ++  +KFNEFIV LCL+YLL D 
Sbjct  67   DSNGEIDQLELKHCFQKLGIESTDEEIKALFQACDIYEHMGMKFNEFIVFLCLVYLLNDP  126

Query  534  PSSGSTSKIG  563
              S +  ++G
Sbjct  127  AVSEARKRMG  136



>ref|XP_004965909.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X1 [Setaria italica]
 ref|XP_004965910.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X2 [Setaria italica]
Length=224

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 88/128 (69%), Gaps = 1/128 (1%)
 Frame = +3

Query  183  PNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDS  359
              K S   SKLE K+++ +++ A    S++S + +++KFP   E  ++ +T+FEQFDEDS
Sbjct  10   TQKRSFHGSKLEAKMVDAMQQRASHGTSLKSFDGIVMKFPRIDESFRKCKTIFEQFDEDS  69

Query  360  NGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS  539
            NG ID+EELK C QKL+    EEEI +LF +CD++++  +KFNEFIV LCL+YLL +   
Sbjct  70   NGEIDKEELKHCFQKLEISFTEEEISDLFEACDINEDMGMKFNEFIVFLCLVYLLNEPAV  129

Query  540  SGSTSKIG  563
            S +  K+G
Sbjct  130  SEAKIKMG  137



>ref|NP_194377.2| putative calcium-binding protein CML21 [Arabidopsis thaliana]
 sp|Q52K82.1|CML21_ARATH RecName: Full=Probable calcium-binding protein CML21; AltName: 
Full=Calmodulin-like protein 21 [Arabidopsis thaliana]
 gb|AAY17423.1| At4g26470 [Arabidopsis thaliana]
 gb|AEE85204.1| putative calcium-binding protein CML21 [Arabidopsis thaliana]
Length=231

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E V+R A    +++S N+++LKFP   +GL+  + +F++FDEDSNG+ID  
Sbjct  18   ETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHT  77

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS  542
            ELK C++KL+    EEEI++LF++CD++++  I F EFIVLLCL+YLL D  S+
Sbjct  78   ELKNCIRKLEISFDEEEINDLFKACDINEDMGITFTEFIVLLCLVYLLKDDSST  131



>gb|EYU33744.1| hypothetical protein MIMGU_mgv1a013136mg [Erythranthe guttata]
Length=229

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 93/129 (72%), Gaps = 2/129 (2%)
 Frame = +3

Query  189  KYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNG  365
            K S  ++KLE+K++E V+R      S++S N++ILKFP   E  ++ +T F+++DED NG
Sbjct  12   KSSLQETKLESKIIEAVQRRELKGSSMKSFNSIILKFPKIDESFRKCKTTFDEYDEDKNG  71

Query  366  AIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-  542
             ID +ELK C +KL+    EEEI++LF++CD++++  +KFNEFIVL+CL+YLL + PS  
Sbjct  72   TIDLQELKHCFRKLEISFTEEEINDLFQACDINEDMTMKFNEFIVLICLVYLLKEDPSDK  131

Query  543  GSTSKIGSP  569
             + S++G P
Sbjct  132  DAKSQMGMP  140



>ref|XP_011097697.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011097698.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011097699.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
Length=229

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = +3

Query  204  DSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDR  377
            ++KLE K++E   KR A  + S++S N++ILKFP   E  ++ +T FE+FDED NG+I+ 
Sbjct  17   ETKLEAKIIEAVRKREAQGS-SMKSFNSIILKFPKIDESFRKCKTTFEEFDEDGNGSIEP  75

Query  378  EELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTS  554
            +ELK C +KL+    +EEID+LF +CD++++ +IKFNEFIVLLCL+YLL + P++    S
Sbjct  76   QELKHCFRKLEIKFTDEEIDDLFEACDINEDMRIKFNEFIVLLCLVYLLKEYPTAEQDKS  135

Query  555  KIGSP  569
            + G P
Sbjct  136  QRGMP  140



>ref|XP_004294881.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461556.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461557.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461558.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461559.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461561.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461562.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461563.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461564.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461565.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461566.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461567.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461568.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
Length=228

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 95/141 (67%), Gaps = 2/141 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G+++    SP   S  ++KLE K++E ++R A     ++S N++ILKFP   E L+  +
Sbjct  1    MGAVVGKAESPRSLSISETKLEAKMVEAMQRRAAKGSVMKSFNSIILKFPKIDESLRNCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +F+QFDEDSNGAID +ELK+   KL+    +EEID+LF +CD++++  I FNEFIVL+C
Sbjct  61   DIFQQFDEDSNGAIDHDELKRAFSKLEVSFTDEEIDDLFAACDINEDMGINFNEFIVLIC  120

Query  510  LIYLLMDAPSSGSTS-KIGSP  569
            +++LL D  ++G     +G P
Sbjct  121  VVFLLKDDQNAGEKKVDMGMP  141



>ref|XP_006285834.1| hypothetical protein CARUB_v10007314mg [Capsella rubella]
 gb|EOA18732.1| hypothetical protein CARUB_v10007314mg [Capsella rubella]
Length=233

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 92/131 (70%), Gaps = 1/131 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G+ +    S  K    ++KLE K++E V+R A    +++S N+++LKFP   EGL+  +
Sbjct  1    MGAAVTKSESLQKEWVPETKLEAKIIEAVQRRATRGTAMKSFNSIVLKFPKIDEGLRNCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +F++FDEDSNG+ID  ELK C++KL+    E+EI++LF++CD++++  I F EFIVLLC
Sbjct  61   AIFQEFDEDSNGSIDHTELKNCIRKLEISFEEDEINDLFKACDINEDMGITFTEFIVLLC  120

Query  510  LIYLLMDAPSS  542
            L+YLL D  S+
Sbjct  121  LVYLLKDDSST  131



>ref|XP_008449066.1| PREDICTED: probable calcium-binding protein CML21 [Cucumis melo]
Length=224

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 2/124 (2%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E ++R A     IRS + ++LKFP   + L+  +T+F+QFDED NG IDR 
Sbjct  17   ETKLEAKMVETMRRRATKGSIIRSFDCILLKFPKIDDSLRNCKTIFQQFDEDLNGIIDRR  76

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  557
            ELKKC   L+  + EEEID+LF +CD+     IKFNEFIVLLCL+YLL D P +  S S+
Sbjct  77   ELKKCFDGLEILLTEEEIDDLFEACDISAAMGIKFNEFIVLLCLVYLLKDDPDAVFSKSQ  136

Query  558  IGSP  569
             G P
Sbjct  137  FGMP  140



>ref|XP_010327214.1| PREDICTED: probable calcium-binding protein CML21 [Solanum lycopersicum]
Length=230

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 98/143 (69%), Gaps = 4/143 (3%)
 Frame = +3

Query  153  VGSLLCCHGSPN--KYSRLDSKLETKVLEVK-RNAPATLSIRSINALILKFPHFREGLKE  323
            +G +L  + SP+  K S  ++KLE K+ E   R      SIRS ++L+LKFP   E L++
Sbjct  1    MGGVLGKNESPSSPKASVPETKLEAKITEAMLRRETEGSSIRSFDSLVLKFPKIDENLRK  60

Query  324  IRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVL  503
             + +F++FDEDSNGAID +ELK    KL+ +  +EEI +LF +CD++++  I+F+EFIVL
Sbjct  61   CKVIFQEFDEDSNGAIDPQELKHAFNKLEINFTDEEISDLFEACDINEDMGIEFSEFIVL  120

Query  504  LCLIYLLMDAPSS-GSTSKIGSP  569
            LCL+YLL D PS+  + S++G P
Sbjct  121  LCLVYLLKDDPSALHAKSRMGLP  143



>emb|CAA18223.1| putative protein [Arabidopsis thaliana]
 emb|CAB79502.1| putative protein [Arabidopsis thaliana]
Length=248

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E V+R A    +++S N+++LKFP   +GL+  + +F++FDEDSNG+ID  
Sbjct  18   ETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHT  77

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS  542
            ELK C++KL+    EEEI++LF++CD++++  I F EFIVLLCL+YLL D  S+
Sbjct  78   ELKNCIRKLEISFDEEEINDLFKACDINEDMGITFTEFIVLLCLVYLLKDDSST  131



>ref|XP_004149571.1| PREDICTED: probable calcium-binding protein CML21-like [Cucumis 
sativus]
 ref|XP_004170177.1| PREDICTED: probable calcium-binding protein CML21-like [Cucumis 
sativus]
 gb|KGN56046.1| hypothetical protein Csa_3G061000 [Cucumis sativus]
Length=229

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 86/124 (69%), Gaps = 2/124 (2%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E +K+ A     IRS + +ILKFP   + L+  +T+F+QFDED NG IDR 
Sbjct  17   ETKLEAKMVETMKQRATKGSIIRSFDCIILKFPKIDDSLRNCKTIFQQFDEDLNGIIDRR  76

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  557
            ELKKC   L+  + EEEID+LF +CD+     +KFNEFIVLLCL+YLL D P++  S S+
Sbjct  77   ELKKCFDGLEILLTEEEIDDLFDACDISTAMGMKFNEFIVLLCLVYLLKDDPNAVFSKSQ  136

Query  558  IGSP  569
             G P
Sbjct  137  FGMP  140



>ref|XP_006352556.1| PREDICTED: probable calcium-binding protein CML21-like [Solanum 
tuberosum]
Length=237

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 98/143 (69%), Gaps = 4/143 (3%)
 Frame = +3

Query  153  VGSLLCCHGSPN--KYSRLDSKLETKVLEVK-RNAPATLSIRSINALILKFPHFREGLKE  323
            +G +L  + SP+  K S  ++KLE K+ E   R      SIRS ++L+LKFP   E L++
Sbjct  1    MGGVLGKNESPSSPKASVPETKLEAKITEAMLRRETEGSSIRSFDSLVLKFPKIDENLRK  60

Query  324  IRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVL  503
             + +F++FDEDSNGAID +ELK    KL+ +  +EEI +LF +CD++++  I+F+EFIVL
Sbjct  61   CKVIFQEFDEDSNGAIDPQELKHAFNKLEINFTDEEISDLFEACDINEDMGIEFSEFIVL  120

Query  504  LCLIYLLMDAPSS-GSTSKIGSP  569
            LCL+YLL D PS+  + S++G P
Sbjct  121  LCLVYLLKDDPSALHAKSRMGLP  143



>ref|XP_009142368.1| PREDICTED: probable calcium-binding protein CML21 [Brassica rapa]
 emb|CDY66743.1| BnaAnng22830D [Brassica napus]
Length=225

