BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF021D10

Length=536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009593905.1|  PREDICTED: eukaryotic initiation factor 4A-9...    275   3e-90   Nicotiana tomentosiformis
ref|XP_002324737.1|  translation initiation factor eIF-4A family ...    279   3e-89   Populus trichocarpa [western balsam poplar]
ref|XP_011019413.1|  PREDICTED: eukaryotic initiation factor 4A-9...    278   5e-89   Populus euphratica
ref|XP_009757031.1|  PREDICTED: eukaryotic initiation factor 4A-9       278   7e-89   Nicotiana sylvestris
ref|XP_010927213.1|  PREDICTED: eukaryotic initiation factor 4A-2...    278   9e-89   Elaeis guineensis
ref|XP_010929386.1|  PREDICTED: eukaryotic initiation factor 4A-2       278   1e-88   Elaeis guineensis
gb|ABK93239.1|  unknown                                                 277   1e-88   Populus trichocarpa [western balsam poplar]
ref|XP_002308545.1|  translation initiation factor eIF-4A family ...    277   2e-88   Populus trichocarpa [western balsam poplar]
ref|XP_011038130.1|  PREDICTED: eukaryotic initiation factor 4A-15      277   2e-88   Populus euphratica
gb|AAL69381.1|AF462218_1  putative DEAD/DEAH box helicase               268   2e-88   Narcissus pseudonarcissus
ref|XP_010925445.1|  PREDICTED: eukaryotic initiation factor 4A-8...    276   2e-88   Elaeis guineensis
ref|XP_008798133.1|  PREDICTED: eukaryotic initiation factor 4A-14      276   2e-88   Phoenix dactylifera
gb|AFC90091.1|  eukaryotic initiation factor 4A-14                      276   3e-88   Nicotiana benthamiana
ref|XP_010242273.1|  PREDICTED: eukaryotic initiation factor 4A-11      275   6e-88   Nelumbo nucifera [Indian lotus]
ref|XP_011081667.1|  PREDICTED: eukaryotic initiation factor 4A-2       275   7e-88   Sesamum indicum [beniseed]
ref|XP_004245077.1|  PREDICTED: eukaryotic initiation factor 4A-2       275   8e-88   Solanum lycopersicum
sp|Q40466.1|IF413_TOBAC  RecName: Full=Eukaryotic initiation fact...    273   8e-88   Nicotiana tabacum [American tobacco]
ref|XP_011100200.1|  PREDICTED: eukaryotic initiation factor 4A-14      275   8e-88   Sesamum indicum [beniseed]
sp|Q40471.1|IF4A9_TOBAC  RecName: Full=Eukaryotic initiation fact...    275   9e-88   Nicotiana tabacum [American tobacco]
ref|XP_003533770.1|  PREDICTED: eukaryotic initiation factor 4A-1...    275   9e-88   
ref|XP_010915249.1|  PREDICTED: eukaryotic initiation factor 4A-8...    275   1e-87   Elaeis guineensis
ref|XP_010929385.1|  PREDICTED: eukaryotic initiation factor 4A-15      275   1e-87   Elaeis guineensis
gb|ACU18673.1|  unknown                                                 269   1e-87   Glycine max [soybeans]
gb|ACU22915.1|  unknown                                                 268   1e-87   Glycine max [soybeans]
emb|CDO97887.1|  unnamed protein product                                275   1e-87   Coffea canephora [robusta coffee]
gb|KHN28839.1|  Eukaryotic initiation factor 4A-15                      275   1e-87   Glycine soja [wild soybean]
ref|XP_006597014.1|  PREDICTED: uncharacterized protein LOC100786...    276   1e-87   
ref|XP_002521376.1|  dead box ATP-dependent RNA helicase, putative      275   2e-87   Ricinus communis
ref|XP_004303662.1|  PREDICTED: eukaryotic initiation factor 4A-8       274   2e-87   Fragaria vesca subsp. vesca
ref|XP_006342504.1|  PREDICTED: eukaryotic initiation factor 4A-2...    274   3e-87   Solanum tuberosum [potatoes]
gb|KHN32709.1|  Eukaryotic initiation factor 4A-10                      274   3e-87   Glycine soja [wild soybean]
ref|XP_008782542.1|  PREDICTED: eukaryotic initiation factor 4A-1...    273   3e-87   Phoenix dactylifera
gb|EYU29343.1|  hypothetical protein MIMGU_mgv1a007274mg                273   4e-87   Erythranthe guttata [common monkey flower]
ref|XP_009604758.1|  PREDICTED: eukaryotic initiation factor 4A-1...    273   4e-87   Nicotiana tomentosiformis
ref|XP_009604756.1|  PREDICTED: eukaryotic initiation factor 4A-7       273   4e-87   Nicotiana tomentosiformis
sp|Q40470.1|IF4A7_TOBAC  RecName: Full=Eukaryotic initiation fact...    273   4e-87   Nicotiana tabacum [American tobacco]
ref|XP_003543580.1|  PREDICTED: eukaryotic initiation factor 4A-1...    273   4e-87   Glycine max [soybeans]
ref|XP_009784285.1|  PREDICTED: eukaryotic initiation factor 4A-14      273   4e-87   Nicotiana sylvestris
ref|XP_009780782.1|  PREDICTED: eukaryotic initiation factor 4A-1...    273   4e-87   Nicotiana sylvestris
sp|P41379.1|IF4A2_NICPL  RecName: Full=Eukaryotic initiation fact...    273   4e-87   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P41382.1|IF410_TOBAC  RecName: Full=Eukaryotic initiation fact...    273   4e-87   Nicotiana tabacum [American tobacco]
ref|NP_001242064.1|  uncharacterized protein LOC100786735               273   4e-87   Glycine max [soybeans]
ref|XP_008801403.1|  PREDICTED: eukaryotic initiation factor 4A-15      273   5e-87   Phoenix dactylifera
sp|Q40467.1|IF414_TOBAC  RecName: Full=Eukaryotic initiation fact...    273   5e-87   Nicotiana tabacum [American tobacco]
ref|XP_006426587.1|  hypothetical protein CICLE_v10025724mg             273   6e-87   
gb|KHN30068.1|  Eukaryotic initiation factor 4A-10                      273   8e-87   Glycine soja [wild soybean]
ref|XP_004253093.1|  PREDICTED: eukaryotic initiation factor 4A-2       273   8e-87   Solanum lycopersicum
ref|XP_009602748.1|  PREDICTED: eukaryotic initiation factor 4A-11      272   9e-87   Nicotiana tomentosiformis
sp|Q40465.1|IF411_TOBAC  RecName: Full=Eukaryotic initiation fact...    272   9e-87   Nicotiana tabacum [American tobacco]
ref|XP_008220506.1|  PREDICTED: eukaryotic initiation factor 4A-1...    272   1e-86   Prunus mume [ume]
ref|XP_009597977.1|  PREDICTED: eukaryotic initiation factor 4A-15      272   1e-86   Nicotiana tomentosiformis
ref|XP_004291063.1|  PREDICTED: eukaryotic initiation factor 4A-2       272   1e-86   Fragaria vesca subsp. vesca
ref|XP_008798130.1|  PREDICTED: eukaryotic initiation factor 4A-8...    272   1e-86   Phoenix dactylifera
gb|KDP40743.1|  hypothetical protein JCGZ_24742                         272   1e-86   Jatropha curcas
ref|XP_004146811.1|  PREDICTED: eukaryotic initiation factor 4A-8...    272   1e-86   Cucumis sativus [cucumbers]
gb|ACU24597.1|  unknown                                                 266   1e-86   Glycine max [soybeans]
gb|ACU21478.1|  unknown                                                 272   1e-86   Glycine max [soybeans]
emb|CBI27885.3|  unnamed protein product                                272   1e-86   Vitis vinifera
gb|KHN39326.1|  Eukaryotic initiation factor 4A-10                      272   2e-86   Glycine soja [wild soybean]
ref|XP_003531602.1|  PREDICTED: eukaryotic initiation factor 4A-10      272   2e-86   Glycine max [soybeans]
ref|XP_006583001.1|  PREDICTED: eukaryotic initiation factor 4A-10      272   2e-86   Glycine max [soybeans]
ref|XP_009764703.1|  PREDICTED: eukaryotic initiation factor 4A-1...    272   2e-86   Nicotiana sylvestris
ref|XP_008447621.1|  PREDICTED: eukaryotic initiation factor 4A-8       271   2e-86   Cucumis melo [Oriental melon]
emb|CAN70196.1|  hypothetical protein VITISV_040309                     271   2e-86   Vitis vinifera
ref|XP_003522265.1|  PREDICTED: eukaryotic initiation factor 4A-11      271   2e-86   Glycine max [soybeans]
gb|AAR23806.1|  initiation factor eIF4A-15                              271   3e-86   Helianthus annuus
ref|XP_008462340.1|  PREDICTED: eukaryotic initiation factor 4A-11      271   4e-86   Cucumis melo [Oriental melon]
gb|KHN06630.1|  Eukaryotic initiation factor 4A-15                      271   4e-86   Glycine soja [wild soybean]
ref|XP_010094955.1|  Eukaryotic initiation factor 4A-13                 265   4e-86   Morus notabilis
ref|XP_007150491.1|  hypothetical protein PHAVU_005G157100g             271   4e-86   Phaseolus vulgaris [French bean]
ref|XP_004141688.1|  PREDICTED: eukaryotic initiation factor 4A-1...    271   4e-86   Cucumis sativus [cucumbers]
gb|KJB56905.1|  hypothetical protein B456_009G142800                    268   5e-86   Gossypium raimondii
ref|XP_007222702.1|  hypothetical protein PRUPE_ppa006409mg             270   5e-86   Prunus persica
ref|XP_010262239.1|  PREDICTED: uncharacterized protein LOC104600806    283   5e-86   
gb|EYU21355.1|  hypothetical protein MIMGU_mgv1a0072631mg               270   5e-86   Erythranthe guttata [common monkey flower]
gb|KHG04102.1|  Eukaryotic initiation factor 4A-14                      267   6e-86   Gossypium arboreum [tree cotton]
ref|XP_003526019.1|  PREDICTED: eukaryotic initiation factor 4A-11      270   6e-86   Glycine max [soybeans]
ref|XP_007215455.1|  hypothetical protein PRUPE_ppa006399mg             270   7e-86   Prunus persica
emb|CAN61608.1|  hypothetical protein VITISV_040122                     270   7e-86   Vitis vinifera
ref|XP_007135520.1|  hypothetical protein PHAVU_010G136300g             270   8e-86   Phaseolus vulgaris [French bean]
emb|CDP08290.1|  unnamed protein product                                270   8e-86   Coffea canephora [robusta coffee]
ref|XP_008793233.1|  PREDICTED: eukaryotic initiation factor 4A-1...    270   9e-86   Phoenix dactylifera
gb|KDP33852.1|  hypothetical protein JCGZ_07423                         270   9e-86   Jatropha curcas
ref|XP_004510408.1|  PREDICTED: eukaryotic initiation factor 4A-1...    270   1e-85   Cicer arietinum [garbanzo]
ref|XP_010927212.1|  PREDICTED: eukaryotic initiation factor 4A-1...    270   1e-85   Elaeis guineensis
ref|XP_004513437.1|  PREDICTED: eukaryotic initiation factor 4A-1...    270   1e-85   
ref|XP_009399791.1|  PREDICTED: eukaryotic initiation factor 4A-8       269   2e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403035.1|  PREDICTED: eukaryotic initiation factor 4A-1...    269   2e-85   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB56903.1|  hypothetical protein B456_009G142800                    269   2e-85   Gossypium raimondii
ref|XP_007024535.1|  Eukaryotic translation initiation factor 4A1...    269   2e-85   Theobroma cacao [chocolate]
ref|XP_008379513.1|  PREDICTED: eukaryotic initiation factor 4A-8       269   3e-85   Malus domestica [apple tree]
gb|KJB70132.1|  hypothetical protein B456_011G063400                    269   3e-85   Gossypium raimondii
ref|XP_008392378.1|  PREDICTED: eukaryotic initiation factor 4A-8       269   3e-85   Malus domestica [apple tree]
gb|AFK40852.1|  unknown                                                 269   3e-85   Lotus japonicus
emb|CBI35913.3|  unnamed protein product                                262   3e-85   Vitis vinifera
ref|XP_002278119.1|  PREDICTED: eukaryotic initiation factor 4A-11      268   3e-85   Vitis vinifera
ref|XP_008337727.1|  PREDICTED: eukaryotic initiation factor 4A-11      268   3e-85   Malus domestica [apple tree]
ref|XP_008377701.1|  PREDICTED: eukaryotic initiation factor 4A-1...    268   4e-85   
ref|XP_003595233.1|  Eukaryotic initiation factor 4A                    268   4e-85   Medicago truncatula
ref|XP_007138709.1|  hypothetical protein PHAVU_009G230600g             268   4e-85   Phaseolus vulgaris [French bean]
gb|KHG23060.1|  Eukaryotic initiation factor 4A-9                       262   4e-85   Gossypium arboreum [tree cotton]
ref|XP_009385793.1|  PREDICTED: eukaryotic initiation factor 4A-1...    268   5e-85   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q40468.1|IF415_TOBAC  RecName: Full=Eukaryotic initiation fact...    268   5e-85   Nicotiana tabacum [American tobacco]
gb|AAN74635.1|  DEAD box RNA helicase                                   268   5e-85   Pisum sativum [garden pea]
gb|EYU29345.1|  hypothetical protein MIMGU_mgv1a007246mg                268   5e-85   Erythranthe guttata [common monkey flower]
ref|XP_010669372.1|  PREDICTED: eukaryotic initiation factor 4A-9       268   5e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009372398.1|  PREDICTED: eukaryotic initiation factor 4A-8       268   5e-85   Pyrus x bretschneideri [bai li]
gb|KHN17683.1|  Eukaryotic initiation factor 4A-15                      268   6e-85   Glycine soja [wild soybean]
ref|XP_011079970.1|  PREDICTED: eukaryotic initiation factor 4A-8       268   6e-85   Sesamum indicum [beniseed]
ref|XP_009389913.1|  PREDICTED: eukaryotic initiation factor 4A-11      268   7e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415521.1|  PREDICTED: eukaryotic initiation factor 4A-15      268   8e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003627168.1|  Eukaryotic initiation factor 4A                    267   8e-85   Medicago truncatula
ref|XP_011010150.1|  PREDICTED: eukaryotic initiation factor 4A-8       267   1e-84   Populus euphratica
ref|XP_002304104.1|  translation initiation factor 4A family protein    267   2e-84   
ref|XP_003597562.1|  Eukaryotic initiation factor 4A                    266   2e-84   Medicago truncatula
ref|XP_007202168.1|  hypothetical protein PRUPE_ppa006450mg             266   2e-84   Prunus persica
ref|XP_006338111.1|  PREDICTED: eukaryotic initiation factor 4A-1...    266   2e-84   Solanum tuberosum [potatoes]
gb|KJB34989.1|  hypothetical protein B456_006G095400                    266   2e-84   Gossypium raimondii
ref|XP_007136846.1|  hypothetical protein PHAVU_009G079100g             266   3e-84   Phaseolus vulgaris [French bean]
ref|XP_004253094.1|  PREDICTED: eukaryotic initiation factor 4A-2...    266   3e-84   Solanum lycopersicum
ref|XP_006342502.1|  PREDICTED: eukaryotic initiation factor 4A-2...    266   3e-84   Solanum tuberosum [potatoes]
ref|XP_007012323.1|  Eukaryotic translation initiation factor 4A1       266   3e-84   Theobroma cacao [chocolate]
ref|XP_002277703.1|  PREDICTED: eukaryotic initiation factor 4A-8       266   4e-84   Vitis vinifera
ref|XP_009381599.1|  PREDICTED: eukaryotic initiation factor 4A-9...    266   4e-84   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY72259.1|  BnaCnng76770D                                          259   5e-84   Brassica napus [oilseed rape]
ref|XP_010049453.1|  PREDICTED: eukaryotic initiation factor 4A-15      265   5e-84   
ref|XP_010322836.1|  PREDICTED: eukaryotic initiation factor 4A-8...    265   6e-84   Solanum lycopersicum
dbj|BAJ89461.1|  predicted protein                                      265   9e-84   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB54655.1|  hypothetical protein B456_009G043400                    265   9e-84   Gossypium raimondii
ref|XP_003563508.1|  PREDICTED: eukaryotic initiation factor 4A         265   9e-84   Brachypodium distachyon [annual false brome]
ref|XP_009410226.1|  PREDICTED: eukaryotic initiation factor 4A-9...    265   9e-84   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS65096.1|  hypothetical protein M569_09681                         265   9e-84   Genlisea aurea
dbj|BAJ85348.1|  predicted protein                                      265   1e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010033764.1|  PREDICTED: eukaryotic initiation factor 4A-2...    265   1e-83   Eucalyptus grandis [rose gum]
sp|P41378.1|IF4A_WHEAT  RecName: Full=Eukaryotic initiation facto...    265   1e-83   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009798256.1|  PREDICTED: eukaryotic initiation factor 4A-8       265   1e-83   Nicotiana sylvestris
ref|XP_006656443.1|  PREDICTED: eukaryotic initiation factor 4A-1...    265   1e-83   Oryza brachyantha
dbj|BAA02152.1|  eukaryotic initiation factor 4A                        265   1e-83   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ96964.1|  predicted protein                                      265   1e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P41381.1|IF4A8_TOBAC  RecName: Full=Eukaryotic initiation fact...    264   1e-83   Nicotiana tabacum [American tobacco]
ref|NP_001058481.1|  Os06g0701100                                       264   1e-83   
gb|EAZ02256.1|  hypothetical protein OsI_24355                          265   1e-83   Oryza sativa Indica Group [Indian rice]
gb|AIZ68204.1|  eukaryotic initiation factor 4A-14                      264   2e-83   Ornithogalum longebracteatum [sea-onion]
gb|ACJ84921.1|  unknown                                                 264   2e-83   Medicago truncatula
ref|XP_010087709.1|  Eukaryotic initiation factor 4A-8                  264   2e-83   
ref|XP_010322839.1|  PREDICTED: eukaryotic initiation factor 4A-8...    264   2e-83   Solanum lycopersicum
ref|XP_011072546.1|  PREDICTED: eukaryotic initiation factor 4A-8...    263   3e-83   Sesamum indicum [beniseed]