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E V+R A    +++S N+++LKFP   EGL+  + +F++FDEDSNG+ID  
Sbjct  12   ETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDEGLRNCKAIFQEFDEDSNGSIDHT  71

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  557
            ELK C +KL+    E+EI++LF +CD++++  I F EFIVLLCL+YLL D  S+     +
Sbjct  72   ELKNCFRKLEISFEEDEINDLFEACDINEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWR  131

Query  558  IGSP  569
            +G P
Sbjct  132  LGMP  135



>ref|XP_006413177.1| hypothetical protein EUTSA_v10026168mg [Eutrema salsugineum]
 gb|ESQ54630.1| hypothetical protein EUTSA_v10026168mg [Eutrema salsugineum]
Length=226

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 87/124 (70%), Gaps = 2/124 (2%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E V+R A    + +S N+++LKFP   +GL+  + +F++FDEDSNG+ID  
Sbjct  18   ETKLEAKIIEAVRRRASRGTTTKSFNSIVLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHT  77

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  557
            ELK C +KL+    EEEI++LF +CD++++  I F EFIVLLCL+YLL D  S+     +
Sbjct  78   ELKNCFRKLEISFDEEEINDLFEACDINEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWR  137

Query  558  IGSP  569
            +G P
Sbjct  138  LGMP  141



>ref|XP_011095629.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095630.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095632.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095633.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095634.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095635.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095636.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
Length=229

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 96/139 (69%), Gaps = 3/139 (2%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++  + SP K +  ++KLE ++ E ++R      +I+S N++ILKFP     L++ +
Sbjct  1    MGGVIGKNESP-KAAVSETKLEARINEAIRRREVEGSTIKSFNSIILKFPKIDRSLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
              FE FDED NGAIDREELK C  KL+    +EE+++LF +CD++++  +KFNEFIVLLC
Sbjct  60   ATFEDFDEDGNGAIDREELKHCFHKLEISFTDEEVNDLFEACDINEDMGMKFNEFIVLLC  119

Query  510  LIYLLMDAPSS-GSTSKIG  563
            L+YLL + P++  + S++G
Sbjct  120  LVYLLKEDPAAEHAKSRMG  138



>ref|NP_001148425.1| calcium ion binding protein [Zea mays]
 gb|ACG31429.1| calcium ion binding protein [Zea mays]
Length=225

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 89/130 (68%), Gaps = 1/130 (1%)
 Frame = +3

Query  177  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  353
            G   +++   SKLE K++E +++ A    S++S+N++I+KFP   E L++ RT+F+QFDE
Sbjct  7    GDSPRHTSSASKLEKKMVEAMQQRALKGTSVKSLNSVIMKFPKIDESLRKCRTIFQQFDE  66

Query  354  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  533
            DSNG ID+ ELK C Q L     ++EI +LF++CD+ +N  +KFNEFIV LCL+YLL D 
Sbjct  67   DSNGEIDQLELKHCFQNLGIESTDQEIKDLFQACDIYENMGMKFNEFIVFLCLVYLLDDP  126

Query  534  PSSGSTSKIG  563
              S    ++G
Sbjct  127  AVSEVRKRMG  136



>ref|XP_004951561.1| PREDICTED: probable calcium-binding protein CML21-like [Setaria 
italica]
Length=226

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +3

Query  177  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  353
            G   + S   +KLE K++E +++ A    S++S N++I+KFP   E L+  RT+F+QFDE
Sbjct  7    GDSPRNSSPATKLERKMVEAMQQRALKGTSVKSFNSVIMKFPKIDESLRNCRTIFQQFDE  66

Query  354  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  533
            DSNG ID++ELK C QKL     ++EI +LF +CD+ ++  +KFNEFIV LCL+YLL D 
Sbjct  67   DSNGEIDQQELKHCFQKLGIESTDDEIKDLFEACDIYEHMGMKFNEFIVFLCLVYLLNDP  126

Query  534  PSSGSTSKIG  563
              S +  ++G
Sbjct  127  AVSEARKRMG  136



>gb|AFW66169.1| calcium ion binding protein [Zea mays]
Length=225

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 89/130 (68%), Gaps = 1/130 (1%)
 Frame = +3

Query  177  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  353
            G   +++   SKLE K++E +++ A    S++S+N++I+KFP   E L++ RT+F+QFDE
Sbjct  7    GDSPRHTSPASKLEKKMVEAMQQRALKGTSVKSLNSVIMKFPKIDESLRKCRTIFQQFDE  66

Query  354  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  533
            DSNG ID+ ELK C Q L     ++EI +LF++CD+ +N  +KFNEFIV LCL+YLL D 
Sbjct  67   DSNGEIDQLELKHCFQNLGIESTDQEIKDLFQACDIYENMGMKFNEFIVFLCLVYLLDDP  126

Query  534  PSSGSTSKIG  563
              S    ++G
Sbjct  127  AVSEVRKRMG  136



>dbj|BAK07400.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 87/130 (67%), Gaps = 1/130 (1%)
 Frame = +3

Query  177  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  353
            G   +YS   +KLE K+++ +++ A    S++S N++I+KFP   E L+  R +F+QFDE
Sbjct  8    GDTPRYSSAATKLEQKMVDAMQQRAQQGTSLKSFNSVIMKFPKIDENLRNCRIIFQQFDE  67

Query  354  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  533
            DSNG ID+ EL+ C QKL     +EEI +LF +CD+ ++  +KFNEFIV LCL+YLL D 
Sbjct  68   DSNGEIDQLELEHCFQKLDISFTDEEIKDLFEACDIYEHMGMKFNEFIVFLCLVYLLNDP  127

Query  534  PSSGSTSKIG  563
              S +  ++G
Sbjct  128  AVSEARKRMG  137



>ref|XP_010448264.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
 ref|XP_010448265.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
Length=232

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++    S  K    ++KLE K++E V+R A    +++S N+++LKFP    GL+  +
Sbjct  1    MGGVVTKSESLEKEWVPETKLEAKIIEAVQRRATKGTTMKSFNSIVLKFPKIDVGLRNCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +F++FDEDSNG+ID  ELK C++KL+    E+EI++LF++CD++++  I F EFIVLLC
Sbjct  61   AIFQEFDEDSNGSIDHTELKNCIRKLEISFEEDEINDLFKACDINEDMGITFTEFIVLLC  120

Query  510  LIYLLMDAPSS  542
            L+YLL D  S+
Sbjct  121  LVYLLKDDSST  131



>ref|XP_010433497.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
Length=231

 Score =   118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G ++    S  K    ++KLE K++E V+R A    +++S N+++LKFP    GL+  +
Sbjct  1    MGGVVTKSESLEKEWVPETKLEAKIIEAVQRRATRGTTMKSFNSIVLKFPKIDVGLRNCK  60

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +F++FDEDSNG+ID  ELK C++KL+    E+EI++LF++CD++++  I F EFIVLLC
Sbjct  61   AIFQEFDEDSNGSIDHTELKNCIRKLEISFEEDEINDLFKACDINEDMGITFTEFIVLLC  120

Query  510  LIYLLMDAPSS  542
            L+YLL D  S+
Sbjct  121  LVYLLKDDSST  131



>ref|XP_010438747.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
 ref|XP_010438748.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
Length=233

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E V+R A    +++S N+++LKFP    GL+  + +F++FDEDSNG+ID  
Sbjct  18   ETKLEAKIIEAVQRRATRGTTMKSFNSIVLKFPKIDVGLRNCKAIFQEFDEDSNGSIDHT  77

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS  542
            ELK C++KL+    E+EI++LF++CD++++  I F EFIVLLCL+YLL D  S+
Sbjct  78   ELKNCIRKLEISFEEDEINDLFKACDINEDMGITFTEFIVLLCLVYLLKDDSST  131



>ref|XP_006654041.1| PREDICTED: probable calcium-binding protein CML22-like [Oryza 
brachyantha]
Length=229

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 82/132 (62%), Gaps = 2/132 (2%)
 Frame = +3

Query  180  SPNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  353
            +P KY R+   L+ KV E   +R      + RS+N++ +  P F+EGL  IR VF+Q+DE
Sbjct  10   APIKYRRIQKDLDKKVAEALKERTKAKKKTFRSVNSITMGLPRFKEGLNNIRDVFDQYDE  69

Query  354  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  533
            DSNG ID +EL+ CL +L   + EEE+D + R CD+D+ + I+F EF V LCL+YLL  +
Sbjct  70   DSNGTIDNDELRNCLNELHVQLSEEEVDNIHRYCDIDNRKGIQFQEFAVFLCLMYLLFGS  129

Query  534  PSSGSTSKIGSP  569
              +   S+  S 
Sbjct  130  DVTRRISEFESA  141



>ref|XP_009608207.1| PREDICTED: probable calcium-binding protein CML21 [Nicotiana 
tomentosiformis]
 ref|XP_009608208.1| PREDICTED: probable calcium-binding protein CML21 [Nicotiana 
tomentosiformis]
Length=227

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 99/141 (70%), Gaps = 3/141 (2%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G +L  + SP + S  ++KLE K+ E ++R      SI+S ++++LKFP   E L++ +
Sbjct  1    MGGVLGKNESP-RASVPETKLEAKITEAMQRRETEGSSIKSFDSIVLKFPKIDENLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +F++FDEDSNGAID +ELK    KL+ +  +EEI +LF +CD++++  I+F+EFIVLLC
Sbjct  60   VIFQEFDEDSNGAIDPQELKHAFGKLEINFTDEEISDLFEACDINEDMGIEFSEFIVLLC  119

Query  510  LIYLLMDAPSS-GSTSKIGSP  569
            L+YLL D P++  + S++G P
Sbjct  120  LVYLLKDDPTALHAKSRMGLP  140



>ref|XP_009776689.1| PREDICTED: probable calcium-binding protein CML21 [Nicotiana 
sylvestris]
 ref|XP_009776690.1| PREDICTED: probable calcium-binding protein CML21 [Nicotiana 
sylvestris]
Length=227

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 99/141 (70%), Gaps = 3/141 (2%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G +L  + SP + S  ++KLE K+ E ++R      SI+S ++++LKFP   E L++ +
Sbjct  1    MGGVLGKNESP-RASVPETKLEAKITEAMQRRETEGSSIKSFDSIVLKFPKIDENLRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             +F++FDEDSNGAID +ELK    KL+ +  +EEI +LF +CD++++  I+F+EFIVLLC
Sbjct  60   VIFQEFDEDSNGAIDPQELKHAFGKLEINFTDEEISDLFEACDINEDMGIEFSEFIVLLC  119

Query  510  LIYLLMDAPSS-GSTSKIGSP  569
            L+YLL D P++  + S++G P
Sbjct  120  LVYLLKDDPTALHAKSRMGLP  140



>ref|NP_001131792.1| calcium ion binding protein [Zea mays]
 gb|ACF80358.1| unknown [Zea mays]
 gb|ACG38606.1| calcium ion binding protein [Zea mays]
 gb|AFW70731.1| calcium ion binding protein [Zea mays]
Length=227

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +3

Query  177  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  353
            G   ++S   SKLE K+++ +++ A    S++S N++I+KFP   E L+  RT+F++FDE
Sbjct  7    GDSPRHSSPASKLEKKMVDAMQQRALKGTSVKSFNSVIMKFPKIDESLRNCRTIFQEFDE  66

Query  354  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  533
            DSNG ID+ ELK+C Q L     +EEI +LF +CD+ ++  +KFNEFIV LCL+YLL D 
Sbjct  67   DSNGEIDQLELKRCFQNLGIESTDEEIKDLFEACDIYEHMGMKFNEFIVFLCLVYLLNDP  126

Query  534  PSSGSTSKIG  563
              S +  ++G
Sbjct  127  AVSEARKRMG  136



>ref|XP_010231716.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Brachypodium distachyon]
 ref|XP_010231717.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Brachypodium distachyon]
 ref|XP_010231718.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Brachypodium distachyon]
Length=230

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 84/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEI  326
            +G       +P K  R++  L+ KV+E   +R      + +S+N++ ++ P F++GL++I
Sbjct  1    MGGAASRLATPIKQRRVEKDLDNKVVEALRERARARKKTFKSVNSITMRLPRFKDGLRDI  60

Query  327  RTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLL  506
            R VF+ +D DSNG ID EEL+ C+ KLQ  + E+E+D++ R CDV+  + I+F EF+VLL
Sbjct  61   RDVFDHYDVDSNGTIDNEELRSCMSKLQVQMSEKEVDDVHRYCDVNSRKGIQFQEFVVLL  120

Query  507  CLIYLL  524
            CL+YLL
Sbjct  121  CLMYLL  126



>ref|XP_003568950.2| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Brachypodium distachyon]
Length=244

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 84/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEI  326
            +G       +P K  R++  L+ KV+E   +R      + +S+N++ ++ P F++GL++I
Sbjct  15   MGGAASRLATPIKQRRVEKDLDNKVVEALRERARARKKTFKSVNSITMRLPRFKDGLRDI  74

Query  327  RTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLL  506
            R VF+ +D DSNG ID EEL+ C+ KLQ  + E+E+D++ R CDV+  + I+F EF+VLL
Sbjct  75   RDVFDHYDVDSNGTIDNEELRSCMSKLQVQMSEKEVDDVHRYCDVNSRKGIQFQEFVVLL  134

Query  507  CLIYLL  524
            CL+YLL
Sbjct  135  CLMYLL  140



>gb|ABK22178.1| unknown [Picea sitchensis]
 gb|ACN39992.1| unknown [Picea sitchensis]
Length=224

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 85/123 (69%), Gaps = 2/123 (2%)
 Frame = +3

Query  207  SKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            SKLE K++E   K+      +++S N++I+KFP   E  + +R VF++FD+DS+G ID E
Sbjct  18   SKLELKMVEAMRKKATSGGSTLKSFNSIIMKFPKIDESFENVRDVFQKFDKDSSGTIDLE  77

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKI  560
            ELK+C ++LQ    +EEI EL + CD+D+++ I+F EFIVLLCL+Y+L +     S S+I
Sbjct  78   ELKECFRELQVSFTDEEITELHQICDMDESKGIEFKEFIVLLCLVYILWEPTDPNSKSRI  137

Query  561  GSP  569
            G P
Sbjct  138  GLP  140



>gb|ACR34117.1| unknown [Zea mays]
 gb|AFW87514.1| hypothetical protein ZEAMMB73_336887 [Zea mays]
Length=163

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 94/138 (68%), Gaps = 4/138 (3%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  329
            +G++L  H + +K S   SKLE K+++ +++ A    S++S +++I+KFP   E  ++ +
Sbjct  1    MGAVLGRHDT-HKRSSHGSKLEVKMVDAMQQRASHGTSLKSFDSIIMKFPKIDESFRKCK  59

Query  330  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            T+FEQFD  SNG ID+EELK C QKL+    EEEI +LF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFD--SNGEIDKEELKHCFQKLEISFTEEEICDLFEACDINEDMGMKFNEFIVFLC  117

Query  510  LIYLLMDAPSSGSTSKIG  563
            L+YLL +A    + S I 
Sbjct  118  LVYLLNEAAVLEAVSFIS  135



>ref|XP_004960294.1| PREDICTED: probable calcium-binding protein CML22-like [Setaria 
italica]
Length=262

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 89/138 (64%), Gaps = 9/138 (7%)
 Frame = +3

Query  117  RPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALIL  290
            RP  ++ +V+      +C    P K  R++  L+ KV     +R      + RS+N++ +
Sbjct  28   RPVAAMGIVAS-----MCME--PIKRRRVEKDLDDKVAAALRERARSRQRTFRSVNSITM  80

Query  291  KFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDN  470
            + P F++GL++I+ VF+Q+DE+S+G ID EEL++CL KLQ  + +EE D++ R CD+D  
Sbjct  81   RLPRFKDGLRDIKDVFDQYDENSDGTIDNEELRRCLGKLQVQMSDEEADDVHRYCDIDRR  140

Query  471  EKIKFNEFIVLLCLIYLL  524
              I+F EF+VLLCL+YLL
Sbjct  141  NGIQFQEFVVLLCLMYLL  158



>gb|EMS52340.1| putative calcium-binding protein CML22 [Triticum urartu]
Length=321

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 87/133 (65%), Gaps = 2/133 (2%)
 Frame = +3

Query  135  KLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFR  308
            K  ++++G       +P K+ R++ +L+ KV E   +R      + RS+N++ ++ P F+
Sbjct  85   KRKNEEMGGAASRLAAPIKHRRVERELDNKVAEALRERAKARKKTFRSVNSITMRLPRFK  144

Query  309  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  488
            +GLK+IR VF  +D DSNG ID EEL+ CL KL+  + E+E D++ R CDVD  + I+F 
Sbjct  145  DGLKDIRDVFALYDTDSNGTIDNEELRSCLSKLEVRMSEKEADDVHRYCDVDSRKGIQFQ  204

Query  489  EFIVLLCLIYLLM  527
            EF+VL+CL+YLL 
Sbjct  205  EFVVLICLMYLLF  217



>ref|XP_002447440.1| hypothetical protein SORBIDRAFT_06g001080 [Sorghum bicolor]
 gb|EES11768.1| hypothetical protein SORBIDRAFT_06g001080 [Sorghum bicolor]
Length=230

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = +3

Query  183  PNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDED  356
            P K  R++  L+ KV +   +R      + RS+N++ ++ P F+EGL++I+ +F+Q+DED
Sbjct  11   PIKRRRVEKDLDDKVADALQERTRSRQRTFRSVNSITMRLPRFKEGLRDIKEIFDQYDED  70

Query  357  SNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLL  524
            SNG ID EEL+  L KLQ  + ++EID L   CD+D    I+F EF+VLLCL+YLL
Sbjct  71   SNGTIDNEELQSFLSKLQVKMSQQEIDNLHSYCDIDSRNGIQFQEFVVLLCLMYLL  126



>gb|KHN01846.1| Putative calcium-binding protein CML22 [Glycine soja]
Length=193

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  234  VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF  413
            ++R       ++S++++++ FP F+E LK +R +FEQ+DEDSNG+I+  ELKK L+ L+ 
Sbjct  1    MRRYKFGQSKLKSVDSVVMLFPMFKERLKTLRGMFEQYDEDSNGSIEPNELKKFLEHLEL  60

Query  414  HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSK  557
            H+ E+EI+ LF+ CD+D ++ I+FNEFIVLLCLI+LL +  SS  +SK
Sbjct  61   HLKEQEIEHLFQYCDLDGSKGIQFNEFIVLLCLIHLLAEPSSSDISSK  108



>gb|KJB63080.1| hypothetical protein B456_009G454500 [Gossypium raimondii]
Length=128

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = +3

Query  177  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  353
            G   K    ++KLE K++E ++  A    +I+S N++ILKFP     L++ + +FEQFDE
Sbjct  3    GVVGKSESPETKLEAKMVEAMQHRASKGTTIKSFNSIILKFPKIDHTLRKCKAIFEQFDE  62

Query  354  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEF  494
            DSNGAID EELKKCL KLQ    EEEI++LF++CD++++  IKFNEF
Sbjct  63   DSNGAIDHEELKKCLHKLQVCFTEEEIEDLFKACDMNEDMGIKFNEF  109



>gb|EMS67685.1| putative calcium-binding protein CML21 [Triticum urartu]
Length=313

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 85/136 (63%), Gaps = 8/136 (6%)
 Frame = +3

Query  177  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  353
            G   +YS   +KLE K+++ +++ A    S++S N++I+KFP   E L+  R +F+QF E
Sbjct  8    GDTPRYSSAATKLEQKMVDAMQQRAQQGTSVKSFNSVIMKFPKIDENLRNCRIIFQQFGE  67

Query  354  -------DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  512
                   DSNG ID+ ELK C QKL     +EEI +LF +CD+ ++  +KFNEFIV LCL
Sbjct  68   HYPPVYEDSNGEIDQLELKHCFQKLDISFTDEEIKDLFEACDIYEHMGMKFNEFIVFLCL  127

Query  513  IYLLMDAPSSGSTSKI  560
            +YLL D   S + S I
Sbjct  128  VYLLNDPAVSEAVSFI  143



>gb|KJB63081.1| hypothetical protein B456_009G454500 [Gossypium raimondii]
Length=165

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = +3

Query  177  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  353
            G   K    ++KLE K++E ++  A    +I+S N++ILKFP     L++ + +FEQFDE
Sbjct  3    GVVGKSESPETKLEAKMVEAMQHRASKGTTIKSFNSIILKFPKIDHTLRKCKAIFEQFDE  62