ref|XP_006357714.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic i...    263   3e-83   
emb|CDX82505.1|  BnaA03g33160D                                          264   4e-83   
ref|XP_010656491.1|  PREDICTED: uncharacterized protein LOC100244028    273   4e-83   Vitis vinifera
ref|XP_006338110.1|  PREDICTED: eukaryotic initiation factor 4A-1...    263   4e-83   
ref|XP_010501441.1|  PREDICTED: eukaryotic initiation factor 4A-1       263   5e-83   Camelina sativa [gold-of-pleasure]
ref|XP_006474427.1|  PREDICTED: eukaryotic initiation factor 4A-9...    263   5e-83   Citrus sinensis [apfelsine]
ref|XP_007012324.1|  Eukaryotic translation initiation factor 4A1       263   5e-83   Theobroma cacao [chocolate]
ref|NP_001105396.1|  translational initiation factor eIF-4A             263   6e-83   
ref|XP_006297793.1|  hypothetical protein CARUB_v10013828mg             263   6e-83   Capsella rubella
ref|XP_009135344.1|  PREDICTED: eukaryotic initiation factor 4A-1...    263   6e-83   Brassica rapa
gb|AFW75865.1|  putative DEAD-box ATP-dependent RNA helicase fami...    263   6e-83   
ref|XP_009106914.1|  PREDICTED: eukaryotic initiation factor 4A-1...    263   6e-83   Brassica rapa
emb|CDY02469.1|  BnaA08g00760D                                          263   7e-83   
gb|KJB65513.1|  hypothetical protein B456_010G098500                    263   7e-83   Gossypium raimondii
ref|XP_009624936.1|  PREDICTED: eukaryotic initiation factor 4A-8...    262   7e-83   Nicotiana tomentosiformis
ref|XP_002438954.1|  hypothetical protein SORBIDRAFT_10g028940          262   7e-83   Sorghum bicolor [broomcorn]
gb|ACN34609.1|  unknown                                                 262   8e-83   Zea mays [maize]
ref|XP_004966111.1|  PREDICTED: eukaryotic initiation factor 4A-3...    262   8e-83   Setaria italica
gb|AAY33860.1|  eukaryotic initiation factor 4A                         262   9e-83   Cenchrus americanus [bulrush millet]
ref|XP_006601410.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    272   1e-82   
gb|KHG25459.1|  Eukaryotic initiation factor 4A-8                       258   1e-82   Gossypium arboreum [tree cotton]
ref|XP_010688701.1|  PREDICTED: eukaryotic initiation factor 4A-9...    261   1e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002884997.1|  predicted protein                                  261   2e-82   Arabidopsis lyrata subsp. lyrata
ref|XP_007154632.1|  hypothetical protein PHAVU_003G134800g             261   2e-82   Phaseolus vulgaris [French bean]
ref|XP_006595337.1|  PREDICTED: eukaryotic initiation factor 4A-14      271   2e-82   
gb|ACJ85073.1|  unknown                                                 260   2e-82   Medicago truncatula
ref|XP_006453067.1|  hypothetical protein CICLE_v10008468mg             261   2e-82   Citrus clementina [clementine]
ref|XP_006307670.1|  hypothetical protein CARUB_v10009297mg             261   2e-82   Capsella rubella
ref|XP_010502017.1|  PREDICTED: eukaryotic initiation factor 4A-2...    256   2e-82   Camelina sativa [gold-of-pleasure]
gb|KEH32494.1|  DEAD-box ATP-dependent RNA helicase                     261   2e-82   Medicago truncatula
emb|CDX75739.1|  BnaC03g38220D                                          262   2e-82   
ref|XP_009334733.1|  PREDICTED: eukaryotic initiation factor 4A-1...    261   2e-82   
gb|EMS68416.1|  Eukaryotic initiation factor 4A-1                       261   3e-82   Triticum urartu
ref|XP_010062659.1|  PREDICTED: eukaryotic initiation factor 4A-1...    261   3e-82   Eucalyptus grandis [rose gum]
emb|CDX97528.1|  BnaA05g25510D                                          261   3e-82   
emb|CDY39079.1|  BnaA01g29770D                                          261   3e-82   Brassica napus [oilseed rape]
ref|XP_006453066.1|  hypothetical protein CICLE_v10008460mg             261   3e-82   Citrus clementina [clementine]
ref|XP_006407149.1|  hypothetical protein EUTSA_v10020824mg             261   3e-82   
ref|XP_007012776.1|  Eukaryotic translation initiation factor 4A1...    261   4e-82   
emb|CDY55205.1|  BnaCnng28430D                                          261   4e-82   Brassica napus [oilseed rape]
ref|XP_010552222.1|  PREDICTED: eukaryotic initiation factor 4A-1...    254   5e-82   Tarenaya hassleriana [spider flower]
ref|XP_006853908.1|  hypothetical protein AMTR_s00036p00181640          260   5e-82   Amborella trichopoda
emb|CDP03140.1|  unnamed protein product                                260   5e-82   Coffea canephora [robusta coffee]
emb|CDY10607.1|  BnaC03g70070D                                          260   5e-82   Brassica napus [oilseed rape]
gb|KEH32495.1|  DEAD-box ATP-dependent RNA helicase                     260   5e-82   Medicago truncatula
dbj|BAH56988.1|  AT3G13920                                              259   6e-82   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001104874.1|  translation initiation factor                      260   6e-82   Zea mays [maize]
ref|XP_003574572.1|  PREDICTED: eukaryotic initiation factor 4A-1...    260   7e-82   Brachypodium distachyon [annual false brome]
ref|XP_004951905.1|  PREDICTED: eukaryotic initiation factor 4A-like    260   7e-82   Setaria italica
gb|AAL91176.1|  eukaryotic translation initiation factor                260   7e-82   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566469.1|  translational initiation factor 4A-1                  259   9e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009361722.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   9e-82   
gb|AAM63951.1|  Eukaryotic initiation factor 4A, putative               259   9e-82   Arabidopsis thaliana [mouse-ear cress]
emb|CDY08220.1|  BnaA05g13990D                                          259   1e-81   Brassica napus [oilseed rape]
ref|XP_009107078.1|  PREDICTED: eukaryotic initiation factor 4A-1       259   1e-81   Brassica rapa
ref|XP_006357392.1|  PREDICTED: eukaryotic initiation factor 4A-8...    259   1e-81   
ref|XP_011046150.1|  PREDICTED: eukaryotic initiation factor 4A-8...    259   1e-81   Populus euphratica
ref|XP_006369263.1|  hypothetical protein POPTR_0001s20480g             259   1e-81   
ref|XP_006392695.1|  hypothetical protein EUTSA_v10011528mg             259   1e-81   Eutrema salsugineum [saltwater cress]
ref|XP_001786409.1|  predicted protein                                  252   2e-81   
dbj|BAE98559.1|  eukaryotic protein synthesis initiation factor 4A      259   2e-81   Arabidopsis thaliana [mouse-ear cress]
gb|EPS63850.1|  hypothetical protein M569_10933                         259   2e-81   Genlisea aurea
ref|NP_001030693.1|  translational initiation factor 4A-1               259   2e-81   
ref|XP_010536184.1|  PREDICTED: eukaryotic initiation factor 4A-9...    259   2e-81   Tarenaya hassleriana [spider flower]
ref|XP_010480021.1|  PREDICTED: eukaryotic initiation factor 4A-1...    258   3e-81   Camelina sativa [gold-of-pleasure]
ref|XP_006646878.1|  PREDICTED: eukaryotic initiation factor 4A-3...    258   3e-81   Oryza brachyantha
ref|NP_001045878.1|  Os02g0146600                                       258   4e-81   
emb|CDY24057.1|  BnaA06g00550D                                          258   5e-81   Brassica napus [oilseed rape]
ref|XP_010462344.1|  PREDICTED: eukaryotic initiation factor 4A-1...    258   5e-81   
ref|XP_009147530.1|  PREDICTED: eukaryotic initiation factor 4A-1       257   6e-81   Brassica rapa
ref|XP_009334734.1|  PREDICTED: eukaryotic initiation factor 4A-1...    257   7e-81   
gb|EYU45869.1|  hypothetical protein MIMGU_mgv1a007331mg                257   7e-81   Erythranthe guttata [common monkey flower]
ref|XP_009117360.1|  PREDICTED: eukaryotic initiation factor 4A-1...    257   7e-81   Brassica rapa
ref|XP_002451536.1|  hypothetical protein SORBIDRAFT_04g003390          257   8e-81   Sorghum bicolor [broomcorn]
ref|XP_004486853.1|  PREDICTED: eukaryotic initiation factor 4A-1...    257   9e-81   Cicer arietinum [garbanzo]
ref|XP_009598422.1|  PREDICTED: eukaryotic initiation factor 4A-9...    250   9e-81   Nicotiana tomentosiformis
ref|XP_010542416.1|  PREDICTED: eukaryotic initiation factor 4A-1       257   1e-80   Tarenaya hassleriana [spider flower]
gb|AFW69337.1|  putative DEAD-box ATP-dependent RNA helicase fami...    256   1e-80   
ref|NP_001151064.1|  LOC100284697                                       256   1e-80   Zea mays [maize]
sp|Q41741.1|IF4A_MAIZE  RecName: Full=Eukaryotic initiation facto...    256   1e-80   Zea mays [maize]
ref|XP_010534921.1|  PREDICTED: eukaryotic initiation factor 4A-1       256   2e-80   Tarenaya hassleriana [spider flower]
ref|XP_009146433.1|  PREDICTED: eukaryotic initiation factor 4A-1...    256   2e-80   Brassica rapa
ref|XP_008242400.1|  PREDICTED: eukaryotic initiation factor 4A-2       265   3e-80   
ref|XP_001783934.1|  predicted protein                                  255   4e-80   
ref|XP_009334735.1|  PREDICTED: eukaryotic initiation factor 4A-6...    255   6e-80   
emb|CDY33073.1|  BnaC06g07060D                                          255   6e-80   Brassica napus [oilseed rape]
ref|XP_009334732.1|  PREDICTED: eukaryotic initiation factor 4A-6...    255   7e-80   
ref|XP_002514133.1|  dead box ATP-dependent RNA helicase, putative      263   7e-80   
ref|XP_001758216.1|  predicted protein                                  254   8e-80   
ref|XP_002891805.1|  predicted protein                                  254   1e-79   Arabidopsis lyrata subsp. lyrata
ref|XP_001765568.1|  predicted protein                                  254   1e-79   
ref|NP_175829.1|  eukaryotic initiation factor 4A-2                     253   2e-79   Arabidopsis thaliana [mouse-ear cress]
gb|ABR18348.1|  unknown                                                 253   4e-79   Picea sitchensis
ref|XP_010324046.1|  PREDICTED: eukaryotic initiation factor 4A-9...    253   5e-79   Solanum lycopersicum
ref|XP_001771324.1|  predicted protein                                  252   1e-78   
ref|XP_010090077.1|  Eukaryotic initiation factor 4A-15                 261   3e-78   
ref|XP_004508240.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    260   6e-78   
ref|XP_011470735.1|  PREDICTED: eukaryotic initiation factor 4A-9       258   1e-77   Fragaria vesca subsp. vesca
gb|AAN74636.1|  DEAD box RNA helicase                                   248   2e-77   Pisum sativum [garden pea]
emb|CDY49861.1|  BnaA02g16100D                                          248   5e-77   Brassica napus [oilseed rape]
ref|XP_009779503.1|  PREDICTED: eukaryotic initiation factor 4A-9...    247   7e-77   Nicotiana sylvestris
emb|CDY53867.1|  BnaC02g46260D                                          247   1e-76   Brassica napus [oilseed rape]
ref|XP_009127948.1|  PREDICTED: eukaryotic initiation factor 4A-3...    246   1e-76   Brassica rapa
ref|XP_009105938.1|  PREDICTED: eukaryotic initiation factor 4A-3       244   2e-75   Brassica rapa
ref|XP_002966250.1|  hypothetical protein SELMODRAFT_85554              243   2e-75   
ref|XP_006390626.1|  hypothetical protein EUTSA_v10018626mg             243   2e-75   Eutrema salsugineum [saltwater cress]
ref|XP_006302320.1|  hypothetical protein CARUB_v10020373mg             243   2e-75   Capsella rubella
gb|ABS19813.1|  eukaryotic initiation factor 4A                         240   3e-75   Lolium perenne [perennial ryegrass]
ref|NP_001189885.1|  translational initiation factor 4A-1               243   3e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72939.1|  BnaC06g33870D                                          244   6e-75   
dbj|BAB21258.1|  eukaryotic initiation factor 4A                        241   1e-74   Oryza sativa [red rice]
gb|ACA24135.1|  eukaryotic initiation factor 4A                         239   1e-74   Lolium temulentum
ref|XP_009127949.1|  PREDICTED: eukaryotic initiation factor 4A-3...    240   2e-74   Brassica rapa
ref|XP_010416036.1|  PREDICTED: eukaryotic initiation factor 4A-3       239   5e-74   Camelina sativa [gold-of-pleasure]
emb|CDY68148.1|  BnaA07g38930D                                          246   2e-73   Brassica napus [oilseed rape]
ref|XP_009334736.1|  PREDICTED: eukaryotic initiation factor 4A-6...    238   3e-73   
gb|ABS19814.1|  eukaryotic initiation factor 4A                         235   4e-73   Lolium perenne [perennial ryegrass]
ref|NP_001185220.1|  eukaryotic initiation factor 4A-2                  237   6e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002524306.1|  dead box ATP-dependent RNA helicase, putative      236   8e-73   
gb|ACN40356.1|  unknown                                                 236   2e-72   Picea sitchensis
ref|XP_009132534.1|  PREDICTED: eukaryotic initiation factor 4A-1...    234   5e-72   Brassica rapa
ref|NP_177417.1|  eukaryotic initiation factor 4A-3                     234   6e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888890.1|  predicted protein                                  234   7e-72   Arabidopsis lyrata subsp. lyrata
emb|CAA09211.1|  RNA helicase                                           235   8e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CDY32586.1|  BnaC03g15540D                                          233   9e-72   Brassica napus [oilseed rape]
gb|ACN40838.1|  unknown                                                 233   2e-71   Picea sitchensis
ref|XP_002966232.1|  hypothetical protein SELMODRAFT_143895             233   3e-71   Selaginella moellendorffii
ref|XP_002982302.1|  hypothetical protein SELMODRAFT_228839             233   3e-71   
gb|ACN40422.1|  unknown                                                 233   3e-71   Picea sitchensis
gb|KEH39505.1|  DEAD-box ATP-dependent RNA helicase                     229   4e-70   Medicago truncatula
ref|NP_001078148.1|  translational initiation factor 4A-1               226   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009624937.1|  PREDICTED: eukaryotic initiation factor 4A-8...    226   5e-69   Nicotiana tomentosiformis
gb|ACJ84368.1|  unknown                                                 213   2e-67   
emb|CDP15708.1|  unnamed protein product                                218   1e-66   
ref|XP_005644820.1|  eukaryotic initiation factor 4A-like protein       219   5e-66   
ref|XP_005845171.1|  eukaryotic initiation factor 4A (ATP-depende...    215   1e-64   
ref|XP_003058151.1|  predicted protein                                  215   2e-64   
ref|XP_002499673.1|  hypothetical protein MICPUN_106753                 215   2e-64   
ref|XP_001691452.1|  eukaryotic initiation factor 4A-like protein       211   8e-63   
emb|CEF98795.1|  Helicase, C-terminal                                   210   1e-62   
emb|CDY11154.1|  BnaC06g24060D                                          202   7e-62   
ref|XP_002951303.1|  hypothetical protein VOLCADRAFT_120953             208   8e-62   
ref|XP_004489750.1|  PREDICTED: eukaryotic initiation factor 4A-8...    201   1e-61   
gb|AFC88837.1|  initiation factor 4A-3-like protein                     205   4e-61   
gb|KIZ04417.1|  Eukaryotic initiation factor 4A-3                       206   9e-61   
ref|XP_007513631.1|  predicted protein                                  205   9e-61   
ref|XP_002516092.1|  dead box ATP-dependent RNA helicase, putative      202   2e-60   
gb|AAQ08996.1|  translation initiation factor 4A                        195   2e-60   
ref|XP_001418972.1|  predicted protein                                  204   3e-60   
gb|KDD74664.1|  DEAD/DEAH box helicase                                  204   5e-60   
gb|AID52925.1|  initiation factor eIF4A                                 197   3e-59   
ref|XP_011398174.1|  Eukaryotic initiation factor 4A-10                 200   4e-59   
ref|XP_010514906.1|  PREDICTED: eukaryotic initiation factor 4A-2...    199   1e-58   
ref|XP_006300238.1|  hypothetical protein CARUB_v10016478mg             199   4e-58   
ref|XP_010501104.1|  PREDICTED: eukaryotic initiation factor 4A-1...    196   1e-57   
gb|KDO65151.1|  hypothetical protein CISIN_1g015129mg                   196   2e-57   
emb|CAC43286.1|  translation initiation factor eIF-4A1                  196   2e-57   
ref|XP_010552227.1|  PREDICTED: eukaryotic initiation factor 4A-1       195   3e-57   
ref|XP_006279086.1|  hypothetical protein CARUB_v10012714mg             195   7e-57   
gb|AFJ42571.1|  elongation initiation factor 4A                         189   2e-55   
emb|CBI20639.3|  unnamed protein product                                176   1e-52   
ref|XP_007217768.1|  hypothetical protein PRUPE_ppa014802mg             176   2e-49   