Query  354  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEF  494
            DSNGAID EELKKCL KLQ    EEEI++LF++CD++++  IKFNEF
Sbjct  63   DSNGAIDHEELKKCLHKLQVCFTEEEIEDLFKACDMNEDMGIKFNEF  109



>gb|KJB63079.1| hypothetical protein B456_009G454500 [Gossypium raimondii]
Length=220

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +3

Query  177  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  353
            G   K    ++KLE K++E ++  A    +I+S N++ILKFP     L++ + +FEQFDE
Sbjct  3    GVVGKSESPETKLEAKMVEAMQHRASKGTTIKSFNSIILKFPKIDHTLRKCKAIFEQFDE  62

Query  354  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-  530
            DSNGAID EELKKCL KLQ    EEEI++LF++CD++++  IKFNEF+VLLCL+YLL D 
Sbjct  63   DSNGAIDHEELKKCLHKLQVCFTEEEIEDLFKACDMNEDMGIKFNEFVVLLCLVYLLKDN  122

Query  531  APSSGSTSKIGSP  569
            A    + S++G P
Sbjct  123  ATEFEAKSRMGVP  135



>tpg|DAA38718.1| TPA: calcium ion binding protein [Zea mays]
Length=230

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = +3

Query  183  PNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDED  356
            P K  R++  L+ KV +   +R      + RS+N++ ++ P F+EGL++++ +F+Q+DED
Sbjct  11   PIKRHRVERDLDGKVADALRERTRSRQRTFRSVNSITMRLPRFKEGLRDVKNIFDQYDED  70

Query  357  SNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLL  524
            S+G ID EEL+    +++ H+ EEE+  L R CD+D  + ++F EF+VLLCL YLL
Sbjct  71   SDGTIDSEELQSFGSRVRVHMSEEEMSNLHRYCDIDSRKGVQFQEFVVLLCLAYLL  126



>ref|NP_001148758.1| calcium ion binding protein [Zea mays]
 gb|ACG32796.1| calcium ion binding protein [Zea mays]
Length=230

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = +3

Query  183  PNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDED  356
            P K  R++  L+ KV +   +R      + RS+N++ ++ P F+EGL++++ +F+Q+DED
Sbjct  11   PIKRHRVERDLDGKVADALRERTRSRQRTFRSVNSITMRLPRFKEGLRDVKNIFDQYDED  70

Query  357  SNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLL  524
            S+G ID EEL+    +++ H+ EEE+  L R CD+D  + ++F EF+VLLCL YLL
Sbjct  71   SDGTIDSEELQSFGSRVRVHMSEEEMSNLHRYCDIDSRKGVQFQEFVVLLCLAYLL  126



>ref|XP_008667961.1| PREDICTED: calcium ion binding protein isoform X1 [Zea mays]
Length=260

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = +3

Query  183  PNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDED  356
            P K  R++  L+ KV +   +R      + RS+N++ ++ P F+EGL++++ +F+Q+DED
Sbjct  11   PIKRHRVERDLDGKVADALRERTRSRQRTFRSVNSITMRLPRFKEGLRDVKNIFDQYDED  70

Query  357  SNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLL  524
            S+G ID EEL+    +++ H+ EEE+  L R CD+D  + ++F EF+VLLCL YLL
Sbjct  71   SDGTIDSEELQSFGSRVRVHMSEEEMSNLHRYCDIDSRKGVQFQEFVVLLCLAYLL  126



>emb|CDY42732.1| BnaA03g48070D [Brassica napus]
Length=228

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K+ E ++R      +++S N++ILKFP   EGL+  + +F++FDEDSNG+ID  
Sbjct  16   ETKLEAKIKEAMQRRESKGTTMKSFNSIILKFPKIDEGLRNCKAIFQEFDEDSNGSIDHS  75

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  557
            ELK C +KL+    EEEI++LF++CD++++ +I F EFIVLLCL+YLL D  S+     +
Sbjct  76   ELKNCFRKLEILFEEEEINDLFQACDINEDMEIAFTEFIVLLCLVYLLKDDSSTLQKKWR  135

Query  558  IGSP  569
            +G P
Sbjct  136  LGMP  139



>ref|XP_009137599.1| PREDICTED: probable calcium-binding protein CML21 [Brassica rapa]
Length=228

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K+ E ++R      +++S N++ILKFP   EGL+  + +F++FDEDSNG+ID  
Sbjct  16   ETKLEAKIKEAMQRRESKGTTMKSFNSIILKFPKIDEGLRNCKAIFQEFDEDSNGSIDHS  75

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  557
            ELK C +KL+    EEEI++LF++CD++++ +I F EFIVLLCL+YLL D  S+     +
Sbjct  76   ELKNCFRKLEILFEEEEINDLFQACDINEDMEIAFTEFIVLLCLVYLLKDDSSTLQKKWR  135

Query  558  IGSP  569
            +G P
Sbjct  136  LGMP  139



>emb|CDX92818.1| BnaC07g40760D [Brassica napus]
Length=228

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 87/124 (70%), Gaps = 2/124 (2%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K+ E ++R      +++S N++ILKFP   EGL+  + +F++FDEDSNG+ID  
Sbjct  16   ETKLEAKIKEAMQRRESKGTTMKSFNSIILKFPKIDEGLRNCKAIFQEFDEDSNGSIDHS  75

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  557
            ELK C +KL+    EEEI++LF++CD++++  I F EFIVLLCL+YLL D  S+     +
Sbjct  76   ELKNCFRKLEILFEEEEINDLFQACDINEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWR  135

Query  558  IGSP  569
            +G P
Sbjct  136  LGMP  139



>emb|CDX94327.1| BnaC01g18570D [Brassica napus]
Length=225

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = +3

Query  204  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            ++KLE K++E V+R A    +++S N+++LKFP   EGL+  + +F++FDEDSNG+ID  
Sbjct  12   ETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDEGLRNCKAIFQEFDEDSNGSIDHT  71

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  557
            ELK C +KL+    E+EI++LF +CD++++  I F EF+VLLCL+YLL D  S+     +
Sbjct  72   ELKNCFRKLEISFEEDEINDLFEACDINEDMGITFTEFVVLLCLVYLLKDDSSTLQKKWR  131

Query  558  IGSP  569
            +G P
Sbjct  132  LGMP  135



>ref|XP_001784911.1| predicted protein [Physcomitrella patens]
 gb|EDQ50300.1| predicted protein [Physcomitrella patens]
Length=229

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 76/123 (62%), Gaps = 2/123 (2%)
 Frame = +3

Query  207  SKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            +K+E ++++   +R     +++++ N  ILKFP      + +R VF + D++ +G++D E
Sbjct  14   TKIERRMVQAMAERAQKVNVTLKTFNTFILKFPKIDASFEAVREVFNKADKNGDGSLDME  73

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKI  560
            ELK+CLQ+LQ    ++EI+E     D+D +  I+F EFIV+L LIYLL     +G  S I
Sbjct  74   ELKQCLQELQVEYSDQEIEEFHHESDMDASHGIQFKEFIVVLALIYLLGRPTHTGVESAI  133

Query  561  GSP  569
            G P
Sbjct  134  GLP  136



>ref|XP_001775820.1| predicted protein [Physcomitrella patens]
 gb|EDQ59359.1| predicted protein [Physcomitrella patens]
Length=229

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 75/123 (61%), Gaps = 2/123 (2%)
 Frame = +3

Query  207  SKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            +K+E ++++   +R   A + +++ N  ILKFP      + +R VF + D++ +G++D +
Sbjct  14   TKIERRMIQAMAERAQIANVVLKTFNTFILKFPKIDASFEAVREVFNKADKNGDGSLDMD  73

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKI  560
            ELK+CLQ+LQ    ++EI+E     D+D    I+F EFIV+L LIYLL     +G  S I
Sbjct  74   ELKQCLQELQVEYSDQEIEEFHHESDMDSTHGIQFKEFIVVLALIYLLGRPTHTGVKSAI  133

Query  561  GSP  569
            G P
Sbjct  134  GLP  136



>ref|XP_002323775.2| hypothetical protein POPTR_0017s08200g [Populus trichocarpa]
 gb|EEF03908.2| hypothetical protein POPTR_0017s08200g [Populus trichocarpa]
Length=136

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 64/99 (65%), Gaps = 15/99 (15%)
 Frame = +3

Query  273  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  452
            +N LI+ FP F E LK IR VFEQ+DED NG+ID EELKKCLQKL   + +EE+++LF S
Sbjct  1    MNILIMWFPQFNEELKHIRGVFEQYDEDVNGSIDLEELKKCLQKLTLTL-KEEVEDLFHS  59

Query  453  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSP  569
            CD+D++    F E I LL              TSK+GSP
Sbjct  60   CDIDNSTSSMFLEVINLL--------------TSKMGSP  84



>ref|XP_010691276.1| PREDICTED: probable calcium-binding protein CML22 isoform X5 
[Beta vulgaris subsp. vulgaris]
Length=226

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 82/164 (50%), Gaps = 47/164 (29%)
 Frame = +3

Query  105  VGLSRPCLSLKLVSDKVGSLL----CCHGSPNKYSRLDSKLETKVLEVKRNAPAT----L  260
             G SR C +LK +  KVGS+L    C   + NKY RLD+KLE K++E+KR A  +     
Sbjct  10   TGRSRSCPALKSICYKVGSMLWGCNCASSTTNKYRRLDAKLERKMIELKRQASTSGHTNK  69

Query  261  SIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDE  440
              RSIN++I+KFP  +E +K++R VFE +D                              
Sbjct  70   KFRSINSVIMKFPQLKEQVKKLRGVFEHYDR-----------------------------  100

Query  441  LFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSP  569
                     N +I+F EFIVLLCLIYL+    S + + S+  SP
Sbjct  101  ---------NGRIQFREFIVLLCLIYLITKPSSPTDAVSRTESP  135



>ref|XP_006840146.1| hypothetical protein AMTR_s00089p00059230 [Amborella trichopoda]
 gb|ERN01821.1| hypothetical protein AMTR_s00089p00059230 [Amborella trichopoda]
Length=225

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 74/131 (56%), Gaps = 3/131 (2%)
 Frame = +3

Query  153  VGSLLCCHGSPNKYSRLDSKLETKVLEVKR---NAPATLSIRSINALILKFPHFREGLKE  323
            +G +     SP    R  SKL   V E  +   +A      RSI+ +++KFP   EGLKE
Sbjct  1    MGGIWGRLSSPLSQMRASSKLHMMVGEAMKRRVSAGGGSPFRSIDGMLMKFPKLIEGLKE  60

Query  324  IRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVL  503
            +  +F+QFD+DSNG I+ EEL++    LQ    ++ +  L+ +C++D ++ I F + ++L
Sbjct  61   LHIIFDQFDKDSNGTINWEELRQIFSYLQLKFSDQTLANLYDACEMDGHKGINFAKLVLL  120

Query  504  LCLIYLLMDAP  536
            L   +LL D P
Sbjct  121  LGWFHLLEDHP  131



>ref|XP_006299579.1| hypothetical protein CARUB_v10015753mg [Capsella rubella]
 gb|EOA32477.1| hypothetical protein CARUB_v10015753mg [Capsella rubella]
Length=157

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 80/154 (52%), Gaps = 25/154 (16%)
 Frame = +3

Query  168  CCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  341
            CC  S    KY+ LD+KL  K++E +R  P   S++S++++I+KFP  REGL+ IR+VFE
Sbjct  4    CCVNSEKNKKYAELDAKLARKMVESRRIYPGHRSLKSMDSIIMKFPKLREGLRNIRSVFE  63

Query  342  QF--------------------DEDSNGAIDREELKKCLQKLQFHVGEEEIDELF---RS  452
             +                    D D NG ID EELKKCL++L+  + +EE+  L+     
Sbjct  64   SYAFIKIPLVFLFNILVLRIFSDNDKNGTIDIEELKKCLEELKLSLSDEEVKGLYGCAEE  123

Query  453  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTS  554
             D     K+ F EF+        L DA    ++S
Sbjct  124  MDWGRKGKVGFREFLFAFMSWVGLDDADDYYTSS  157



>ref|XP_002990940.1| hypothetical protein SELMODRAFT_132549 [Selaginella moellendorffii]
 gb|EFJ07984.1| hypothetical protein SELMODRAFT_132549 [Selaginella moellendorffii]
Length=226

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +3

Query  207  SKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            SK+E +++E   KR        +S N++++KFP   +  +++R VF++FD+D +G ID E
Sbjct  15   SKIERRMVEAMRKRAKAGPSPFKSFNSILMKFPKIDKSFEQVRGVFKKFDKDDSGTIDLE  74

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKI  560
            ELK C ++LQ    + E+       D+D ++ + F EFI++L L+YLL +  +    S+I
Sbjct  75   ELKTCFRELQVEFTDTEVKAFHEESDMDKSKGVDFKEFIIVLALVYLLGETGAK-PKSRI  133

Query  561  G  563
            G
Sbjct  134  G  134



>ref|XP_002982786.1| hypothetical protein SELMODRAFT_422194 [Selaginella moellendorffii]
 gb|EFJ16031.1| hypothetical protein SELMODRAFT_422194 [Selaginella moellendorffii]
Length=243

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = +3

Query  207  SKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  380
            SK+E +++E   KR        +S N++++KFP   +  +++R VF++FD+D +G ID E
Sbjct  15   SKIERRMVEAMRKRAKAGPSPFKSFNSILMKFPKIDKSFEQVRGVFKKFDKDDSGTIDLE  74

Query  381  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLL  524
            ELK C ++LQ    + E+       D+D ++ + F EFI++L L+YLL
Sbjct  75   ELKTCFRELQVEFTDTEVKAFHEESDMDKSKGVDFKEFIIVLALVYLL  122



>ref|XP_002990719.1| hypothetical protein SELMODRAFT_429138 [Selaginella moellendorffii]
 gb|EFJ08168.1| hypothetical protein SELMODRAFT_429138 [Selaginella moellendorffii]
Length=233

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 67/120 (56%), Gaps = 9/120 (8%)
 Frame = +3

Query  237  KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQF---------DEDSNGAIDREELK  389
            +R A A  S++S +A+++KF        ++R VF++F         D+   G ID E+LK
Sbjct  28   QRAAAAKSSVKSFDAILMKFSKIDMAFDQVRDVFKRFASAGWILVADKHKRGTIDLEQLK  87

Query  390  KCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSP  569
             C ++L+    EEE+   +   DVD N +I F EFIV+L L YLL +  +S   S+IG P
Sbjct  88   ACFRELKVEFTEEEVQMFYEEGDVDHNRRISFKEFIVVLALAYLLGEPLNSDGKSRIGLP  147



>ref|XP_002986712.1| hypothetical protein SELMODRAFT_425580 [Selaginella moellendorffii]
 gb|EFJ12275.1| hypothetical protein SELMODRAFT_425580 [Selaginella moellendorffii]
Length=233

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 67/120 (56%), Gaps = 9/120 (8%)
 Frame = +3

Query  237  KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQF---------DEDSNGAIDREELK  389
            +R A A  S++S +A+++KF        ++R VF++F         D+   G ID E+LK
Sbjct  28   QRAAAAKSSVKSFDAILMKFSKIDMAFDQVRDVFKRFASVGWILVADKHKRGTIDLEQLK  87

Query  390  KCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSP  569
             C ++L+    EEE+   +   DVD N +I F EFIV+L L YLL +  +S   S+IG P
Sbjct  88   ACFRELKVEFTEEEVQIFYEEGDVDHNRRISFKEFIVVLALAYLLGEPLNSDGKSRIGLP  147



>ref|XP_007224348.1| hypothetical protein PRUPE_ppa020720mg [Prunus persica]
 gb|EMJ25547.1| hypothetical protein PRUPE_ppa020720mg [Prunus persica]
Length=160

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  351  EDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD  530
            EDSNGAID+EE+KKC  KL+    +EEI +LF +CD++++  IKFNEFIVL+CL+YLL D
Sbjct  21   EDSNGAIDQEEMKKCFYKLEVCFTDEEISDLFEACDINEDMGIKFNEFIVLICLVYLLKD  80

Query  531  APSSGST  551
              +   T
Sbjct  81   DSNDVHT  87



>ref|XP_010468449.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
Length=182

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 33/136 (24%)
 Frame = +3

Query  162  LLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  332
            ++CC     +  KY+ LD KL  K++E +R  P                           
Sbjct  1    MICCCVKSDTNKKYAELDGKLARKMVESRRIYPG--------------------------  34

Query  333  VFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFR-SCDVDDNEKIKFNEFIVLLC  509
                 + D NG ID EELKKCL++LQ  + +EE+  L+   CDVD ++ I+FNEF+  L 
Sbjct  35   ---HKNNDKNGTIDIEELKKCLEELQLSLSDEEVKGLYGIWCDVDGSKGIQFNEFMFKLI  91

Query  510  LIYLLMDAPSSGSTSK  557
             ++L +D    G  +K
Sbjct  92   EVFLFLDKEGKGKVNK  107



>ref|XP_009040569.1| hypothetical protein AURANDRAFT_66979 [Aureococcus anophagefferens]
 gb|EGB04654.1| hypothetical protein AURANDRAFT_66979 [Aureococcus anophagefferens]
Length=339

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 59/108 (55%), Gaps = 2/108 (2%)
 Frame = +3

Query  222  KVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQ  401
            ++L+ KR+  A     + + +++K        K I  V++  D D NG++D +EL+K + 
Sbjct  25   QMLKAKRDELAHAPPVTFSKILMKASSMNATYKRINAVYDSLDTDKNGSLDLKELQKMID  84

Query  402  KLQF--HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS  539
            +L+    V  E++  +F  CD+D +  I   EFIV L L+YLL   P+
Sbjct  85   ELEIGHEVSSEDLRSVFELCDIDHDGTISLKEFIVTLSLLYLLRAVPT  132



>ref|XP_004691277.1| PREDICTED: calmodulin-like protein 3 [Condylura cristata]
Length=149

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            ++ L++ V E+ R+   T+       ++ +    R+  +EIR  F  FD+D NG +   E
Sbjct  46   EADLQSMVNEIDRDGNGTVDFPEFLGMMARKMKDRDSEEEIREAFRVFDKDGNGFVSAAE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  + +L   + +EE+DE+ R+ DVD + ++ + EF+ +L 
Sbjct  106  LRHVMTRLGEKLSDEEVDEMIRAADVDGDGQVNYEEFVRMLV  147



>ref|XP_006088486.1| PREDICTED: calmodulin-like protein 3 [Myotis lucifugus]
Length=149

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/125 (25%), Positives = 68/125 (54%), Gaps = 6/125 (5%)
 Frame = +3

Query  138  LVSDKVGSLLCCHG-SPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREG  314
            + + ++G+++   G +P +     ++LE  V E+ R+   T+       ++ +    R+ 
Sbjct  28   ITTQELGTVMRALGQNPTQ-----AELEAMVSEIDRDGNGTVDFPEFLGMMARRMKDRDS  82

Query  315  LKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEF  494
             +EIR  F  FD+D NG +   EL+  + +L   + ++E+DE+ ++ DVD + ++ + EF
Sbjct  83   EEEIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDQEVDEMIQAADVDGDGQVNYEEF  142

Query  495  IVLLC  509
            + +L 
Sbjct  143  VRMLV  147



>ref|XP_002063560.1| GK19414 [Drosophila willistoni]
 gb|EDW74546.1| GK19414 [Drosophila willistoni]
Length=148

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 59/117 (50%), Gaps = 7/117 (6%)
 Frame = +3

Query  165  LCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQ  344
            L CH S       + +L++ + EV  +   ++ I    A+IL+         E+R  F  
Sbjct  39   LGCHPS-------EGELQSMINEVDYDGNGSIEIEEFTAMILRKLRATNNEDELREAFRI  91

Query  345  FDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLI  515
            +D D+NG I   ELK  L  L   + +EE+DE+ R  D D + ++ F++F+ ++  I
Sbjct  92   YDRDNNGFIHPGELKYVLTALGVKISDEEVDEMIREYDYDHDGQMNFDDFVGMMSTI  148



>gb|ABF38946.2| calmodulin [Phytomonas serpens]
Length=149

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 66/124 (53%), Gaps = 4/124 (3%)
 Frame = +3

Query  138  LVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGL  317
            + S ++G+++   G     +  +++L+ ++ EV ++   T+       L+ +     +  
Sbjct  28   ITSKELGTVMRSLGQ----NPTEAELQYRINEVDQDGSGTVDFPEFLTLMARKMQDSDSE  83