gb|AAK83983.1|AF393811_1  eukaryotic initiation factor 4A -like p...    167   5e-49   
gb|AFY99068.1|  translation initiation factor                           165   6e-49   
gb|AFY99066.1|  translation initiation factor                           164   3e-48   
gb|AFY99067.1|  translation initiation factor                           162   1e-47   
gb|AFY99065.1|  translation initiation factor                           162   1e-47   
dbj|BAP46432.1|  eukaryotic initiation factor 4A                        161   2e-47   
ref|NP_001091916.1|  eukaryotic initiation factor 4a                    171   2e-47   
emb|CAF89463.1|  unnamed protein product                                163   3e-47   
ref|XP_010234049.1|  PREDICTED: ATP-dependent RNA helicase drs1-like    175   5e-47   
ref|XP_010533343.1|  PREDICTED: eukaryotic initiation factor 4A-1...    168   7e-47   
gb|KJB65515.1|  hypothetical protein B456_010G098500                    168   7e-47   
gb|AAF19805.1|  EIF4A protein                                           167   1e-46   
gb|EMS64960.1|  Eukaryotic initiation factor 4A-7                       168   2e-46   
ref|XP_009764706.1|  PREDICTED: eukaryotic initiation factor 4A-6...    167   3e-46   
gb|KIH56011.1|  DEAD/DEAH box helicase                                  164   3e-46   
ref|XP_011421101.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   4e-46   
emb|CDQ56285.1|  unnamed protein product                                167   5e-46   
ref|XP_006825894.1|  PREDICTED: eukaryotic initiation factor 4A-I...    167   5e-46   
ref|XP_741188.1|  RNA helicase-1                                        162   7e-46   
pdb|3BOR|A  Chain A, Crystal Structure Of The Deadc Domain Of Hum...    162   8e-46   
dbj|BAN20868.1|  eukaryotic initiation factor 4a                        166   8e-46   
gb|AFP57571.1|  eukaryotic initiation factor 4A                         162   1e-45   
ref|XP_005802438.1|  PREDICTED: eukaryotic initiation factor 4A-I...    166   1e-45   
ref|XP_005802437.1|  PREDICTED: eukaryotic initiation factor 4A-I...    166   1e-45   
ref|XP_003437851.1|  PREDICTED: eukaryotic initiation factor 4A-I...    166   1e-45   
ref|XP_004078949.1|  PREDICTED: eukaryotic initiation factor 4A-I...    166   1e-45   
ref|XP_008282835.1|  PREDICTED: eukaryotic initiation factor 4A-II      166   1e-45   
ref|XP_005476057.1|  PREDICTED: eukaryotic initiation factor 4A-I...    166   1e-45   
gb|EDL78075.1|  eukaryotic translation initiation factor 4A2, iso...    159   2e-45   
ref|XP_005989463.1|  PREDICTED: eukaryotic initiation factor 4A-I...    165   2e-45   
ref|XP_001348829.1|  helicase 45                                        165   2e-45   
emb|CCQ18648.1|  Translation initiation factor 4F, helicase subunit     166   2e-45   
ref|XP_005989465.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   2e-45   
ref|XP_002260177.1|  RNA helicase                                       165   2e-45   
ref|XP_008813934.1|  eukaryotic initiation factor 4A                    165   2e-45   
gb|ETE63526.1|  Eukaryotic initiation factor 4A-II                      164   2e-45   
gb|ETW15723.1|  eukaryotic initiation factor 4A                         165   2e-45   
gb|ETW33322.1|  eukaryotic initiation factor 4A                         165   2e-45   
ref|XP_006262091.1|  PREDICTED: eukaryotic initiation factor 4A-II      164   2e-45   
gb|ETW39547.1|  eukaryotic initiation factor 4A                         165   2e-45   
emb|CCF72996.1|  unnamed protein product                                165   3e-45   
ref|XP_006637457.1|  PREDICTED: eukaryotic initiation factor 4A-I...    165   3e-45   
ref|XP_001615701.1|  RNA helicase-1                                     164   3e-45   
ref|XP_007071060.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   3e-45   
ref|XP_005989462.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   3e-45   
ref|XP_006637458.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   3e-45   
ref|XP_005506650.1|  PREDICTED: eukaryotic initiation factor 4A-II      164   3e-45   
ref|XP_010395597.1|  PREDICTED: eukaryotic initiation factor 4A-II      164   3e-45   
gb|EKG22315.1|  RNA helicase ATP-dependent DEAD-box conserved site      164   3e-45   
ref|XP_009074201.1|  PREDICTED: eukaryotic initiation factor 4A-II      164   4e-45   
ref|XP_007764392.1|  DEAD-domain-containing protein                     164   4e-45   
ref|XP_010732076.1|  PREDICTED: eukaryotic initiation factor 4A-II      164   4e-45   
ref|XP_005895572.1|  PREDICTED: eukaryotic initiation factor 4A-I...    160   4e-45   
ref|XP_005024716.1|  PREDICTED: eukaryotic initiation factor 4A-I...    163   4e-45   
ref|XP_003975803.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   4e-45   
ref|XP_006219988.1|  PREDICTED: eukaryotic initiation factor 4A-like    160   4e-45   
ref|XP_002163229.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   4e-45   
gb|EYC01872.1|  hypothetical protein Y032_0103g3516                     164   5e-45   
gb|EFA77714.1|  DEAD/DEAH box helicase domain-containing protein        164   5e-45   
gb|EOA97603.1|  Eukaryotic initiation factor 4A-II                      164   5e-45   
gb|EMC85744.1|  Eukaryotic initiation factor 4A-II                      164   5e-45   
gb|KFQ16858.1|  Eukaryotic initiation factor 4A-II                      164   5e-45   
ref|XP_007250744.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   5e-45   
ref|XP_007587937.1|  putative atp-dependent rna helicase eif4a pr...    164   6e-45   
ref|NP_998616.2|  eukaryotic initiation factor 4A-II                    164   6e-45   
dbj|BAG64309.1|  unnamed protein product                                157   6e-45   
ref|NP_989880.1|  eukaryotic initiation factor 4A-II                    164   6e-45   
ref|XP_007884153.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   6e-45   
ref|XP_006884231.1|  PREDICTED: eukaryotic initiation factor 4A-II      161   6e-45   
ref|XP_003225744.1|  PREDICTED: eukaryotic initiation factor 4A-II      164   7e-45   
ref|XP_002196090.1|  PREDICTED: eukaryotic initiation factor 4A-II      164   7e-45   
ref|XP_005644822.1|  eukaryotic initiation factor 4A-11                 163   7e-45   
ref|XP_007071059.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   7e-45   
ref|XP_006138538.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   7e-45   
ref|XP_005146991.1|  PREDICTED: eukaryotic initiation factor 4A-I...    163   8e-45   
ref|XP_009901849.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   8e-45   
ref|XP_005024715.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   8e-45   
ref|XP_005051294.1|  PREDICTED: eukaryotic initiation factor 4A-I...    163   8e-45   
ref|XP_009901850.1|  PREDICTED: eukaryotic initiation factor 4A-I...    163   8e-45   
ref|XP_005024714.1|  PREDICTED: eukaryotic initiation factor 4A-I...    163   8e-45   
ref|XP_009997708.1|  PREDICTED: eukaryotic initiation factor 4A-I...    163   8e-45   
ref|XP_008228382.1|  PREDICTED: eukaryotic initiation factor 4A-1...    162   8e-45   
emb|CDJ93494.1|  DNA RNA helicase domain containing protein             160   8e-45   
ref|XP_009997700.1|  PREDICTED: eukaryotic initiation factor 4A-I...    163   8e-45   
ref|XP_008491602.1|  PREDICTED: eukaryotic initiation factor 4A-I...    163   8e-45   
ref|XP_007195306.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   8e-45   
ref|XP_010223876.1|  PREDICTED: eukaryotic initiation factor 4A-II      163   8e-45   
ref|XP_005146992.1|  PREDICTED: eukaryotic initiation factor 4A-I...    163   8e-45   
gb|KIJ59695.1|  hypothetical protein HYDPIDRAFT_118189                  163   9e-45   
ref|XP_008168912.1|  PREDICTED: eukaryotic initiation factor 4A-I...    164   9e-45   
ref|XP_008491601.1|  PREDICTED: eukaryotic initiation factor 4A-I...    163   9e-45   
ref|XP_006017190.1|  PREDICTED: eukaryotic initiation factor 4A-I...    163   9e-45   
ref|XP_006017189.1|  PREDICTED: eukaryotic initiation factor 4A-I...    163   9e-45   
ref|XP_003747632.1|  PREDICTED: eukaryotic initiation factor 4A-I...    163   1e-44   
dbj|BAE36681.1|  unnamed protein product                                158   1e-44   
gb|KIN99522.1|  hypothetical protein M404DRAFT_1004624                  160   1e-44   
ref|NP_001279576.1|  eukaryotic translation initiation factor 4A2       163   1e-44   
ref|XP_004473759.1|  PREDICTED: eukaryotic initiation factor 4A-I...    160   1e-44   
gb|KIW32961.1|  ATP-dependent RNA helicase eIF4A                        162   1e-44   
ref|XP_007746836.1|  ATP-dependent RNA helicase eIF4A                   162   1e-44   
dbj|BAB27678.2|  unnamed protein product                                158   1e-44   
ref|XP_009675574.1|  PREDICTED: eukaryotic initiation factor 4A-II      163   2e-44   
ref|XP_007116337.1|  PREDICTED: eukaryotic initiation factor 4A-I...    162   2e-44   
ref|XP_009690141.1|  eukaryotic translation initiation factor 4a        162   2e-44   
gb|EMP25200.1|  Eukaryotic initiation factor 4A-II                      162   2e-44   
gb|AAH15842.1|  Eukaryotic translation initiation factor 4A, isof...    162   2e-44   
gb|ELU06081.1|  hypothetical protein CAPTEDRAFT_202865                  163   2e-44   
gb|KEQ65229.1|  ATP-dependent RNA helicase eIF4A                        162   2e-44   
ref|XP_007263911.1|  DEAD-domain-containing protein                     162   2e-44   
ref|XP_005067896.1|  PREDICTED: eukaryotic initiation factor 4A-I       158   2e-44   
gb|KEQ77136.1|  ATP-dependent RNA helicase eIF4A                        162   2e-44   
gb|ELK28651.1|  Eukaryotic initiation factor 4A-II                      162   2e-44   
ref|XP_676472.1|  RNA helicase-1                                        162   2e-44   
ref|NP_001177648.1|  eukaryotic initiation factor 4a                    162   2e-44   
gb|KFM75183.1|  Eukaryotic initiation factor 4A-I                       162   2e-44   
ref|XP_011408551.1|  PREDICTED: eukaryotic initiation factor 4A-I...    155   2e-44   
gb|KIK19856.1|  hypothetical protein PISMIDRAFT_682778                  162   2e-44   
ref|XP_005331052.1|  PREDICTED: eukaryotic initiation factor 4A-I...    162   2e-44   
ref|XP_005088431.1|  PREDICTED: eukaryotic initiation factor 4A-I...    161   2e-44   
ref|XP_005876342.1|  PREDICTED: eukaryotic initiation factor 4A-I...    161   3e-44   
ref|NP_001116510.1|  eukaryotic initiation factor 4A-II isoform c       161   3e-44   
ref|XP_001841147.1|  ATP-dependent RNA helicase eIF4A                   162   3e-44   
ref|XP_005545524.1|  PREDICTED: eukaryotic initiation factor 4A-I...    160   3e-44   
gb|ETB63014.1|  eukaryotic initiation factor 4A                         162   3e-44   
ref|XP_007116334.1|  PREDICTED: eukaryotic initiation factor 4A-I...    162   3e-44   
ref|XP_008622240.1|  eukaryotic initiation factor 4A                    162   3e-44   
ref|XP_005545523.1|  PREDICTED: eukaryotic initiation factor 4A-I...    161   3e-44   
ref|XP_004745275.1|  PREDICTED: eukaryotic initiation factor 4A-I...    161   3e-44   
ref|XP_007862988.1|  DEAD-domain-containing protein                     162   3e-44   
ref|XP_008477775.1|  PREDICTED: eukaryotic initiation factor 4A-I...    158   3e-44   
gb|EYB84565.1|  hypothetical protein Y032_0314g2232                     161   3e-44   
ref|XP_003652371.1|  hypothetical protein THITE_2154358                 162   3e-44   
ref|XP_007779635.1|  ATP-dependent RNA helicase eIF4A                   161   3e-44   
gb|EDK97657.1|  eukaryotic translation initiation factor 4A2, iso...    161   4e-44   
ref|XP_004365945.1|  eukaryotic translation initiation factor 4A ...    162   4e-44   
ref|XP_007322327.1|  hypothetical protein SERLADRAFT_476444             161   4e-44   
gb|EFB26304.1|  hypothetical protein PANDA_002799                       161   4e-44   
gb|ELK31803.1|  Eukaryotic initiation factor 4A-I                       159   4e-44   
ref|XP_004899727.1|  PREDICTED: eukaryotic initiation factor 4A-I...    160   4e-44   
ref|XP_003886231.1|  DEAD-box ATP-dependent RNA helicase 34, related    162   4e-44   
ref|XP_008888515.1|  eukaryotic initiation factor-4A, putative          162   4e-44   
dbj|BAF57644.1|  eIF4A isoform 1A protein                               161   4e-44   
gb|EAW90166.1|  eukaryotic translation initiation factor 4A, isof...    159   4e-44   
ref|XP_007116335.1|  PREDICTED: eukaryotic initiation factor 4A-I...    161   4e-44   
ref|XP_645917.1|  DEAD/DEAH box helicase domain-containing protein      161   4e-44   
ref|XP_002367359.1|  eukaryotic translation initiation factor 4A        162   4e-44   
ref|XP_007395441.1|  hypothetical protein PHACADRAFT_255471             161   4e-44   
ref|XP_009020682.1|  hypothetical protein HELRODRAFT_112831             162   4e-44   
ref|XP_004278520.1|  PREDICTED: eukaryotic initiation factor 4A-II      161   5e-44   
ref|XP_002595212.1|  hypothetical protein BRAFLDRAFT_238703             161   5e-44   
ref|XP_006171515.1|  PREDICTED: eukaryotic initiation factor 4A-I...    161   5e-44   
ref|XP_006171516.1|  PREDICTED: eukaryotic initiation factor 4A-I...    161   5e-44   
gb|AIC61961.1|  EIF4A2                                                  161   5e-44   
gb|KIW19628.1|  ATP-dependent RNA helicase eIF4A                        161   5e-44   
ref|XP_005910826.1|  PREDICTED: eukaryotic initiation factor 4A-II      161   5e-44   
gb|EQK99305.1|  cell cycle control protein                              161   5e-44   
ref|XP_002175853.1|  translation initiation factor eIF4A                161   5e-44   
ref|XP_006752550.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    161   5e-44   
ref|XP_004473756.1|  PREDICTED: eukaryotic initiation factor 4A-I...    161   5e-44   
ref|XP_002407236.1|  translation initiation factor 4F, helicase s...    162   5e-44   
gb|EYB84563.1|  hypothetical protein Y032_0314g2232                     161   5e-44   
ref|XP_003256667.1|  PREDICTED: eukaryotic initiation factor 4A-II      161   5e-44   
ref|XP_005415421.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    161   5e-44   
ref|XP_004713471.1|  PREDICTED: eukaryotic initiation factor 4A-II      161   5e-44   
ref|XP_004603081.1|  PREDICTED: eukaryotic initiation factor 4A-I...    161   5e-44   
gb|KEZ44358.1|  hypothetical protein SAPIO_CDS3338                      161   5e-44   
ref|XP_008954015.1|  PREDICTED: eukaryotic initiation factor 4A-I...    161   5e-44   
gb|EFX83683.1|  hypothetical protein DAPPUDRAFT_230663                  162   5e-44   
ref|XP_008954024.1|  PREDICTED: eukaryotic initiation factor 4A-I...    161   5e-44   
gb|AIC61962.1|  EIF4A2                                                  161   5e-44   
ref|NP_001008336.1|  eukaryotic initiation factor 4A-II                 161   5e-44   
ref|XP_010900275.1|  PREDICTED: eukaryotic initiation factor 4A-II      161   5e-44   
gb|KHN88002.1|  Eukaryotic initiation factor 4A                         161   5e-44   
ref|XP_003412833.1|  PREDICTED: eukaryotic initiation factor 4A-II      161   5e-44   
dbj|BAE90010.1|  unnamed protein product                                161   5e-44   
dbj|GAM21646.1|  hypothetical protein SAMD00019534_048210               161   5e-44   
ref|XP_007292698.1|  eukaryotic initiation factor 4A                    162   6e-44   
emb|CAA31025.1|  unnamed protein product                                161   6e-44   
ref|XP_008714653.1|  ATP-dependent RNA helicase eIF4A                   161   6e-44   
ref|XP_007519824.1|  PREDICTED: eukaryotic initiation factor 4A-II      161   6e-44   
dbj|BAA06336.1|  eukaryotic initiation factor 4AII                      161   6e-44   
ref|XP_010994826.1|  PREDICTED: eukaryotic initiation factor 4A-I       161   6e-44   
ref|XP_005652416.1|  PREDICTED: eukaryotic initiation factor 4A-I...    161   6e-44   
gb|ABC84194.1|  eukaryotic translation initiation factor 4A isofo...    161   6e-44   
emb|CCJ09440.1|  eukaryotic initiation factor 4A                        161   6e-44   
ref|NP_001271641.1|  eukaryotic initiation factor 4A-II                 161   6e-44   
gb|EUD70446.1|  eukaryotic initiation factor 4A                         162   6e-44   
ref|XP_009219747.1|  ATP-dependent RNA helicase eIF4A                   161   6e-44   
gb|KIV84687.1|  ATP-dependent RNA helicase eIF4A                        161   6e-44   
ref|XP_001594651.1|  eukaryotic initiation factor 4A                    161   6e-44   
ref|XP_008149790.1|  PREDICTED: eukaryotic initiation factor 4A-I...    161   6e-44   



>ref|XP_009593905.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Nicotiana 
tomentosiformis]
Length=207

 Score =   275 bits (702),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAPEGSQFDARQYD+KM ELL  EGQ+FFTSYDEV+DSFDAMGLKENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDSKMTELLNAEGQDFFTSYDEVYDSFDAMGLKENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYELLDCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_002324737.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
 gb|ABK92554.1| unknown [Populus trichocarpa]
 gb|EEF03302.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
Length=413

 Score =   279 bits (713),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQ+D+KM ELLT +GQ+FFTSYDEV+D+FDAMGLKENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDSKMNELLTTDGQDFFTSYDEVYDTFDAMGLKENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDVVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_011019413.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Populus euphratica]
 ref|XP_011019414.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Populus euphratica]
Length=413

 Score =   278 bits (711),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA +APEGSQFDARQ+D+KM ELLT EGQ+FFTSYDEVH++FDAM LKENLLRGIYAYGF
Sbjct  1    MASSAPEGSQFDARQFDSKMNELLTTEGQDFFTSYDEVHETFDAMNLKENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDIVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_009757031.1| PREDICTED: eukaryotic initiation factor 4A-9 [Nicotiana sylvestris]
Length=413

 Score =   278 bits (710),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAPEGSQFDARQYD+KM ELL  EGQ+FFTSYDEV+DSFDAMGLKENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDSKMTELLNAEGQDFFTSYDEVYDSFDAMGLKENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYELLDCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_010927213.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Elaeis guineensis]
Length=413

 Score =   278 bits (710),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAPEGSQFDARQYDAKM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDAKMTELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_010929386.1| PREDICTED: eukaryotic initiation factor 4A-2 [Elaeis guineensis]
Length=413

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAPEGSQFDARQYDAKM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDAKMTELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|ABK93239.1| unknown [Populus trichocarpa]
Length=413

 Score =   277 bits (708),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA +APEGSQFDARQ+D++M ELLT EGQ+FFTSYDEVH++FDAM LKENLLRGIYAYGF
Sbjct  1    MASSAPEGSQFDARQFDSRMNELLTAEGQDFFTSYDEVHETFDAMNLKENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDIVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_002308545.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
 gb|EEE92068.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
Length=413

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA +APEGSQFDARQ+D++M ELLT EGQ+FFTSYDEVH++FDAM LKENLLRGIYAYGF
Sbjct  1    MASSAPEGSQFDARQFDSRMNELLTAEGQDFFTSYDEVHETFDAMNLKENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDIVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_011038130.1| PREDICTED: eukaryotic initiation factor 4A-15 [Populus euphratica]
Length=413

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQ+D+KM ELLT + Q+FFTSYDEV+D+FDAMGLKENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDSKMNELLTTDAQDFFTSYDEVYDTFDAMGLKENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDVVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|AAL69381.1|AF462218_1 putative DEAD/DEAH box helicase [Narcissus pseudonarcissus]
Length=164

 Score =   268 bits (685),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG A EGSQFDARQYD+KM +LL+ EGQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGMATEGSQFDARQYDSKMNDLLSAEGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_010925445.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Elaeis guineensis]
Length=413

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELLT +GQEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQYDAKMNELLTQDGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_008798133.1| PREDICTED: eukaryotic initiation factor 4A-14 [Phoenix dactylifera]
 ref|XP_008798134.1| PREDICTED: eukaryotic initiation factor 4A-14 [Phoenix dactylifera]
Length=413

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGIAPEGSQFDARQYDSKMNELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|AFC90091.1| eukaryotic initiation factor 4A-14 [Nicotiana benthamiana]
Length=413

 Score =   276 bits (706),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_010242273.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nelumbo nucifera]
Length=413

 Score =   275 bits (704),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELLT +GQ+FFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMSELLTSDGQDFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_011081667.1| PREDICTED: eukaryotic initiation factor 4A-2 [Sesamum indicum]
Length=413

 Score =   275 bits (704),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAPEGSQFDARQ+DAKM ELL  +G+EFFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDAKMNELLGTDGEEFFTSYDEVYNSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYNVVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_004245077.1| PREDICTED: eukaryotic initiation factor 4A-2 [Solanum lycopersicum]
 ref|XP_006351592.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Solanum tuberosum]
Length=413

 Score =   275 bits (704),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQ+DAKM ELL  E QEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDAKMTELLGTEQQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>sp|Q40466.1|IF413_TOBAC RecName: Full=Eukaryotic initiation factor 4A-13; Short=eIF-4A-13; 
AltName: Full=ATP-dependent RNA helicase eIF4A-13, partial 
[Nicotiana tabacum]
 emb|CAA55741.1| unnamed protein product [Nicotiana tabacum]
Length=355

 Score =   273 bits (699),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_011100200.1| PREDICTED: eukaryotic initiation factor 4A-14 [Sesamum indicum]
Length=413

 Score =   275 bits (704),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQ+DARQYDAKM ELL  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQYDARQYDAKMDELLGTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYNIVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>sp|Q40471.1|IF4A9_TOBAC RecName: Full=Eukaryotic initiation factor 4A-9; Short=eIF-4A-9; 
AltName: Full=ATP-dependent RNA helicase eIF4A-9 [Nicotiana 
tabacum]
 emb|CAA55736.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   275 bits (703),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAPEGSQFDARQYD+KM ELL  EGQ+FFTSYDEV+ SFDAMGLKENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQYDSKMTELLNAEGQDFFTSYDEVYHSFDAMGLKENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYELLDCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_003533770.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoformX1 
[Glycine max]
 ref|XP_003533771.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoformX2 
[Glycine max]
 ref|XP_006587022.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X3 
[Glycine max]
 gb|KHN35869.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   275 bits (703),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD KM ELLT +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGIAPEGSQFDARQYDTKMNELLTSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_010915249.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Elaeis guineensis]
Length=413

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD+KM ELLT +GQEFFT+YDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQYDSKMNELLTQDGQEFFTTYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_010929385.1| PREDICTED: eukaryotic initiation factor 4A-15 [Elaeis guineensis]
Length=413

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQYDAKMNDLLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|ACU18673.1| unknown [Glycine max]
Length=234

 Score =   269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|ACU22915.1| unknown [Glycine max]
Length=225

 Score =   268 bits (685),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMSDLLSSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>emb|CDO97887.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD +M+ELL+ +GQ+FFTSYDEVHD+FDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGMAPEGSQFDARQYDTRMKELLSADGQDFFTSYDEVHDTFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|KHN28839.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD KM ELLT +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDTKMNELLTSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_006597014.1| PREDICTED: uncharacterized protein LOC100786735 isoform X1 [Glycine 
max]
 ref|XP_006597015.1| PREDICTED: uncharacterized protein LOC100786735 isoform X2 [Glycine 
max]
 ref|XP_006597016.1| PREDICTED: uncharacterized protein LOC100786735 isoform X3 [Glycine 
max]
Length=457

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  105  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            VMAG APEGSQFDARQYD KM ELLT +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYG
Sbjct  44   VMAGLAPEGSQFDARQYDTKMNELLTSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYG  103

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRE
Sbjct  104  FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTRE  163

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  164  LAQQIEKVMRALGDYLGVKVHACV  187



>ref|XP_002521376.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF41044.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=413

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA+QYDAKM ELL+ EGQEFFT+YDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDAKMSELLSTEGQEFFTTYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_004303662.1| PREDICTED: eukaryotic initiation factor 4A-8 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEG+QFDA+QYD+KM E+L+ EGQEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGAQFDAKQYDSKMNEILSSEGQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_006342504.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum tuberosum]
Length=413

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG+APEGSQFDARQ+DAKM ELL  E QEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQFDAKMTELLGTEQQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|KHN32709.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLSADGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_008782542.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
 ref|XP_008782543.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
Length=413

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG  PEGSQFDARQYD KM ELLT +GQEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLVPEGSQFDARQYDTKMNELLTQDGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|EYU29343.1| hypothetical protein MIMGU_mgv1a007274mg [Erythranthe guttata]
Length=413

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA AAPEGSQFDARQ+DAKM E+L  EG EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAAAPEGSQFDARQFDAKMNEILGAEGDEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_009604758.1| PREDICTED: eukaryotic initiation factor 4A-10 isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_009604756.1| PREDICTED: eukaryotic initiation factor 4A-7 [Nicotiana tomentosiformis]
 ref|XP_009604757.1| PREDICTED: eukaryotic initiation factor 4A-7 [Nicotiana tomentosiformis]
 ref|XP_009604759.1| PREDICTED: eukaryotic initiation factor 4A-7 isoform X2 [Nicotiana 
tomentosiformis]
Length=413

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>sp|Q40470.1|IF4A7_TOBAC RecName: Full=Eukaryotic initiation factor 4A-7; Short=eIF-4A-7; 
AltName: Full=ATP-dependent RNA helicase eIF4A-7 [Nicotiana 
tabacum]
 emb|CAA55738.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_003543580.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Glycine max]
 ref|XP_003546753.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X1 
[Glycine max]
 ref|XP_006597198.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X2 
[Glycine max]
Length=413

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLSADGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_009784285.1| PREDICTED: eukaryotic initiation factor 4A-14 [Nicotiana sylvestris]
Length=413

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_009780782.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Nicotiana 
sylvestris]
Length=413

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>sp|P41379.1|IF4A2_NICPL RecName: Full=Eukaryotic initiation factor 4A-2; Short=eIF-4A-2; 
AltName: Full=ATP-dependent RNA helicase eIF4A-2 [Nicotiana 
plumbaginifolia]
 emb|CAA43513.1| nicotiana eukaryotic translation initiation factor 4A [Nicotiana 
plumbaginifolia]
Length=413

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG+APEGSQFDARQ+DAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQFDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>sp|P41382.1|IF410_TOBAC RecName: Full=Eukaryotic initiation factor 4A-10; Short=eIF-4A-10; 
AltName: Full=ATP-dependent RNA helicase eIF4A-10 [Nicotiana 
tabacum]
 emb|CAA55642.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
 emb|CAA55641.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
Length=413

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|NP_001242064.1| uncharacterized protein LOC100786735 [Glycine max]
 gb|ACU18275.1| unknown [Glycine max]
Length=413

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD KM ELLT +GQ+FFTSYDEV+DSFDAMGL++NLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDTKMNELLTSDGQDFFTSYDEVYDSFDAMGLQDNLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_008801403.1| PREDICTED: eukaryotic initiation factor 4A-15 [Phoenix dactylifera]
 ref|XP_008801404.1| PREDICTED: eukaryotic initiation factor 4A-15 [Phoenix dactylifera]
Length=413

 Score =   273 bits (698),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG  PEGSQFDARQYDAKM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVTPEGSQFDARQYDAKMTELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELLECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>sp|Q40467.1|IF414_TOBAC RecName: Full=Eukaryotic initiation factor 4A-14; Short=eIF-4A-14; 
AltName: Full=ATP-dependent RNA helicase eIF4A-14 [Nicotiana 
tabacum]
 emb|CAA55742.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   273 bits (698),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELL  E +EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_006426587.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 ref|XP_006426588.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 ref|XP_006465995.1| PREDICTED: eukaryotic initiation factor 4A-8-like isoform X1 
[Citrus sinensis]
 ref|XP_006465996.1| PREDICTED: eukaryotic initiation factor 4A-8-like isoform X2 
[Citrus sinensis]
 gb|ESR39827.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 gb|ESR39828.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 gb|KDO65148.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
 gb|KDO65149.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
 gb|KDO65150.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
Length=413