Query  318  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  497
            +EI+  F  FD+D NG I   EL+  +  L   +GEEE+DE+ R  DVD + +I + EF+
Sbjct  84   EEIKEAFRVFDKDGNGFISAAELRHVMTNLGEKLGEEEVDEMIREADVDGDGQINYEEFV  143

Query  498  VLLC  509
             ++ 
Sbjct  144  KMMM  147



>gb|AHA51331.1| EF-hand_1 domain-containing protein [Charistephane fugiens]
Length=239

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  EVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQ  410
            EV  +    + +      +     +++  + IR  F+QFD+D NG IDR+EL+  +  L 
Sbjct  144  EVDADGNGMVDVHEFLVFMASRTLYKDEDQNIRDAFKQFDKDGNGYIDRDELRSLMITLG  203

Query  411  FHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIY  518
              + +EEIDE+ +  D D + KI + EF +++ L Y
Sbjct  204  EKLTDEEIDEMMQEADFDRDGKISYQEFYIMMKLTY  239



>ref|XP_004588547.1| PREDICTED: calmodulin-like protein 3 [Ochotona princeps]
Length=149

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/101 (28%), Positives = 56/101 (55%), Gaps = 0/101 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L+  V E+ R+   T+       ++++        +EIR  F  FD+D NG +   E
Sbjct  46   EAELQDMVREIDRDGSGTVDFSEFLGMMVRQMKDTHSEEEIREAFRVFDKDGNGYVSAAE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLL  506
            L+  + +L   + +EE+DE+ RS D+D + ++ + EF+ +L
Sbjct  106  LRHVMTRLGEKLSDEEVDEMIRSADIDGDGQVNYEEFVHML  146



>ref|XP_005869569.1| PREDICTED: calmodulin-like protein 3 [Myotis brandtii]
 ref|XP_006772690.1| PREDICTED: calmodulin-like protein 3 [Myotis davidii]
 ref|XP_008153574.1| PREDICTED: calmodulin-like protein 3 [Eptesicus fuscus]
 gb|ELK23559.1| Calmodulin-like protein 3 [Myotis davidii]
 gb|EPQ09736.1| Calmodulin-like protein 3 [Myotis brandtii]
Length=149

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/125 (25%), Positives = 68/125 (54%), Gaps = 6/125 (5%)
 Frame = +3

Query  138  LVSDKVGSLLCCHG-SPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREG  314
            + + ++G+++   G +P +     ++LE  V E+ R+   T+       ++ +    R+ 
Sbjct  28   ITTQELGTVMRALGQNPTQ-----AELEGMVSEIDRDGNGTVDFPEFLGMMARRMKDRDS  82

Query  315  LKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEF  494
             +EIR  F  FD+D NG +   EL+  + +L   + ++E+DE+ ++ DVD + ++ + EF
Sbjct  83   EEEIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDQEVDEMIQAADVDGDGQVNYEEF  142

Query  495  IVLLC  509
            + +L 
Sbjct  143  VRMLV  147



>gb|AHA51329.1| EF-hand_1 domain-containing protein, partial [Charistephane fugiens]
Length=220

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  EVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQ  410
            EV  +    + +      +     +++  + IR  F+QFD+D NG IDR+EL+  +  L 
Sbjct  125  EVDADGNGMVDVHEFLVFMASRTLYKDEDQNIRDAFKQFDKDGNGYIDRDELRSLMITLG  184

Query  411  FHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIY  518
              + +EEIDE+ +  D D + KI + EF +++ L Y
Sbjct  185  EKLTDEEIDEMMQEADFDRDGKISYQEFYIMMKLTY  220



>gb|AHA51330.1| EF-hand_1 domain-containing protein, partial [Charistephane fugiens]
Length=230

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  EVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQ  410
            EV  +    + +      +     +++  + IR  F+QFD+D NG IDR+EL+  +  L 
Sbjct  135  EVDADGNGMVDVHEFLVFMASRTLYKDEDQNIRDAFKQFDKDGNGYIDRDELRSLMITLG  194

Query  411  FHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIY  518
              + +EEIDE+ +  D D + KI + EF +++ L Y
Sbjct  195  EKLTDEEIDEMMQEADFDRDGKISYQEFYIMMKLTY  230



>emb|CAB40133.1| calmodulin-like protein [Branchiostoma floridae]
Length=147

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 67/121 (55%), Gaps = 6/121 (5%)
 Frame = +3

Query  150  KVGSLLCCHG-SPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEI  326
            ++G+++   G +PN+     ++L+  + EV  +   T+       ++ +     +  +EI
Sbjct  30   ELGTVMRSLGQNPNQ-----AELQDMINEVDTDGNGTIDFSEFLTMMARKMGETDSEEEI  84

Query  327  RTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLL  506
            R  F  FD+D NG I+R ELK+ + KL   + +EE+DE+ +  D+D + +I + EF+ ++
Sbjct  85   REAFRHFDKDCNGYINRSELKQVMSKLGEKLTDEELDEMIQEADIDGDGQINYEEFVKMM  144

Query  507  C  509
             
Sbjct  145  M  145



>ref|XP_004336073.1| Calmodulin, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR14060.1| Calmodulin, putative [Acanthamoeba castellanii str. Neff]
Length=149

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 67/125 (54%), Gaps = 4/125 (3%)
 Frame = +3

Query  135  KLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREG  314
            K+ S ++G+++   G+    +  +++L+  + +V  +   T+       ++ +     EG
Sbjct  27   KITSKELGTVMRSLGA----NPTEAELKDMIKDVDLDGNGTIDFPEFLTMMARKMQDSEG  82

Query  315  LKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEF  494
             +EIR  F+ FD+D NG I   EL+  +  L   + +EE+DE+ R  DVD + +I + EF
Sbjct  83   EEEIREAFKVFDKDGNGTISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQIHYEEF  142

Query  495  IVLLC  509
            + ++ 
Sbjct  143  VKMMM  147



>gb|AHA51333.1| EF-hand_1 domain-containing protein [Charistephane fugiens]
Length=284

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  EVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQ  410
            EV  +    + +      +     +++  + IR  F+QFD+D NG IDR+EL+  +  L 
Sbjct  189  EVDADGNGMVDVHEFLVFMASRTLYKDEDQNIRDAFKQFDKDGNGYIDRDELRSLMITLG  248

Query  411  FHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIY  518
              + +EEIDE+ +  D D + KI + EF +++ L Y
Sbjct  249  EKLTDEEIDEMMQEADFDRDGKISYQEFYIMMKLTY  284



>gb|AHA51332.1| EF-hand_1 domain-containing protein, partial [Charistephane fugiens]
Length=290

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  EVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQ  410
            EV  +    + +      +     +++  + IR  F+QFD+D NG IDR+EL+  +  L 
Sbjct  195  EVDADGNGMVDVHEFLVFMASRTLYKDEDQNIRDAFKQFDKDGNGYIDRDELRSLMITLG  254

Query  411  FHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIY  518
              + +EEIDE+ +  D D + KI + EF +++ L Y
Sbjct  255  EKLTDEEIDEMMQEADFDRDGKISYQEFYIMMKLTY  290



>ref|XP_005617262.1| PREDICTED: calmodulin-like protein 3, partial [Canis lupus familiaris]
Length=135

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L   V E+ R+   ++       ++ +    R+  ++IR  F  FD+D NG +   E
Sbjct  32   EAELRDMVGEIDRDGNGSVDFPEFLGMMARQLKGRDSEEQIREAFRVFDKDGNGLVSAAE  91

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  + +L   + +EE+DE+ R+ DVD + ++ + EF+ +L 
Sbjct  92   LRHVMTRLGEKLSDEEVDEMIRAADVDGDGQVNYEEFVHMLV  133



>ref|XP_004806636.1| PREDICTED: calmodulin-like protein 3 [Mustela putorius furo]
Length=149

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L   V E+ R+   T+       ++ +    R+   +IR  F  FD+D NG +   E
Sbjct  46   EAELRDMVSEIDRDGNGTVDFPEFLGMMARQLKGRDSEDQIREAFRVFDKDGNGLVSAAE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  + +L   + +EE+DE+ R+ DVD + ++ + EF+ +L 
Sbjct  106  LRHVMTRLGEKLSDEEVDEMIRAADVDGDGQVNYEEFVHMLV  147



>ref|XP_004757981.1| PREDICTED: calmodulin-like protein 3 [Mustela putorius furo]
Length=149

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L   V E+ R+   T+       ++ +    R+   +IR  F  FD+D NG +   E
Sbjct  46   EAELRDMVSEIDRDGNGTVDFPEFLGMMARQLKGRDSEDQIREAFRVFDKDGNGLVSATE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  + +L   + +EE+DE+ R+ DVD + ++ + EF+ +L 
Sbjct  106  LRHVMTRLGEKLSDEEVDEMIRAADVDGDGQVNYEEFVHMLV  147



>gb|EPB84784.1| calmodulin [Mucor circinelloides f. circinelloides 1006PhL]
Length=147

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 55/102 (54%), Gaps = 1/102 (1%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            D++L+  V +V  +    +       L+       EG  +++  F+ FD D NG IDREE
Sbjct  46   DAELQDMVNDVDADGNGNIDFTEFLGLVKNMKTGNEG-DDLKEAFKVFDVDGNGLIDREE  104

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+K +  L   + EEE+D + +  D++ + +I F+EF +++ 
Sbjct  105  LRKVMASLNESLSEEELDAMIKEADINGDGQISFDEFKIMMG  146



>dbj|GAN02697.1| calmodulin [Mucor ambiguus]
Length=147

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 55/102 (54%), Gaps = 1/102 (1%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            D++L+  V +V  +    +       L+       EG  +++  F+ FD D NG IDREE
Sbjct  46   DAELQDMVNDVDADGNGNIDFTEFLGLVKNMKTGSEG-DDLKEAFKVFDVDGNGLIDREE  104

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+K +  L   + EEE+D + +  D++ + +I F+EF +++ 
Sbjct  105  LRKVMASLNESLSEEELDAMIKEADINGDGQISFDEFKIMMG  146



>gb|ELU09134.1| hypothetical protein CAPTEDRAFT_228814 [Capitella teleta]
Length=533

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +3

Query  312  GLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNE  491
            G +E+   F  FD+D +G ID  EL+  L  L   + E E+DE+ R  D+D + K+ +NE
Sbjct  186  GPEELEQAFRMFDKDGDGFIDARELRHLLTNLGEKLTETEVDEMIREVDIDGDGKVDYNE  245

Query  492  FIVLLCLIYLLMDA  533
            F+ +L  +  L+DA
Sbjct  246  FVQMLQPMMQLVDA  259



>ref|XP_010619737.1| PREDICTED: calmodulin-like protein 3 [Fukomys damarensis]
 gb|KFO34526.1| Calmodulin-like protein 3 [Fukomys damarensis]
Length=149

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L+  V EV R+   T+       L+ +     +  +EIR  F  FD+D NG +   E
Sbjct  46   EAELQGMVNEVDRDGNGTVDFPEFLGLMARKMKDTDSEEEIREAFRVFDKDGNGYVSAPE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  + +L   + +EE+DE+ R+ D D + ++ + EF+ +L 
Sbjct  106  LRHVMTRLGEKLSDEEVDEMIRAADADGDGQVNYEEFVRMLV  147



>ref|XP_002920391.1| PREDICTED: calmodulin-like protein 3 [Ailuropoda melanoleuca]
 gb|EFB23091.1| hypothetical protein PANDA_009127 [Ailuropoda melanoleuca]
Length=149

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L   V E+ R+   ++       ++ +    R+  ++IR  F  FD+D NG +   E
Sbjct  46   EAELRDMVGEIDRDGNGSVDFPEFLGMMARQLKGRDSEEQIREAFRVFDKDGNGLVSAAE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  + +L   + +EE+DE+ R+ DVD + ++ + EF+ +L 
Sbjct  106  LRHVMTRLGEKLSDEEVDEMIRAADVDGDGQVNYEEFVRMLV  147



>gb|ETI45580.1| hypothetical protein F443_09884 [Phytophthora parasitica P1569]
 gb|ETM45391.1| hypothetical protein L914_09550 [Phytophthora parasitica]
Length=325

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 65/137 (47%), Gaps = 2/137 (1%)
 Frame = +3

Query  135  KLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLE--VKRNAPATLSIRSINALILKFPHFR  308
            KL++  + S+     +P   + LD K+   + E   +R             ++LK P   
Sbjct  49   KLLTSNIASIRPVEQTPRVPTPLDQKITNAIKERWQERAQQEKEKENQFTRILLKLPQAA  108

Query  309  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  488
                  R+ F  FD++  G I+  +L +  ++L  +   EEI ++F   D+ ++ K+ FN
Sbjct  109  VAFNSARSTFNAFDKEGKGYIEFSDLSRVFEQLGANFSSEEIGQVFEESDMMEDGKLNFN  168

Query  489  EFIVLLCLIYLLMDAPS  539
            EF+V L + ++L   PS
Sbjct  169  EFLVCLAIGFVLHKIPS  185



>ref|XP_008892917.1| hypothetical protein PPTG_01392 [Phytophthora parasitica INRA-310]
 gb|ETN21086.1| hypothetical protein PPTG_01392 [Phytophthora parasitica INRA-310]
Length=325

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 65/137 (47%), Gaps = 2/137 (1%)
 Frame = +3

Query  135  KLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLE--VKRNAPATLSIRSINALILKFPHFR  308
            KL++  + S+     +P   + LD K+   + E   +R             ++LK P   
Sbjct  49   KLLTSNIASIRPVEQTPRVPTPLDQKITNAIKERWQERAQQEKEKENQFTRILLKLPQAA  108

Query  309  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  488
                  R+ F  FD++  G I+  +L +  ++L  +   EEI ++F   D+ ++ K+ FN
Sbjct  109  VAFNSARSTFNAFDKEGKGYIEFSDLSRVFEQLGANFSSEEIGQVFEESDMMEDGKLNFN  168

Query  489  EFIVLLCLIYLLMDAPS  539
            EF+V L + ++L   PS
Sbjct  169  EFLVCLAIGFVLHKIPS  185



>gb|ETK85532.1| hypothetical protein L915_09682 [Phytophthora parasitica]
 gb|ETL38971.1| hypothetical protein L916_09586 [Phytophthora parasitica]
 gb|ETL92092.1| hypothetical protein L917_09511 [Phytophthora parasitica]
 gb|ETO74224.1| hypothetical protein F444_09978 [Phytophthora parasitica P1976]
 gb|ETP15388.1| hypothetical protein F441_09834 [Phytophthora parasitica CJ01A1]
 gb|ETP43453.1| hypothetical protein F442_09789 [Phytophthora parasitica P10297]
Length=325

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 65/137 (47%), Gaps = 2/137 (1%)
 Frame = +3

Query  135  KLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLE--VKRNAPATLSIRSINALILKFPHFR  308
            KL++  + S+     +P   + LD K+   + E   +R             ++LK P   
Sbjct  49   KLLTSNIASIRPVEQTPRVPTPLDQKITNAIKERWQERAQQEKEKENQFTRILLKLPQAA  108

Query  309  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  488
                  R+ F  FD++  G I+  +L +  ++L  +   EEI ++F   D+ ++ K+ FN
Sbjct  109  VAFNSARSTFNAFDKEGKGYIEFSDLSRVFEQLGANFSSEEIGQVFEESDMMEDGKLNFN  168

Query  489  EFIVLLCLIYLLMDAPS  539
            EF+V L + ++L   PS
Sbjct  169  EFLVCLAIGFVLHKIPS  185



>ref|XP_008703623.1| PREDICTED: calmodulin-like protein 3 [Ursus maritimus]
Length=149

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L   V E+ R+   ++       ++ +    R+  ++IR  F  FD+D NG +   E
Sbjct  46   EAELRDMVGEIDRDGNGSVDFPEFLGMMARQLKGRDSEEQIREAFRVFDKDGNGLVSAAE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  + +L   + +EE+DE+ R+ DVD + ++ + EF+ +L 
Sbjct  106  LRHVMTRLGEKLSDEEVDEMIRAADVDGDGQVNYEEFVHMLV  147



>pdb|3WLC|A Chain A, Crystal Structure Of Dimeric Gcamp6m
 pdb|3WLD|A Chain A, Crystal Structure Of Monomeric Gcamp6m
Length=448

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L+  + EV  +   T+       ++ +   +R+  +EIR  F  FD+D NG I   E
Sbjct  345  EAELQDMINEVDADGDGTIDFPEFLTMMARKGSYRDTEEEIREAFGVFDKDGNGYISAAE  404

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  +  L   + +EE+DE+ R  D+D + ++ + EF+ ++ 
Sbjct  405  LRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT  446



>ref|XP_009526469.1| hypothetical protein PHYSODRAFT_264348 [Phytophthora sojae]
 gb|EGZ17411.1| hypothetical protein PHYSODRAFT_264348 [Phytophthora sojae]
Length=346

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 61/117 (52%), Gaps = 5/117 (4%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPAT-----LSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGA  368
            +S +ET   ++ R+   T     L       ++LKFP   +    +R+ F+ FD++ +G 
Sbjct  52   ESSIETTKEQLHRHPTHTHKDSPLDRNPFTRILLKFPQAAKAFNGVRSTFKTFDKEGHGY  111

Query  369  IDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS  539
            I  ++L    ++L     E+EI+++F   D+ +N K+ F E +V L + +LL   PS
Sbjct  112  IVSDDLPAIYKELGVSFSEDEINQVFEESDMKENGKLTFKELLVSLAIGFLLHRIPS  168



>gb|EYB86371.1| hypothetical protein Y032_0280g1224 [Ancylostoma ceylanicum]
Length=250

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  300  HFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKI  479
            + R+ LKE R +F  FD D +GAI  +ELK+ +  +  H  E EID + R  D D N +I
Sbjct  92   YTRKQLKEYRQLFNMFDTDGSGAIGNDELKQAMLSIGIHANEAEIDNVIREVDADGNGEI  151

Query  480  KFNEF  494
             F EF
Sbjct  152  DFEEF  156



>ref|XP_004477431.1| PREDICTED: calmodulin-like protein 3 [Dasypus novemcinctus]
Length=149

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L   V +V  +   T++      L+ K     +G ++IR  F  FD+D NG +   E
Sbjct  46   EAELRDMVRQVDADGSGTVAFPEFLGLMAKKMRDADGEEDIRQAFRVFDKDGNGFVSAAE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  + +L   + EEE+DE+ ++ D D + ++ + EF+ +L 
Sbjct  106  LRHVMTRLGEKLSEEEVDEMIQAADADGDGQVNYEEFVRMLV  147



>ref|XP_005320369.1| PREDICTED: calmodulin-like protein 3 [Ictidomys tridecemlineatus]
Length=149

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L+  V E+ R+   T+       ++ +     +  +EIR  F  FD+D NG +   E
Sbjct  46   EAELQGMVNEIDRDGNGTVDFPEFLGMMARKMKDTDSEEEIREAFRVFDKDGNGYVSAAE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  + +L   + +EE+DE+ R+ D D + ++ + EF+ +L 
Sbjct  106  LRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRMLV  147



>ref|XP_006933271.1| PREDICTED: calmodulin-like protein 3 [Felis catus]
 ref|XP_007081232.1| PREDICTED: calmodulin-like protein 3 [Panthera tigris altaica]
Length=149

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L   V E+ R+   ++       ++ +    R+  ++IR  F  FD+D NG +   E
Sbjct  46   EAELRDMVGEIDRDGNGSVDFPEFLGMMARQLRGRDSEEQIREAFRVFDKDGNGLVSAAE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  + +L   + ++E+DE+ R+ DVD + ++ + EF+ +L 
Sbjct  106  LRHVMTRLGEKLSDDEVDEMIRAADVDGDGQVNYEEFVHMLV  147



>emb|CDH56635.1| calmodulin [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS08821.1| Putative Calmodulin [Absidia idahoensis var. thermophila]
Length=149

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L+  V EV  +   T+       +I +     +  +EI+  F+ FD+D NG I   E
Sbjct  46   EAELQDMVNEVDSDGNGTIDFSEFLTMIARKMKDTDSQEEIQEAFKVFDKDGNGYISAAE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  +  L   + EEE+DE+ R  DVD + +I + EF+ ++ 
Sbjct  106  LRHVMTSLGEKLSEEEVDEMIREADVDQDGQINYEEFVKMMM  147



>gb|ADN07535.1| calmodulin 4 [Microtus ochrogaster]
Length=148

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = +3

Query  270  SINALILKFPHFREGL--KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDEL  443
            S +  +     ++ G   +E+R VF  FD+D +G I  +ELK+ + +L   + +EE+D +
Sbjct  65   SFDEFLAAMAKYKRGSTEQEMRAVFSVFDKDGDGHITVDELKQAMAQLGEEISQEELDSM  124