 Score =   273 bits (698),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD KM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDTKMNELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|KHN30068.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   273 bits (697),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLSADGQEFFTSYDEVYDSFDAMGLLENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_004253093.1| PREDICTED: eukaryotic initiation factor 4A-2 [Solanum lycopersicum]
Length=413

 Score =   273 bits (697),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG+APEGSQFDARQ+DAKM ELL  E Q+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQFDAKMTELLGTEQQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_009602748.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nicotiana tomentosiformis]
 ref|XP_009791873.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nicotiana sylvestris]
Length=413

 Score =   272 bits (696),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELL  E QEFFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQQEFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>sp|Q40465.1|IF411_TOBAC RecName: Full=Eukaryotic initiation factor 4A-11; Short=eIF-4A-11; 
AltName: Full=ATP-dependent RNA helicase eIF4A-11 [Nicotiana 
tabacum]
 emb|CAA55737.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   272 bits (696),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELL  E QEFFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTEQQEFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_008220506.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Prunus mume]
Length=413

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA  APEGSQFDARQYDAKM ELL  +GQEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDARQYDAKMSELLGADGQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYALPDCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_009597977.1| PREDICTED: eukaryotic initiation factor 4A-15 [Nicotiana tomentosiformis]
Length=413

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAPEGSQFDARQ+D+KM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDSKMNELLSADGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLAYELLECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_004291063.1| PREDICTED: eukaryotic initiation factor 4A-2 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAPEGSQFD RQYDAKM ELL  +GQ+FFTSYDEVHDSFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDTRQYDAKMTELLGSDGQDFFTSYDEVHDSFDVMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAMLDCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_008798130.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
 ref|XP_008798131.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
 ref|XP_008798132.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
Length=413

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG  PEGSQFDARQYDAK+ ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLPPEGSQFDARQYDAKLNELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHAC  533
            AQQIEKVMRALGDYLGVKVHAC
Sbjct  121  AQQIEKVMRALGDYLGVKVHAC  142



>gb|KDP40743.1| hypothetical protein JCGZ_24742 [Jatropha curcas]
Length=413

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA+QYDAKM ELL+ +GQ+FFT+YDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDAKMNELLSSDGQDFFTTYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYATVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_004146811.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Cucumis sativus]
 ref|XP_004154791.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Cucumis sativus]
 gb|KGN59802.1| hypothetical protein Csa_3G848120 [Cucumis sativus]
Length=413

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD+KM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLSADGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|ACU24597.1| unknown [Glycine max]
Length=234

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELL  +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMNELLGTDGQDFFTSYDEVCESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVI+QAQSG GKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIRQAQSGAGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|ACU21478.1| unknown [Glycine max]
Length=413

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>emb|CBI27885.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD R YDAKM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDTRNYDAKMTELLSTDGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|KHN39326.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_003531602.1| PREDICTED: eukaryotic initiation factor 4A-10 [Glycine max]
 gb|KHN11260.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_006583001.1| PREDICTED: eukaryotic initiation factor 4A-10 [Glycine max]
Length=413

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_009764703.1| PREDICTED: eukaryotic initiation factor 4A-15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009764704.1| PREDICTED: eukaryotic initiation factor 4A-15 isoform X1 [Nicotiana 
sylvestris]
Length=413

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAPEGSQFDARQ+D KM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDTKMNELLSADGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLAYELLECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_008447621.1| PREDICTED: eukaryotic initiation factor 4A-8 [Cucumis melo]
 gb|ADN33729.1| helicase [Cucumis melo subsp. melo]
Length=413

 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD KM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDTKMNELLSADGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>emb|CAN70196.1| hypothetical protein VITISV_040309 [Vitis vinifera]
Length=410

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD R YDAKM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDTRNYDAKMTELLSTDGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_003522265.1| PREDICTED: eukaryotic initiation factor 4A-11 [Glycine max]
 gb|KHN29706.1| Eukaryotic initiation factor 4A-11 [Glycine soja]
Length=413

 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELL  +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDAKMNELLGTDGQDFFTSYDEVCESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|AAR23806.1| initiation factor eIF4A-15 [Helianthus annuus]
Length=413

 Score =   271 bits (693),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQ+D+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQFDSKMNDLLSADGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY+ VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYNVVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_008462340.1| PREDICTED: eukaryotic initiation factor 4A-11 [Cucumis melo]
Length=413

 Score =   271 bits (692),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEG+QFD+RQYDAKM E+L+ EGQEFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDSRQYDAKMNEILSAEGQEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|KHN06630.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   271 bits (692),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMSDLLSSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_010094955.1| Eukaryotic initiation factor 4A-13 [Morus notabilis]
 gb|EXB57648.1| Eukaryotic initiation factor 4A-13 [Morus notabilis]
Length=248

 Score =   265 bits (678),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG  PEGSQFDARQYDAKM ELL  +G +FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVVPEGSQFDARQYDAKMNELLGSDGSDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_007150491.1| hypothetical protein PHAVU_005G157100g [Phaseolus vulgaris]
 gb|ESW22485.1| hypothetical protein PHAVU_005G157100g [Phaseolus vulgaris]
Length=413

 Score =   271 bits (692),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD R YD+KM ELL+ +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDGRHYDSKMSELLSADGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_004141688.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Cucumis sativus]
 ref|XP_004155930.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Cucumis sativus]
 gb|KGN45514.1| hypothetical protein Csa_7G450710 [Cucumis sativus]
Length=413

 Score =   271 bits (692),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEG+QFD+RQYDAKM E+L+ EGQEFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDSRQYDAKMNEILSAEGQEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|KJB56905.1| hypothetical protein B456_009G142800 [Gossypium raimondii]
Length=336

 Score =   268 bits (685),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD KM ELL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAMVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_007222702.1| hypothetical protein PRUPE_ppa006409mg [Prunus persica]
 gb|EMJ23901.1| hypothetical protein PRUPE_ppa006409mg [Prunus persica]
Length=413

 Score =   270 bits (691),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA  APEGSQFDARQYDAKM ELL  +GQEFFTSYDEVH+SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDARQYDAKMSELLGADGQEFFTSYDEVHESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYALPDCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_010262239.1| PREDICTED: uncharacterized protein LOC104600806 [Nelumbo nucifera]
Length=929

 Score =   283 bits (723),  Expect = 5e-86, Method: Composition-based stats.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  105  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            VMAG APEGSQFDARQYDAKM ELLT +GQ+FFTSYDEV++SFDAMGL+ENLLRGIYAYG
Sbjct  516  VMAGLAPEGSQFDARQYDAKMSELLTADGQDFFTSYDEVYESFDAMGLQENLLRGIYAYG  575

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  576  FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  635

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  636  LAQQIEKVMRALGDYLGVKVHACV  659



>gb|EYU21355.1| hypothetical protein MIMGU_mgv1a0072631mg [Erythranthe guttata]
Length=413

 Score =   270 bits (691),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD RQ+D++M ELL VEG+EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDTRQFDSRMNELLQVEGEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|KHG04102.1| Eukaryotic initiation factor 4A-14 [Gossypium arboreum]
Length=313

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD KM ELL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_003526019.1| PREDICTED: eukaryotic initiation factor 4A-11 [Glycine max]
 gb|KHN32198.1| Eukaryotic initiation factor 4A-11 [Glycine soja]
Length=413

 Score =   270 bits (691),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG+APEGSQFDARQYDAKM ELL  +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQYDAKMNELLGTDGQDFFTSYDEVCESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVH CV
Sbjct  121  AQQIEKVMRALGDYLGVKVHVCV  143



>ref|XP_007215455.1| hypothetical protein PRUPE_ppa006399mg [Prunus persica]
 ref|XP_008228255.1| PREDICTED: eukaryotic initiation factor 4A-11 [Prunus mume]
 ref|XP_008228256.1| PREDICTED: eukaryotic initiation factor 4A-11 [Prunus mume]
 gb|ADB07168.1| DEAD-box RNA helicase-like protein [Prunus persica]
 gb|ADB07169.1| DEAD-box RNA helicase-like protein [Prunus persica]
 gb|EMJ16654.1| hypothetical protein PRUPE_ppa006399mg [Prunus persica]
Length=413

 Score =   270 bits (691),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA+QYD KM ELL+ +GQEFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQYDTKMSELLSTDGQEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>emb|CAN61608.1| hypothetical protein VITISV_040122 [Vitis vinifera]
Length=413

 Score =   270 bits (691),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD+KM ELL  +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLGTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_007135520.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 ref|XP_007135521.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 gb|ESW07514.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 gb|ESW07515.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
Length=413

 Score =   270 bits (690),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEG+QFD RQYDAKM ELL+ +GQEFFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGTQFDGRQYDAKMSELLSTDGQEFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>emb|CDP08290.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   270 bits (690),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 136/144 (94%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEG-QEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDARQYDAKM ELL  +G QEFFTSYDEV+DSFD+MGL+ENLLRGIYAYG
Sbjct  1    MAGLAPEGSQFDARQYDAKMTELLGTDGGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>ref|XP_008793233.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
 ref|XP_008793234.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
Length=413

 Score =   270 bits (690),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG  PEGSQFDARQ+D+KM ELLT +GQEFFTSYDEV+D+FD+M L+ENLLRGIYAYGF
Sbjct  1    MAGLTPEGSQFDARQFDSKMNELLTQDGQEFFTSYDEVYDTFDSMNLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|KDP33852.1| hypothetical protein JCGZ_07423 [Jatropha curcas]
Length=413

 Score =   270 bits (690),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA+QYD+KM ELL  +G++FFT+YDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDSKMNELLATDGEDFFTTYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_004510408.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Cicer arietinum]
Length=413

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA  YD KM ELL  +GQEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDANHYDTKMNELLASDGQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGD+LGVKVHACV
Sbjct  121  AQQIEKVMRALGDFLGVKVHACV  143



>ref|XP_010927212.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Elaeis guineensis]
Length=413

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG  PEGSQFDARQYD KM ELLT +GQ+FFT+YDEV+DSFDAMGL ENLLRGIYAYGF
Sbjct  1    MAGQVPEGSQFDARQYDTKMNELLTADGQDFFTTYDEVYDSFDAMGLHENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALV APTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVFAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHAC  533
            AQQIEKVMRALGDYLGVKVHAC
Sbjct  121  AQQIEKVMRALGDYLGVKVHAC  142



>ref|XP_004513437.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X1 
[Cicer arietinum]
 ref|XP_004513438.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X2 
[Cicer arietinum]
Length=413

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA+Q+D+KM ELLT + Q+FFTSYDEV+DSFDAM L+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQFDSKMNELLTTDAQDFFTSYDEVYDSFDAMHLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+  ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYNVTECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_009399791.1| PREDICTED: eukaryotic initiation factor 4A-8 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELL+ +GQ+FF SYDEV DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQYDAKMNELLSQDGQDFFASYDEVFDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFC+G+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCAGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_009403035.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM ELLT +GQEFFTSYDE+ +SFD MGL ENLLRGIYAYGF
Sbjct  1    MAGMAPEGSQFDARQYDAKMTELLTADGQEFFTSYDEICESFDDMGLHENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|KJB56903.1| hypothetical protein B456_009G142800 [Gossypium raimondii]
 gb|KJB56904.1| hypothetical protein B456_009G142800 [Gossypium raimondii]
Length=413

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD KM ELL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAMVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_007024535.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY27157.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
Length=413

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD KM ELL  +G EFFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDEFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_008379513.1| PREDICTED: eukaryotic initiation factor 4A-8 [Malus domestica]
Length=413

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA+QYD KM ELL+ +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQYDTKMSELLSTDGQDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|KJB70132.1| hypothetical protein B456_011G063400 [Gossypium raimondii]
 gb|KJB70133.1| hypothetical protein B456_011G063400 [Gossypium raimondii]
Length=413

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD KM ELL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDQKMTELLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_008392378.1| PREDICTED: eukaryotic initiation factor 4A-8 [Malus domestica]
Length=413

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA+QYD KM ELL+ +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQYDTKMSELLSTDGQDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|AFK40852.1| unknown [Lotus japonicus]
Length=413

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA+QYD+KM ELL  +GQEFFTSYDEV+D+FD+MGL ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDSKMTELLATDGQEFFTSYDEVYDTFDSMGLHENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>emb|CBI35913.3| unnamed protein product [Vitis vinifera]
Length=224

 Score =   262 bits (670),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQ+D+KM +LL+ +G++FFTSYDEV+D+FD+MGL ENLLRGIYAYGF
Sbjct  1    MAGQAPEGSQFDARQFDSKMNDLLSADGEDFFTSYDEVYDTFDSMGLVENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGV+VHACV
Sbjct  121  AQQIEKVMRALGDYLGVRVHACV  143



>ref|XP_002278119.1| PREDICTED: eukaryotic initiation factor 4A-11 [Vitis vinifera]
 emb|CBI20640.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD+KM ELL  +GQ+FFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMNELLGTDGQDFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_008337727.1| PREDICTED: eukaryotic initiation factor 4A-11 [Malus domestica]
Length=412

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +3

Query  114  GAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEK  293
             AAPEGSQFD RQYD KM ELL  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGFEK
Sbjct  2    AAAPEGSQFDTRQYDTKMSELLATDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEK  61

Query  294  PSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQ  473
            PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRELAQ
Sbjct  62   PSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTECQALVLAPTRELAQ  121

Query  474  QIEKVMRALGDYLGVKVHACV  536
            QIEKVMRALGDYLGV+VHACV
Sbjct  122  QIEKVMRALGDYLGVRVHACV  142



>ref|XP_008377701.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Malus domestica]
Length=413

 Score =   268 bits (686),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA  APEGSQFD  QYDAKM ELL  +GQ+FFTSYDE+HDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSELLGADGQDFFTSYDEIHDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLLDCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_003595233.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|ABN09109.1| Helicase, C-terminal [Medicago truncatula]
 gb|AES65484.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   268 bits (686),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA+Q+D+KM ELLT + Q+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQFDSKMNELLTTDAQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_007138709.1| hypothetical protein PHAVU_009G230600g [Phaseolus vulgaris]
 gb|ESW10703.1| hypothetical protein PHAVU_009G230600g [Phaseolus vulgaris]
Length=413

 Score =   268 bits (685),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD R YD+KM ELLT + Q+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDGRHYDSKMNELLTTDAQDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+  ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYNVTECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|KHG23060.1| Eukaryotic initiation factor 4A-9 [Gossypium arboreum]
Length=224

 Score =   262 bits (669),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 134/143 (94%), Gaps = 1/143 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA AAPEGSQFDARQYDAKM EL  V GQ+FFTSYDEV+D+FD MGL+ENLLRGIYAYGF
Sbjct  1    MAAAAPEGSQFDARQYDAKMDELEAV-GQDFFTSYDEVYDTFDVMGLQENLLRGIYAYGF  59

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  120  AQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_009385793.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYDAKM EL++ +GQ+FF SYDEV DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGMAPEGSQFDARQYDAKMNELISQDGQDFFASYDEVFDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFC+G+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCAGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>sp|Q40468.1|IF415_TOBAC RecName: Full=Eukaryotic initiation factor 4A-15; Short=eIF-4A-15; 
AltName: Full=ATP-dependent RNA helicase eIF4A-15 [Nicotiana 
tabacum]
 emb|CAA55739.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAPEGSQFDARQ+D KM ELL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDTKMNELLSADGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLAYELLECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKV ACV
Sbjct  121  AQQIEKVMRALGDYLGVKVTACV  143



>gb|AAN74635.1| DEAD box RNA helicase [Pisum sativum]
 gb|AAR97917.1| DEAD box RNA helicase [Pisum sativum]
Length=413

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA+Q+D KM ELLT EGQ+F+T Y+EV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQFDTKMNELLTTEGQDFYTFYEEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|EYU29345.1| hypothetical protein MIMGU_mgv1a007246mg [Erythranthe guttata]
Length=413

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA   PEGS FDARQ+DAKM E+L  EG+EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MADKVPEGSNFDARQFDAKMDEILGAEGEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_010669372.1| PREDICTED: eukaryotic initiation factor 4A-9 [Beta vulgaris subsp. 
vulgaris]
Length=413

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQ+DARQYD KM ELL+ EG +FFTSYDEV++SFD MGL ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQYDARQYDNKMSELLSEEGSDFFTSYDEVYESFDKMGLLENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYENLECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_009372398.1| PREDICTED: eukaryotic initiation factor 4A-8 [Pyrus x bretschneideri]
 ref|XP_009340681.1| PREDICTED: eukaryotic initiation factor 4A-8 [Pyrus x bretschneideri]
Length=413

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA+QYD KM ELL+ +GQ+FFTSYDEV +SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDAKQYDTKMSELLSTDGQDFFTSYDEVFESFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|KHN17683.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   268 bits (684),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQYD+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQYDSKMSDLLSSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDY GVKVHACV
Sbjct  121  AQQIEKVMRALGDYQGVKVHACV  143



>ref|XP_011079970.1| PREDICTED: eukaryotic initiation factor 4A-8 [Sesamum indicum]
Length=413

 Score =   268 bits (684),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD R YD KM ELL  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDTRHYDTKMNELLQSDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_009389913.1| PREDICTED: eukaryotic initiation factor 4A-11 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   268 bits (684),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG  PEGSQFDARQYDAKM ELL+ + Q+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGMTPEGSQFDARQYDAKMNELLSQDVQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFC+G+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCAGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_009415521.1| PREDICTED: eukaryotic initiation factor 4A-15 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   268 bits (684),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQ+D KM +LL+ +GQEFFTSYDEV++SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGMAPEGSQFDARQFDTKMNDLLSADGQEFFTSYDEVYESFDDMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_003627168.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|AET01644.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   267 bits (683),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA  YD+KM ELL  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDANHYDSKMNELLATDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            E+PSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   ERPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGD+LGVKVHACV
Sbjct  121  AQQIEKVMRALGDFLGVKVHACV  143



>ref|XP_011010150.1| PREDICTED: eukaryotic initiation factor 4A-8 [Populus euphratica]
Length=413

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD++QYDAKM +LL  +GQ+FFTSYDEV+D+FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDSKQYDAKMNDLLANDGQDFFTSYDEVYDTFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_002304104.1| translation initiation factor 4A family protein [Populus trichocarpa]
 ref|XP_002304185.2| hypothetical protein POPTR_0003s04150g [Populus trichocarpa]
 gb|ABK94270.1| unknown [Populus trichocarpa]
 gb|EEE79083.1| translation initiation factor 4A family protein [Populus trichocarpa]
 gb|EEE79164.2| hypothetical protein POPTR_0003s04150g [Populus trichocarpa]
Length=413

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD++QYDAKM +LL  +GQ+FFTSYDEV+D+FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDSKQYDAKMNDLLANDGQDFFTSYDEVYDTFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_003597562.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|AES67813.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD +Q+D KM ELL+ EGQEFFTSYDEVH++FDAMGL ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDTKQFDTKMNELLSTEGQEFFTSYDEVHETFDAMGLLENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_007202168.1| hypothetical protein PRUPE_ppa006450mg [Prunus persica]
 gb|EMJ03367.1| hypothetical protein PRUPE_ppa006450mg [Prunus persica]
Length=411

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  117  AAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKP  296
            AAPEGSQFD RQYD+KM ELL  +GQEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGFEKP
Sbjct  2    AAPEGSQFDTRQYDSKMTELLATDGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGFEKP  61

Query  297  SAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQ  476
            SAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRELAQQ
Sbjct  62   SAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTECQALVLAPTRELAQQ  121

Query  477  IEKVMRALGDYLGVKVHACV  536
            IEKVMRALGDYLGV+VHACV
Sbjct  122  IEKVMRALGDYLGVRVHACV  141



>ref|XP_006338111.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X2 
[Solanum tuberosum]
 ref|XP_006338112.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X3 
[Solanum tuberosum]
Length=414

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 138/144 (96%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVE-GQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEGSQFD RQ+D+KM ELL+ + GQ+FFTSYDE++DSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGSQFDVRQFDSKMNELLSADDGQDFFTSYDEIYDSFDAMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ +ECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELLECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>gb|KJB34989.1| hypothetical protein B456_006G095400 [Gossypium raimondii]
 gb|KJB34990.1| hypothetical protein B456_006G095400 [Gossypium raimondii]
Length=413

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQ+D KM +LL  +G +FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPEGSQFDARQFDQKMSDLLQTDGDDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGIVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_007136846.1| hypothetical protein PHAVU_009G079100g [Phaseolus vulgaris]
 gb|ESW08840.1| hypothetical protein PHAVU_009G079100g [Phaseolus vulgaris]
Length=413

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD R YDAKM ELL  +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGQAPEGSQFDGRHYDAKMDELLGADGQDFFTSYDEVCESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDY+GVKVHACV
Sbjct  121  AQQIEKVMRALGDYIGVKVHACV  143



>ref|XP_004253094.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum lycopersicum]
Length=410

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  120  APEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPS  299
            A EGSQFDARQ+DAKM ELL  E QEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGFEKPS
Sbjct  2    AAEGSQFDARQFDAKMTELLGTEQQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGFEKPS  61

Query  300  AIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQI  479
            AIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRELAQQI
Sbjct  62   AIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTRELAQQI  121

Query  480  EKVMRALGDYLGVKVHACV  536
            EKVMRALGDYLGVKVHACV
Sbjct  122  EKVMRALGDYLGVKVHACV  140



>ref|XP_006342502.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum tuberosum]
Length=410

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  120  APEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPS  299
            A EGSQFDARQ+DAKM ELL  E QEFFTSYDEVHDSFDAMGL+ENLLRGIYAYGFEKPS
Sbjct  2    AAEGSQFDARQFDAKMTELLGTEQQEFFTSYDEVHDSFDAMGLQENLLRGIYAYGFEKPS  61

Query  300  AIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQI  479
            AIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRELAQQI
Sbjct  62   AIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTRELAQQI  121

Query  480  EKVMRALGDYLGVKVHACV  536
            EKVMRALGDYLGVKVHACV
Sbjct  122  EKVMRALGDYLGVKVHACV  140



>ref|XP_007012323.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
 gb|EOY29942.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
Length=412

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 135/143 (94%), Gaps = 1/143 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA AAPEGSQFDARQYDAKM EL   +GQEFFT+YDEV+D+FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAAAAPEGSQFDARQYDAKMNEL-EADGQEFFTTYDEVYDTFDSMGLQENLLRGIYAYGF  59

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  120  AQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_002277703.1| PREDICTED: eukaryotic initiation factor 4A-8 [Vitis vinifera]
Length=413

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQ+D+KM +LL+ +G++FFTSYDEV+D+FD+MGL ENLLRGIYAYGF
Sbjct  1    MAGQAPEGSQFDARQFDSKMNDLLSADGEDFFTSYDEVYDTFDSMGLVENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGV+VHACV
Sbjct  121  AQQIEKVMRALGDYLGVRVHACV  143



>ref|XP_009381599.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA QYDAKM+ELL  +GQ+FFTSYD+V++SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAHQYDAKMKELLNADGQDFFTSYDDVYESFDKMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVL PTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYGLVQCQALVLGPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>emb|CDY72259.1| BnaCnng76770D, partial [Brassica napus]
Length=222

 Score =   259 bits (662),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 136/145 (94%), Gaps = 3/145 (2%)
 Frame = +3

Query  105  VMAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAY  281
            VMAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFD MGL+ENLLRGIYAY
Sbjct  8    VMAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDVMGLQENLLRGIYAY  65

Query  282  GFEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTR  461
            GFEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTR
Sbjct  66   GFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFAIVQCQALVLAPTR  125

Query  462  ELAQQIEKVMRALGDYLGVKVHACV  536
            ELAQQIEKVMRALGDYLGVKVHACV
Sbjct  126  ELAQQIEKVMRALGDYLGVKVHACV  150



>ref|XP_010049453.1| PREDICTED: eukaryotic initiation factor 4A-15 [Eucalyptus grandis]
 gb|KCW82050.1| hypothetical protein EUGRSUZ_C03418 [Eucalyptus grandis]
Length=413

 Score =   265 bits (678),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG  PEGS FD+RQ+DAKM ELL+ +G++FFTSYDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLTPEGSAFDSRQFDAKMSELLSADGEDFFTSYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVDCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_010322836.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322837.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322838.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
Length=416

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  105  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            VMA  APEG+QFDARQ+D+KM +LL  EG++FFTSYDEV+DSFDAMGL+ENLLRGIYAYG
Sbjct  3    VMARLAPEGAQFDARQFDSKMNDLLAAEGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYG  62

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQ+LVLAPTRE
Sbjct  63   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLIQCQSLVLAPTRE  122

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  123  LAQQIEKVMRALGDYLGVKVHACV  146



>dbj|BAJ89461.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT12089.1| Eukaryotic initiation factor 4A [Aegilops tauschii]
Length=414

 Score =   265 bits (677),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 135/144 (94%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>gb|KJB54655.1| hypothetical protein B456_009G043400 [Gossypium raimondii]
 gb|KJB54656.1| hypothetical protein B456_009G043400 [Gossypium raimondii]
Length=412

 Score =   265 bits (676),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 134/143 (94%), Gaps = 1/143 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA AAPEGSQFDARQYDAKM EL  V GQ+FFTSYDEV+D+FD MGL+ENLLRGIYAYGF
Sbjct  1    MAAAAPEGSQFDARQYDAKMDELEAV-GQDFFTSYDEVYDTFDVMGLQENLLRGIYAYGF  59

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  120  AQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_003563508.1| PREDICTED: eukaryotic initiation factor 4A [Brachypodium distachyon]
 ref|XP_010227424.1| PREDICTED: eukaryotic initiation factor 4A [Brachypodium distachyon]
Length=414

 Score =   265 bits (677),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 135/144 (94%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>ref|XP_009410226.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   265 bits (677),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA QYDAKM +LL  +GQ+FFT YDEVH+SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAHQYDAKMNDLLNADGQDFFTLYDEVHESFDEMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVL PTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYGLVKCQALVLGPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|EPS65096.1| hypothetical protein M569_09681 [Genlisea aurea]
Length=413

 Score =   265 bits (676),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA ++DAKM E+L  EG+EFFT+YDEV++SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDANKFDAKMNEILGGEGEEFFTNYDEVYESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGIVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>dbj|BAJ85348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 135/144 (94%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>ref|XP_010033764.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Eucalyptus 
grandis]
 gb|KCW53567.1| hypothetical protein EUGRSUZ_J028421 [Eucalyptus grandis]
Length=412

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 134/143 (94%), Gaps = 1/143 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG  PEGSQFD RQ+D+K+ EL T E QEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLTPEGSQFDPRQFDSKINEL-TTEAQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGF  59

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD V+CQ+LVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDVVQCQSLVLAPTREL  119

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  120  AQQIEKVMRALGDYLGVKVHACV  142



>sp|P41378.1|IF4A_WHEAT RecName: Full=Eukaryotic initiation factor 4A; Short=eIF-4A; 
AltName: Full=ATP-dependent RNA helicase eIF4A [Triticum aestivum]
Length=414

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 135/144 (94%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>ref|XP_009798256.1| PREDICTED: eukaryotic initiation factor 4A-8 [Nicotiana sylvestris]
Length=413

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA  AP+G+QFDARQYD+KM +LL  +G++FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MARLAPDGAQFDARQYDSKMNDLLAADGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_006656443.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X1 
[Oryza brachyantha]
 ref|XP_006656444.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X2 
[Oryza brachyantha]
Length=414

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL   E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGVVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>dbj|BAA02152.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAB21260.1| eukaryotic initiation factor 4A [Oryza sativa]
Length=413

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL   E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>dbj|BAJ96964.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 135/144 (94%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKNYDSKMQELLSQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQAL+LAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALILAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>sp|P41381.1|IF4A8_TOBAC RecName: Full=Eukaryotic initiation factor 4A-8; Short=eIF-4A-8; 
AltName: Full=ATP-dependent RNA helicase eIF4A-8 [Nicotiana 
tabacum]
 emb|CAA55639.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
 emb|CAA55640.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
Length=413

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA  AP+G+QFDARQYD+KM +LL  +G++FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MARLAPDGAQFDARQYDSKMNDLLAADGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|NP_001058481.1| Os06g0701100 [Oryza sativa Japonica Group]
 sp|P35683.2|IF4A1_ORYSJ RecName: Full=Eukaryotic initiation factor 4A-1; Short=eIF-4A-1; 
AltName: Full=ATP-dependent RNA helicase eIF4A-1; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 4 [Oryza sativa 
Japonica Group]
 dbj|BAD54014.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAD53769.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAF20395.1| Os06g0701100 [Oryza sativa Japonica Group]
 gb|EAZ38180.1| hypothetical protein OsJ_22532 [Oryza sativa Japonica Group]
 dbj|BAG94357.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97257.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99594.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL   E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>gb|EAZ02256.1| hypothetical protein OsI_24355 [Oryza sativa Indica Group]
Length=426

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL   E +EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNQGETEEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYAVVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>gb|AIZ68204.1| eukaryotic initiation factor 4A-14 [Ornithogalum saundersiae]
Length=413

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA+QYD+KM +LL  +GQ+FFTSYDEV++SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAKQYDSKMNDLLAGDGQDFFTSYDEVYESFDDMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVI+QAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIRQAQSGTGKTATFCSGILQQLDYGVVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>gb|ACJ84921.1| unknown [Medicago truncatula]
 gb|AFK40621.1| unknown [Medicago truncatula]
Length=413

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA+Q+D+KM ELLT + Q+FFTSYDEV+DSFDAMGL+ENLLR IYAYGF
Sbjct  1    MAGVAPEGSQFDAKQFDSKMNELLTTDAQDFFTSYDEVYDSFDAMGLQENLLRDIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTR+L
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYSVTECQALVLAPTRKL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_010087709.1| Eukaryotic initiation factor 4A-8 [Morus notabilis]
 gb|EXB29697.1| Eukaryotic initiation factor 4A-8 [Morus notabilis]
Length=423

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG A EG+QFDAR+YDAKM ELL+ +GQ+FFTSYDEVH+SFD+MGL E LLRGIYAYGF
Sbjct  11   MAGLASEGTQFDARKYDAKMNELLSNDGQDFFTSYDEVHESFDSMGLLEKLLRGIYAYGF  70

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQ LDYD V+CQALVLAPTREL
Sbjct  71   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQLLDYDLVQCQALVLAPTREL  130

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  131  AQQIEKVMRALGDYLGVKVHACV  153



>ref|XP_010322839.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X2 [Solanum 
lycopersicum]
Length=413

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA  APEG+QFDARQ+D+KM +LL  EG++FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MARLAPEGAQFDARQFDSKMNDLLAAEGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQ+LVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLIQCQSLVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_011072546.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Sesamum indicum]
Length=412

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 135/143 (94%), Gaps = 1/143 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG AP GSQFDAR+YDAKM E+L V+GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPAGSQFDAREYDAKM-EVLQVDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  59

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTQCQALVLAPTREL  119

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  120  AQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_006357714.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic initiation factor 
4A-9-like [Solanum tuberosum]
Length=413

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAP+GSQFDARQ+D+KM ELL  EGQEFFTSYDE +D+FDAM LKE LLRGIYAYGF
Sbjct  1    MAGAAPDGSQFDARQFDSKMTELLNAEGQEFFTSYDEAYDTFDAMELKEKLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYELLDCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVM+ALGDYL VKVHACV
Sbjct  121  AQQIEKVMQALGDYLKVKVHACV  143



>emb|CDX82505.1| BnaA03g33160D [Brassica napus]
Length=428

 Score =   264 bits (674),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 3/145 (2%)
 Frame = +3

Query  105  VMAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAY  281
            VMAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFDAMGL+ENLLRGIYAY
Sbjct  4    VMAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDAMGLQENLLRGIYAY  61

Query  282  GFEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTR  461
            GFEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTR
Sbjct  62   GFEKPSAIQQRGIVPFCQGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTR  121

Query  462  ELAQQIEKVMRALGDYLGVKVHACV  536
            ELAQQIEKVMRALGDYLGVKVHACV
Sbjct  122  ELAQQIEKVMRALGDYLGVKVHACV  146