Query  444  FRSCDVDDNEKIKFNEFIVLL  506
             R  DVD + K+ +NEF+ +L
Sbjct  125  IREADVDQDGKVDYNEFVRML  145



>gb|ADN07528.1| calmodulin 4 [Microtus ochrogaster]
Length=148

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = +3

Query  270  SINALILKFPHFREGL--KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDEL  443
            S +  +     ++ G   +E+R VF  FD+D +G I  +ELK+ + +L   + +EE+D +
Sbjct  65   SFDEFLAAMAKYKRGSTEQEMRAVFSVFDKDGDGHITVDELKQAMAQLGEEISQEELDSM  124

Query  444  FRSCDVDDNEKIKFNEFIVLL  506
             R  DVD + K+ +NEF+ +L
Sbjct  125  IREADVDQDGKVDYNEFVRML  145



>ref|XP_005354981.1| PREDICTED: calmodulin-4-like [Microtus ochrogaster]
Length=148

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = +3

Query  270  SINALILKFPHFREGL--KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDEL  443
            S +  +     ++ G   +E+R VF  FD+D +G I  +ELK+ + +L   + +EE+D +
Sbjct  65   SFDEFLAAMAKYKRGSTEQEMRAVFSVFDKDGDGHITVDELKQAMAQLGEEISQEELDSM  124

Query  444  FRSCDVDDNEKIKFNEFIVLL  506
             R  DVD + K+ +NEF+ +L
Sbjct  125  IREADVDQDGKVDYNEFVRML  145



>ref|XP_008835071.1| PREDICTED: calmodulin-like protein 5 [Nannospalax galili]
Length=149

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 50/92 (54%), Gaps = 0/92 (0%)
 Frame = +3

Query  234  VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF  413
            V  +   T+S     A + K+       KE+R VF  FD++ +G I  +ELK+ + +L  
Sbjct  56   VDTDGDGTISFDEFLAAMAKYASGGIAEKELRAVFSVFDQNGDGHISVDELKQAMTQLGE  115

Query  414  HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
             + +EE+D + R  DVD + K+ + EF+ +L 
Sbjct  116  KLSQEELDAMIREADVDKDGKVNYEEFVRILS  147



>ref|XP_003939101.1| PREDICTED: calmodulin-like protein 5 [Saimiri boliviensis boliviensis]
Length=146

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = +3

Query  288  LKFPHFRE-------GLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELF  446
            + FP F E       GL+E++  F  FD D +G I  +ELK+ ++KL   + +EE+D + 
Sbjct  64   ISFPEFLEAVKKSKIGLEELQAAFRVFDLDGDGHITVDELKQAMEKLGEQLSQEELDAMI  123

Query  447  RSCDVDDNEKIKFNEFIVLLC  509
            R  DVD + ++ + EF  +L 
Sbjct  124  READVDQDGRVNYEEFARMLS  144



>gb|AHA51383.1| EF-hand_1 domain-containing protein, partial [Hormiphora californensis]
Length=166

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 63/124 (51%), Gaps = 4/124 (3%)
 Frame = +3

Query  138  LVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGL  317
            + + ++G+++   G     +  D  L+  + EV  +   T+       ++ K     +  
Sbjct  44   ITTQELGTVMKSLGQ----NPTDGDLQDMINEVDADGNGTIDFPEFLTMMTKHMKESDND  99

Query  318  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  497
            +E+R  F+ FD+D NG I  EELK  +Q L   + +EEI+E+ R  D D + ++ + EF+
Sbjct  100  QELREAFKVFDKDGNGKISSEELKIVMQNLGEKLTDEEINEMIREADNDGDGEVDYEEFV  159

Query  498  VLLC  509
             ++ 
Sbjct  160  KMMS  163



>ref|XP_004411877.1| PREDICTED: calmodulin-like protein 3 [Odobenus rosmarus divergens]
Length=149

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L   V E+ R+   ++       ++ +    R+  ++IR  F  FD+D NG +   E
Sbjct  46   EAELRDTVGEIDRDGNGSVDFPKFLGIMARQLRGRDSEEQIREAFRVFDKDGNGLVSAAE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  + +L   + ++E+DE+ R+ DVD + ++ + EFI +L 
Sbjct  106  LRHVMTRLGEKLSDDEVDEMIRAADVDRDGQVNYEEFIRVLV  147



>ref|XP_008583911.1| PREDICTED: calmodulin-like protein 3 [Galeopterus variegatus]
Length=149

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L+  V E+ ++   T+       ++ +     +  +EIR  F  FD+D NG +   E
Sbjct  46   EAELQGMVSEIDQDGNGTVDFPEFLGMMARKMKDTDSEEEIREAFRVFDKDGNGYVSAAE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  + KL   + +EE+DE+ R+ D D + ++ + EF+ +L 
Sbjct  106  LRHVMTKLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRMLV  147



>gb|AJK93879.1| calmodulin, partial [Trypanosoma cruzi]
Length=120

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L+  + EV ++   T+       L+ +     +  +EI+ VF  FD+D NG I   E
Sbjct  17   EAELQDMINEVDQDGSGTIDFPEFLTLMARKMQDSDSEEEIKEVFRVFDKDGNGFISAAE  76

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  +  L   + +EE+DE+ R  DVD + +I + EF+ ++ 
Sbjct  77   LRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKMMM  118



>dbj|BAN00003.1| photoactivatable calcium indicator PA-TNXL [synthetic construct]
Length=626

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 40/135 (30%), Positives = 69/135 (51%), Gaps = 11/135 (8%)
 Frame = +3

Query  144  SDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLK-  320
            + ++G+++   G       LD+ +E    EV  +   T+       L++     +E  K 
Sbjct  256  TKELGTVMRMLGQNPTKEELDAIIE----EVDEDGSGTIDFEEF--LVMMVRQMKEDAKG  309

Query  321  ----EIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  488
                E+   F  FD+D+NG ID EEL + L+    HV EE+I++L +  D D+N +I F+
Sbjct  310  KSEEELANCFRIFDKDANGFIDIEELGEILRATGEHVIEEDIEDLMKDSDKDNNGRIDFD  369

Query  489  EFIVLLCLIYLLMDA  533
            EF+ ++  +  LMD 
Sbjct  370  EFLKMMEGVQELMDG  384



>sp|P11118.2|CALM_EUGGR RecName: Full=Calmodulin; Short=CaM [Euglena gracilis]
 gb|ACH72984.1| calmodulin 1 [Euglena gracilis]
Length=149

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L+  + EV ++   T+       L+ +  H  +  +EI+  F  FD+D NG I   E
Sbjct  46   EAELQDMINEVDQDGSGTIDFPEFLTLMSRKMHDTDTEEEIKEAFRVFDKDGNGFISAAE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  +  L   + +EE+DE+ R  DVD + +I + EF+ ++ 
Sbjct  106  LRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKMMM  147



>ref|XP_007655162.1| PREDICTED: calmodulin-A-like [Ornithorhynchus anatinus]
Length=149

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 3/76 (4%)
 Frame = +3

Query  279  ALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCD  458
            A ++K P   +G   IR  F  FD+D NG I   EL++ L  L   + +EE+DE+ R  D
Sbjct  74   AQMMKDPEVEDG---IREAFRMFDKDGNGYISAAELRQVLATLGEKLTDEEVDEMIRGAD  130

Query  459  VDDNEKIKFNEFIVLL  506
             D + K+ + EF+ +L
Sbjct  131  TDGDGKVNYEEFVRVL  146



>ref|XP_006158525.1| PREDICTED: calmodulin-like protein 3 [Tupaia chinensis]
 gb|ELW48330.1| Calmodulin-like protein 3 [Tupaia chinensis]
Length=149

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +3

Query  204  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  383
            +++L+  V E+ ++   T+       ++ K     +  +EIR  F  FD+D NG +   E
Sbjct  46   EAELQEMVSEIDQDGNGTVDFPEFLGMMAKKMKDTDSEEEIRDAFRVFDKDGNGYVSAAE  105

Query  384  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
            L+  + +L   + +EE+DE+ R+ D D + ++ + EF+ +L 
Sbjct  106  LRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRMLV  147



>gb|EYB86370.1| hypothetical protein Y032_0280g1224 [Ancylostoma ceylanicum]
Length=205

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +3

Query  300  HFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKI  479
            + R+ LKE R +F  FD D +GAI  +ELK+ +  +  H  E EID + R  D D N +I
Sbjct  47   YTRKQLKEYRQLFNMFDTDGSGAIGNDELKQAMLSIGIHANEAEIDNVIREVDADGNGEI  106

Query  480  KFNEF  494
             F EF
Sbjct  107  DFEEF  111



>ref|XP_002016663.1| GL11701 [Drosophila persimilis]
 gb|EDW32553.1| GL11701 [Drosophila persimilis]
Length=148

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = +3

Query  195  SRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAID  374
            S  D++L+  + EV  +   ++ +    ++I++  H      E+R  F  FD+++NG I 
Sbjct  42   SPTDNELQAMINEVDADGNGSIELEEFASMIIRKMHDTNHEDELRDAFRVFDKENNGYIT  101

Query  375  REELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  509
              ELK  L  L   + ++EI+E+ R  D+D + ++ F EF+ ++ 
Sbjct  102  SSELKVVLTALGMKLPDDEIEEMIREYDIDQDGRLDFEEFVNMMT  146



>ref|XP_008619093.1| hypothetical protein SDRG_14719 [Saprolegnia diclina VS20]
 gb|EQC27519.1| hypothetical protein SDRG_14719 [Saprolegnia diclina VS20]
Length=287

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 62/121 (51%), Gaps = 2/121 (2%)
 Frame = +3

Query  195  SRLDSKLETKVLEVK--RNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGA  368
            S LDSKL   + E+K  ++            ++LK P  +E    +R  F +FD+   G 
Sbjct  31   STLDSKLMEALRELKARKDHDGGDKHDPFTKILLKGPALKEAFDSVRVTFREFDKQQKGF  90

Query  369  IDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGS  548
            I  ++++  L +L  +  + EIDE F   D+ +N ++ F EF+V L + ++L   P+  +
Sbjct  91   IVFDDMESALNRLGGNFTKAEIDEAFSEADMAENGQLSFKEFLVCLAMGFVLHRIPALET  150

Query  549  T  551
            T
Sbjct  151  T  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985