>ref|XP_010656491.1| PREDICTED: uncharacterized protein LOC100244028 [Vitis vinifera]
Length=827

 Score =   273 bits (699),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  105  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            VMAG APEGSQFD R YDAKM ELL+ +GQ+FFTSYDEV+DSFD+MGL+ENLLRGIYAYG
Sbjct  414  VMAGVAPEGSQFDTRNYDAKMTELLSTDGQDFFTSYDEVYDSFDSMGLQENLLRGIYAYG  473

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  474  FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  533

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  534  LAQQIEKVMRALGDYLGVKVHACV  557



>ref|XP_006338110.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X1 
[Solanum tuberosum]
Length=416

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 137/144 (95%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVE-GQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            + G+APEGSQFD RQ+D+KM ELL+ + GQ+FFTSYDE++DSFDAMGL+ENLLRGIYAYG
Sbjct  3    IVGSAPEGSQFDVRQFDSKMNELLSADDGQDFFTSYDEIYDSFDAMGLQENLLRGIYAYG  62

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ +ECQALVLAPTRE
Sbjct  63   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELLECQALVLAPTRE  122

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  123  LAQQIEKVMRALGDYLGVKVHACV  146



>ref|XP_010501441.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
 ref|XP_010465264.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
 ref|XP_010487172.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
Length=412

 Score =   263 bits (671),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 136/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_006474427.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Citrus sinensis]
Length=413

 Score =   263 bits (672),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGS FDAR +D+ M  LL+ EGQ+FF SYDEV+DSFD+MGLKENLLRGIYAYGF
Sbjct  1    MAGIAPEGSGFDARSFDSNMNNLLSEEGQDFFVSYDEVYDSFDSMGLKENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYESLQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDY+GVKVHACV
Sbjct  121  AQQIEKVMRALGDYMGVKVHACV  143



>ref|XP_007012324.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
 gb|EOY29943.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
Length=413

 Score =   263 bits (671),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG A +GSQ+DA QYD+KM ELL+ EG+EFFT+YDEV +SFD MGLKENLLRGIYAYGF
Sbjct  1    MAGLATDGSQYDAHQYDSKMNELLSDEGKEFFTTYDEVCESFDKMGLKENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|NP_001105396.1| translational initiation factor eIF-4A [Zea mays]
 gb|AAB67607.1| translational initiation factor eIF-4A [Zea mays]
Length=414

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>ref|XP_006297793.1| hypothetical protein CARUB_v10013828mg [Capsella rubella]
 gb|EOA30691.1| hypothetical protein CARUB_v10013828mg [Capsella rubella]
Length=412

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 136/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_009135344.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 136/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCQGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>gb|AFW75865.1| putative DEAD-box ATP-dependent RNA helicase family protein isoform 
1 [Zea mays]
 gb|AFW75866.1| putative DEAD-box ATP-dependent RNA helicase family protein isoform 
2 [Zea mays]
Length=414

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>ref|XP_009106914.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X1 
[Brassica rapa]
 ref|XP_009106915.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X2 
[Brassica rapa]
Length=412

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 136/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFD RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>emb|CDY02469.1| BnaA08g00760D [Brassica napus]
Length=412

 Score =   263 bits (671),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 136/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFD RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>gb|KJB65513.1| hypothetical protein B456_010G098500 [Gossypium raimondii]
 gb|KJB65514.1| hypothetical protein B456_010G098500 [Gossypium raimondii]
 gb|KJB65516.1| hypothetical protein B456_010G098500 [Gossypium raimondii]
 gb|KJB65517.1| hypothetical protein B456_010G098500 [Gossypium raimondii]
Length=413

 Score =   263 bits (671),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG AP+GSQ+DARQYD+KM ELL  +G +FFTSYDEV++SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGVAPDGSQYDARQYDSKMNELLADDGNDFFTSYDEVYESFDKMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQ+GIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQKGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_009624936.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   262 bits (670),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA  AP+G+QFDARQYD+KM +LL  +G++FFTSYDEV+DSFDAM L+ENLLRGIYAYGF
Sbjct  1    MARLAPDGAQFDARQYDSKMNDLLAADGKDFFTSYDEVYDSFDAMSLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_002438954.1| hypothetical protein SORBIDRAFT_10g028940 [Sorghum bicolor]
 gb|EER90321.1| hypothetical protein SORBIDRAFT_10g028940 [Sorghum bicolor]
Length=414

 Score =   262 bits (670),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>gb|ACN34609.1| unknown [Zea mays]
 gb|AFW69338.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=414

 Score =   262 bits (670),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>ref|XP_004966111.1| PREDICTED: eukaryotic initiation factor 4A-3-like [Setaria italica]
Length=414

 Score =   262 bits (670),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELL-TVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL T E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLNTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>gb|AAY33860.1| eukaryotic initiation factor 4A [Cenchrus americanus]
Length=414

 Score =   262 bits (670),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>ref|XP_006601410.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like [Glycine 
max]
Length=853

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 151/178 (85%), Gaps = 4/178 (2%)
 Frame = +3

Query  3    GLDPRSLGKP*FLSRhtsfalslslsslhftsssVMAGAAPEGSQFDARQYDAKMQELLT  182
            G+DPRS G P      +SF       SL   S+ VMAG APEGSQFDARQYD+KM +LL+
Sbjct  410  GVDPRSSGNP----NSSSFTTEQRFFSLSIISTEVMAGLAPEGSQFDARQYDSKMSDLLS  465

Query  183  VEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPSAIQQRGIVPFCNGLDVIQQAQ  362
             +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYGFEKPSAIQQRGIVPFC GLDVIQQAQ
Sbjct  466  SDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQ  525

Query  363  SGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQIEKVMRALGDYLGVKVHACV  536
            SGTGKTATFCSG+LQQLDY   +CQALVLAPTRELAQQIEKVMRALGDY GVKVHACV
Sbjct  526  SGTGKTATFCSGILQQLDYSLTQCQALVLAPTRELAQQIEKVMRALGDYQGVKVHACV  583



>gb|KHG25459.1| Eukaryotic initiation factor 4A-8 [Gossypium arboreum]
Length=288

 Score =   258 bits (658),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  105  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            VMAG AP+ SQ+DARQYD+KM ELL  +G +FFT+YDEV++SFD MGL+ENLLRGIYAYG
Sbjct  36   VMAGVAPDVSQYDARQYDSKMNELLADDGNDFFTTYDEVYESFDKMGLQENLLRGIYAYG  95

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQ+GIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTRE
Sbjct  96   FEKPSAIQQKGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTRE  155

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  156  LAQQIEKVMRALGDYLGVKVHACV  179



>ref|XP_010688701.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Beta vulgaris 
subsp. vulgaris]
Length=413

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAPEGSQ+DARQYD KM ELL+ +G +F TSYDEV++SFD MGL ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQYDARQYDNKMSELLSEDGGDFITSYDEVYESFDKMGLLENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQL+Y+ +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLNYELLECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_002884997.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61256.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 136/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_007154632.1| hypothetical protein PHAVU_003G134800g [Phaseolus vulgaris]
 gb|ESW26626.1| hypothetical protein PHAVU_003G134800g [Phaseolus vulgaris]
Length=413

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGS FD R +D+KM +LL+ +GQ+FFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSNFDTRHFDSKMSDLLSSDGQDFFTSYDEVFESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_006595337.1| PREDICTED: eukaryotic initiation factor 4A-14 [Glycine max]
Length=794

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  105  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            VMAG APEGSQFDARQYD+KM +LL+ +GQ+FFTSYDEV+DSFDAMGL+ENLLRGIYAYG
Sbjct  381  VMAGLAPEGSQFDARQYDSKMSDLLSSDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYG  440

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTRE
Sbjct  441  FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTRE  500

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  501  LAQQIEKVMRALGDYLGVKVHACV  524



>gb|ACJ85073.1| unknown [Medicago truncatula]
Length=369

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD +Q+D KM ELL+ EGQEFFTSYDEVH++FDAMGL ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDTKQFDTKMNELLSTEGQEFFTSYDEVHETFDAMGLLENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQ+EKVMRALGDYLGVKVH  V
Sbjct  121  AQQMEKVMRALGDYLGVKVHVVV  143



>ref|XP_006453067.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 ref|XP_006453068.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 ref|XP_006474428.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Citrus sinensis]
 gb|ESR66307.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 gb|ESR66308.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 gb|KDO73513.1| hypothetical protein CISIN_1g015158mg [Citrus sinensis]
 gb|KDO73514.1| hypothetical protein CISIN_1g015158mg [Citrus sinensis]
Length=412

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 1/143 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG A EGSQFDARQ+DA+M +LL  +GQ+FFTSYDEV+D+FDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLA-EGSQFDARQFDARMNDLLGSDGQDFFTSYDEVYDTFDAMGLQENLLRGIYAYGF  59

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  119

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  120  AQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_006307670.1| hypothetical protein CARUB_v10009297mg [Capsella rubella]
 gb|EOA40568.1| hypothetical protein CARUB_v10009297mg [Capsella rubella]
Length=412

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 135/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFD RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_010502017.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Camelina sativa]
Length=271

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 134/144 (93%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEG+QFD RQ+D ++ E+L  +GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGTAPEGTQFDTRQFDQRLNEVL--DGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDY+GVKVHACV
Sbjct  119  LAQQIEKVMRALGDYIGVKVHACV  142



>gb|KEH32494.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=430

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  105  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            VMAG APEGSQFDA ++D KM +L+  +G EF+TSYDEV+DSFDAMGL ENLLRGIYAYG
Sbjct  17   VMAGLAPEGSQFDAGKFDQKMNDLIAADGDEFWTSYDEVYDSFDAMGLAENLLRGIYAYG  76

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY+  +CQALVLAPTRE
Sbjct  77   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYNVTQCQALVLAPTRE  136

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  137  LAQQIEKVMRALGDYLGVKVHACV  160



>emb|CDX75739.1| BnaC03g38220D [Brassica napus]
Length=436

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 136/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCQGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_009334733.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X2 
[Pyrus x bretschneideri]
Length=413

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA  APEGSQFD  QYDAKM EL+  EGQ+FFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSELVGAEGQDFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFSKGLDVIQQAQSGTGKTATFCSGILQQLDYGLRDCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKV RALGDYLGVKVHACV
Sbjct  121  AQQIEKVTRALGDYLGVKVHACV  143



>gb|EMS68416.1| Eukaryotic initiation factor 4A-1 [Triticum urartu]
 gb|EMT30822.1| Eukaryotic initiation factor 4A-1 [Aegilops tauschii]
Length=414

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+QYD+KM ELL   +  EFFTSYDEVH+SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKQYDSKMTELLNQGDTGEFFTSYDEVHESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>ref|XP_010062659.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Eucalyptus 
grandis]
 gb|KCW69788.1| hypothetical protein EUGRSUZ_F03152 [Eucalyptus grandis]
Length=412

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD RQYD K+ EL + +G EFFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDPRQYDEKISEL-SADGGEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  59

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYGLVQCQALVLAPTREL  119

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  120  AQQIEKVMRALGDYLGVKVHACV  142



>emb|CDX97528.1| BnaA05g25510D [Brassica napus]
Length=425

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 135/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDE HDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDESHDSFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>emb|CDY39079.1| BnaA01g29770D [Brassica napus]
Length=412

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 135/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFD MGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDVMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFAIVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_006453066.1| hypothetical protein CICLE_v10008460mg [Citrus clementina]
 gb|ESR66306.1| hypothetical protein CICLE_v10008460mg [Citrus clementina]
 gb|KDO73515.1| hypothetical protein CISIN_1g0150931mg [Citrus sinensis]
Length=413

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            M G APEGS FDAR +D+ M  LL+ EGQ+FF SYDEV+DSFD+MGLKENLLRGIYAYGF
Sbjct  1    MEGIAPEGSGFDARSFDSNMNNLLSEEGQDFFVSYDEVYDSFDSMGLKENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY+ ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYESLQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDY+GVKVHACV
Sbjct  121  AQQIEKVMRALGDYMGVKVHACV  143



>ref|XP_006407149.1| hypothetical protein EUTSA_v10020824mg [Eutrema salsugineum]
 gb|ESQ48602.1| hypothetical protein EUTSA_v10020824mg [Eutrema salsugineum]
Length=412

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 136/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_007012776.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 ref|XP_007012777.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY30395.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY30396.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
Length=413

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAPEGSQFDARQ+D+KM + L  +GQ+   S+DEV+D+FDAMGL +NLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDSKMNDFLLADGQDVIASWDEVYDTFDAMGLLQNLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>emb|CDY55205.1| BnaCnng28430D [Brassica napus]
Length=423

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 135/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDE HDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDESHDSFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_010552222.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Tarenaya hassleriana]
 ref|XP_010552223.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Tarenaya hassleriana]
Length=215

 Score =   254 bits (648),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAPEGSQFDARQ+D K+ ++L   G EFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGAAPEGSQFDARQFDQKLNDVLE-GGDEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  59

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVL PTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLGPTREL  119

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  120  AQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_006853908.1| hypothetical protein AMTR_s00036p00181640 [Amborella trichopoda]
 gb|ERN15375.1| hypothetical protein AMTR_s00036p00181640 [Amborella trichopoda]
Length=412

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  120  APEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPS  299
            APEGSQFDARQYDAKM ELL  +G++FF SYDEV +SFD+MGL+ENLLRGIYAYGFEKPS
Sbjct  4    APEGSQFDARQYDAKMSELLQADGEDFFASYDEVFESFDSMGLQENLLRGIYAYGFEKPS  63

Query  300  AIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQI  479
            AIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTRELAQQI
Sbjct  64   AIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLLECQALVLAPTRELAQQI  123

Query  480  EKVMRALGDYLGVKVHACV  536
            EKVMRALGDYLGVKVHACV
Sbjct  124  EKVMRALGDYLGVKVHACV  142



>emb|CDP03140.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG A +GSQFDARQYD KM +LL+  GQ+FFTSYDEV DSFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGVATDGSQFDARQYDTKMSDLLSAGGQDFFTSYDEVWDSFDGMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+ QALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYGLVQSQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>emb|CDY10607.1| BnaC03g70070D [Brassica napus]
Length=411

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 135/144 (94%), Gaps = 4/144 (3%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFD RQ+D K+ E   V+GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNE---VQGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  57

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  58   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  117

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  118  LAQQIEKVMRALGDYLGVKVHACV  141



>gb|KEH32495.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA ++D KM +L+  +G EF+TSYDEV+DSFDAMGL ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAGKFDQKMNDLIAADGDEFWTSYDEVYDSFDAMGLAENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY+  +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYNVTQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>dbj|BAH56988.1| AT3G13920 [Arabidopsis thaliana]
Length=398

 Score =   259 bits (663),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 136/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|NP_001104874.1| translation initiation factor [Zea mays]
 gb|AAB64289.1| translation initiation factor [Zea mays]
Length=414

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIY YG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYRYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>ref|XP_003574572.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brachypodium 
distachyon]
Length=414

 Score =   260 bits (664),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 131/144 (91%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD KM ELL   E +EFFTSYDEVH+SFD M L+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDTKMTELLNQGETEEFFTSYDEVHESFDDMSLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>ref|XP_004951905.1| PREDICTED: eukaryotic initiation factor 4A-like [Setaria italica]
Length=410

 Score =   260 bits (664),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 132/143 (92%), Gaps = 3/143 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD +QYD KMQELLT   +EFFTSYDEV +SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDGKQYDNKMQELLT---EEFFTSYDEVCESFDNMGLQENLLRGIYAYGF  57

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  58   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  117

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  118  AQQIEKVMRALGDYLGVKVHACV  140



>gb|AAL91176.1| eukaryotic translation initiation factor [Arabidopsis thaliana]
Length=412

 Score =   260 bits (664),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 136/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|NP_566469.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
 sp|P41376.1|IF4A1_ARATH RecName: Full=Eukaryotic initiation factor 4A-1; Short=eIF-4A-1; 
AltName: Full=ATP-dependent RNA helicase eIF4A-1; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 4 [Arabidopsis thaliana]
 emb|CAA46188.1| eukaryotic translation initiation factor 4A-1 [Arabidopsis thaliana]
 dbj|BAB02322.1| eukaryotic translation initiation factor; RNA helicase [Arabidopsis 
thaliana]
 emb|CAC43288.1| translation initiation factor eIF-4A1 [Arabidopsis thaliana]
 gb|AAK93634.1| putative Eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AAK96536.1| AT3g13920/MDC16_4 [Arabidopsis thaliana]
 gb|AAM14243.1| putative eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AAM19972.1| AT3g13920/MDC16_4 [Arabidopsis thaliana]
 gb|AAM98124.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31802.1| putative eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AEE75438.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
Length=412

 Score =   259 bits (663),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 136/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_009361722.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Pyrus x bretschneideri]
Length=868

 Score =   270 bits (691),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = +3

Query  3    GLDPRSLGKP---*FLSRhtsfalslslsslhftsssVMAGAAPEGSQFDARQYDAKMQE  173
            GLDPRSLG P      ++ +  ALSLSL      SS  +  AAPEGSQFD RQYD KM E
Sbjct  418  GLDPRSLGNPNSQKTRTKISCDALSLSLRLQLSHSSLAVMAAAPEGSQFDTRQYDTKMSE  477

Query  174  LLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPSAIQQRGIVPFCNGLDVIQ  353
            +L  +GQEFFTSYDEV+DSFDAMGL+ENLLRGIYAYGFEKPSAIQQRGIVPFC GLDVIQ
Sbjct  478  ILATDGQEFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQ  537

Query  354  QAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQIEKVMRALGDYLGVKVHAC  533
            QAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRELAQQIEKVMRALGDYLGV+VHAC
Sbjct  538  QAQSGTGKTATFCSGILQQLDYSLTECQALVLAPTRELAQQIEKVMRALGDYLGVRVHAC  597

Query  534  V  536
            V
Sbjct  598  V  598



>gb|AAM63951.1| Eukaryotic initiation factor 4A, putative [Arabidopsis thaliana]
Length=412

 Score =   259 bits (663),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 136/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>emb|CDY08220.1| BnaA05g13990D [Brassica napus]
Length=412

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 135/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFD RQ+D ++ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQRLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_009107078.1| PREDICTED: eukaryotic initiation factor 4A-1 [Brassica rapa]
Length=412

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 135/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFD RQ+D ++ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQRLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_006357392.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Solanum tuberosum]
Length=413

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA  A +G+QFDARQ+D+KM +LL  EG++FFTSYDEV+DSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MARLATDGAQFDARQFDSKMNDLLAAEGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQ+LVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLIQCQSLVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_011046150.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Populus euphratica]
 ref|XP_011046151.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Populus euphratica]
Length=413

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQ+DA+QYDAKM +LL  +GQ+FFT Y+EV ++FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQYDAKQYDAKMNDLLANDGQDFFTMYEEVFETFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_006369263.1| hypothetical protein POPTR_0001s20480g [Populus trichocarpa]
 ref|XP_006369264.1| translation initiation factor 4A family protein [Populus trichocarpa]
 gb|ABK93256.1| unknown [Populus trichocarpa]
 gb|ERP65832.1| hypothetical protein POPTR_0001s20480g [Populus trichocarpa]
 gb|ERP65833.1| translation initiation factor 4A family protein [Populus trichocarpa]
Length=413

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQ+DA+QYDAKM +LL  +GQ+FFT Y+EV ++FD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQYDAKQYDAKMNDLLANDGQDFFTMYEEVFETFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|XP_006392695.1| hypothetical protein EUTSA_v10011528mg [Eutrema salsugineum]
 gb|ESQ29981.1| hypothetical protein EUTSA_v10011528mg [Eutrema salsugineum]
Length=412

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 135/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAGAAPEG+QFD RQ+D ++ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGAAPEGTQFDTRQFDQRLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFTLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_001786409.1| predicted protein [Physcomitrella patens]
 gb|EDQ48779.1| predicted protein, partial [Physcomitrella patens]
Length=203

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG+APEGSQFDARQYDAKM+ +L  EG++F ++++EVH++FD MGL ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQYDAKMETILGGEGEDFISTWEEVHETFDVMGLHENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYQLLECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYL VKVHACV
Sbjct  121  AQQIEKVMRALGDYLQVKVHACV  143



>dbj|BAE98559.1| eukaryotic protein synthesis initiation factor 4A [Arabidopsis 
thaliana]
Length=412

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 135/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKT TFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTTTFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>gb|EPS63850.1| hypothetical protein M569_10933 [Genlisea aurea]
Length=413

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA ++D KM E+L  EG+EFFT+YDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDANKFDTKMNEILGGEGEEFFTNYDEVYESFDSMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFIRGLDVIQQAQSGTGKTATFCSGILQQLDYSVVDCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>ref|NP_001030693.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
 gb|AEE75439.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
Length=415

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 136/144 (94%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYD+VH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_010536184.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Tarenaya hassleriana]
Length=412

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 135/143 (94%), Gaps = 1/143 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG A EGS +DARQYD++M ELLT EG++FF++YDEV++SFD MGLKENLLRGIYAYGF
Sbjct  1    MAGVA-EGSLYDARQYDSRMSELLTEEGKDFFSTYDEVYESFDKMGLKENLLRGIYAYGF  59

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDYD ++CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYDLLQCQALVLAPTREL  119

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  120  AQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_010480021.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Camelina sativa]
Length=412

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 134/144 (93%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEG+QFD RQ+D ++ E+L  +GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGTAPEGTQFDTRQFDQRLNEVL--DGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDY+GVKVHACV
Sbjct  119  LAQQIEKVMRALGDYIGVKVHACV  142



>ref|XP_006646878.1| PREDICTED: eukaryotic initiation factor 4A-3-like isoform X1 
[Oryza brachyantha]
 ref|XP_006646879.1| PREDICTED: eukaryotic initiation factor 4A-3-like isoform X2 
[Oryza brachyantha]
Length=414

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD KMQELL   + +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDNKMQELLHQGDNEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>ref|NP_001045878.1| Os02g0146600 [Oryza sativa Japonica Group]
 sp|Q6Z2Z4.1|IF4A3_ORYSJ RecName: Full=Eukaryotic initiation factor 4A-3; Short=eIF-4A-3; 
AltName: Full=ATP-dependent RNA helicase eIF4A-3; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 23; AltName: Full=eIF4A-2 
[Oryza sativa Japonica Group]
 dbj|BAD13081.1| putative translational initiation factor eIF-4A [Oryza sativa 
Japonica Group]
 dbj|BAF07792.1| Os02g0146600 [Oryza sativa Japonica Group]
 gb|EAY84464.1| hypothetical protein OsI_05839 [Oryza sativa Indica Group]
 dbj|BAG93556.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56296.1| hypothetical protein OsJ_05367 [Oryza sativa Japonica Group]
 gb|AGT42311.1| eucaryotic initiation factor [Oryza sativa Japonica Group]
Length=414

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEGSQFDA+ YD+KMQELL   + +EFFTSYDEV +SFD MGL+ENLLRGIYAYG
Sbjct  1    MAGMAPEGSQFDAKHYDSKMQELLHQGDNEEFFTSYDEVFESFDDMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQ+LVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQSLVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>emb|CDY24057.1| BnaA06g00550D [Brassica napus]
Length=412

 Score =   258 bits (658),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 134/144 (93%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFD RQ+D K+ ++L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQKLNDVL--EGQNEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD   V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDITLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVH CV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHTCV  142



>ref|XP_010462344.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Camelina sativa]
Length=412

 Score =   258 bits (658),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 134/144 (93%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG APEG+QFD RQ+D ++ E+L  +GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGTAPEGTQFDTRQFDQRLNEVL--DGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDY+GVKVHACV
Sbjct  119  LAQQIEKVMRALGDYIGVKVHACV  142



>ref|XP_009147530.1| PREDICTED: eukaryotic initiation factor 4A-1 [Brassica rapa]
Length=412

 Score =   257 bits (657),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 134/144 (93%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QF+ RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFNTRQFDQKLNEVL--EGQNEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD   V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDITLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVH CV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHTCV  142



>ref|XP_009334734.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X3 
[Pyrus x bretschneideri]
Length=413

 Score =   257 bits (657),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA  APEGSQFD  QYDAKM + +  EGQ+FFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSDRVGAEGQDFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFSKGLDVIQQAQSGTGKTATFCSGILQQLDYGLRDCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKV RALGDYLGVKVHACV
Sbjct  121  AQQIEKVTRALGDYLGVKVHACV  143



>gb|EYU45869.1| hypothetical protein MIMGU_mgv1a007331mg [Erythranthe guttata]
Length=410

 Score =   257 bits (657),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  120  APEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPS  299
            A EGSQFD RQYD++M E+L  + QEFFTSYDEVH+SFDAMGL+ENLLRGIYAYGFEKPS
Sbjct  2    AAEGSQFDTRQYDSRMSEILQPDQQEFFTSYDEVHESFDAMGLQENLLRGIYAYGFEKPS  61

Query  300  AIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQI  479
            AIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTRELAQQI
Sbjct  62   AIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLTQCQALVLAPTRELAQQI  121

Query  480  EKVMRALGDYLGVKVHACV  536
            EKVMRALGDYLGVKVHACV
Sbjct  122  EKVMRALGDYLGVKVHACV  140



>ref|XP_009117360.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   257 bits (657),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 134/144 (93%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDEVHDSFD MGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDEVHDSFDVMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLD+  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFAIVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVK HACV
Sbjct  119  LAQQIEKVMRALGDYLGVKGHACV  142



>ref|XP_002451536.1| hypothetical protein SORBIDRAFT_04g003390 [Sorghum bicolor]
 gb|EES04512.1| hypothetical protein SORBIDRAFT_04g003390 [Sorghum bicolor]
Length=410

 Score =   257 bits (657),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 132/143 (92%), Gaps = 3/143 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD +QYD KMQE+LT   ++FFTSYDEV +SFD MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDDKQYDKKMQEILT---EDFFTSYDEVCESFDNMGLQENLLRGIYAYGF  57

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  58   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  117

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  118  AQQIEKVMRALGDYLGVKVHACV  140



>ref|XP_004486853.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Cicer arietinum]
Length=412

 Score =   257 bits (656),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG AP+GSQFDA+QYD+KM ELLT +GQEF   YDEV+D+FDAM L+ENLLRGIYAYGF
Sbjct  1    MAGLAPDGSQFDAKQYDSKMNELLT-DGQEFGVEYDEVYDTFDAMKLEENLLRGIYAYGF  59

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL  119

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  120  AQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_009598422.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Nicotiana 
tomentosiformis]
Length=208

 Score =   250 bits (639),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            M  A  EGSQFDARQ+DAK+ ELL+ +GQEFFTS DEV+DSFD MGLKENLLRGIYAYGF
Sbjct  1    MPSAVTEGSQFDARQFDAKITELLSGDGQEFFTSCDEVYDSFDDMGLKENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVL QLDY  +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLNQLDYKLLECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDY+ VK HACV
Sbjct  121  AQQIEKVMRALGDYIDVKAHACV  143



>ref|XP_010542416.1| PREDICTED: eukaryotic initiation factor 4A-1 [Tarenaya hassleriana]
Length=412

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQ+D K+ +L+   G EFFTSYDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDQKLNDLIE-GGDEFFTSYDEVYESFDSMGLQENLLRGIYAYGF  59

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  120  AQQIEKVMRALGDYLGVKVHACV  142



>gb|AFW69337.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=411

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 131/140 (94%), Gaps = 1/140 (1%)
 Frame = +3

Query  120  APEGSQFDARQYDAKMQELLTV-EGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKP  296
            APEGSQFDA+ YD+KMQELL+  E +EFFTSYDEV +SFD MGL+ENLLRGIYAYGFEKP
Sbjct  2    APEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYGFEKP  61

Query  297  SAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQ  476
            SAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTRELAQQ
Sbjct  62   SAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRELAQQ  121

Query  477  IEKVMRALGDYLGVKVHACV  536
            IEKVMRALGDYLGVKVHACV
Sbjct  122  IEKVMRALGDYLGVKVHACV  141



>ref|NP_001151064.1| LOC100284697 [Zea mays]
 gb|ACF79496.1| unknown [Zea mays]
 gb|ACG41480.1| eukaryotic initiation factor 4A [Zea mays]
Length=410

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 3/143 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD +QYD KMQE+LT   ++FFTSYD+V +SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDDKQYDKKMQEILT---EDFFTSYDDVCESFDSMGLQENLLRGIYAYGF  57

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  58   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  117

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  118  AQQIEKVMRALGDYLGVKVHACV  140



>sp|Q41741.1|IF4A_MAIZE RecName: Full=Eukaryotic initiation factor 4A; Short=eIF-4A; 
AltName: Full=ATP-dependent RNA helicase eIF4A [Zea mays]
 gb|AAA82736.1| translation initiation factor eIF-4A [Zea mays]
Length=410

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 3/143 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFD +QYD KMQE+LT   ++FFTSYD+V +SFD+MGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDDKQYDKKMQEILT---EDFFTSYDDVCESFDSMGLQENLLRGIYAYGF  57

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQALVLAPTREL
Sbjct  58   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTREL  117

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  118  AQQIEKVMRALGDYLGVKVHACV  140



>ref|XP_010534921.1| PREDICTED: eukaryotic initiation factor 4A-1 [Tarenaya hassleriana]
Length=412

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 132/143 (92%), Gaps = 1/143 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDARQ+D K+ +LL   G EFFTSYDEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDARQFDQKLNDLLD-GGDEFFTSYDEVCESFDAMGLQENLLRGIYAYGF  59

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  V+CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYSLVQCQALVLAPTREL  119

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  120  AQQIEKVMRALGDYLGVKVHACV  142



>ref|XP_009146433.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 133/144 (92%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFDARQ+D K+ E+L  EGQ EFFTSYDE HDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDARQFDQKLNEVL--EGQDEFFTSYDESHDSFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYSLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRA G YLGVKVHACV
Sbjct  119  LAQQIEKVMRARGAYLGVKVHACV  142



>ref|XP_008242400.1| PREDICTED: eukaryotic initiation factor 4A-2 [Prunus mume]
Length=806

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  117  AAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKP  296
            AAPEGSQFD RQYD+KM ELL  +GQEFFTSYDEV+DSFD+MGL+ENLLRGIYAYGFEKP
Sbjct  397  AAPEGSQFDTRQYDSKMTELLATDGQEFFTSYDEVYDSFDSMGLQENLLRGIYAYGFEKP  456

Query  297  SAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQ  476
            SAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY   ECQALVLAPTRELAQQ
Sbjct  457  SAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLTECQALVLAPTRELAQQ  516

Query  477  IEKVMRALGDYLGVKVHACV  536
            IEKVMRALGDYLGV+VHACV
Sbjct  517  IEKVMRALGDYLGVRVHACV  536



>ref|XP_001783934.1| predicted protein [Physcomitrella patens]
 gb|EDQ51244.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG+APEGSQFDARQYDAKM+ +L+ EG +F ++++EVH++FD MGL ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQYDAKMENILSGEGDDFISTWEEVHETFDVMGLHENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYQLLECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYL VKVHACV
Sbjct  121  AQQIEKVMRALGDYLQVKVHACV  143



>ref|XP_009334735.1| PREDICTED: eukaryotic initiation factor 4A-6-like isoform X4 
[Pyrus x bretschneideri]
Length=412

 Score =   255 bits (651),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MA  APEGSQFD  QYDAKM E+   EGQ+FFTSYDEVHDSFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSEV-GAEGQDFFTSYDEVHDSFDAMGLQENLLRGIYAYGF  59

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTREL
Sbjct  60   EKPSAIQQRGIVPFSKGLDVIQQAQSGTGKTATFCSGILQQLDYGLRDCQALVLAPTREL  119

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKV RALGDYLGVKVHACV
Sbjct  120  AQQIEKVTRALGDYLGVKVHACV  142



>emb|CDY33073.1| BnaC06g07060D [Brassica napus]
Length=412

 Score =   255 bits (651),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 134/144 (93%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QF+ RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRG+YAYG
Sbjct  1    MAGSAPEGTQFNTRQFDQKLNEVL--EGQNEFFTSYDEVHESFDAMGLQENLLRGVYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQL+   V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLEITLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVH CV
Sbjct  119  LAQQIEKVMRALGDYLGVKVHTCV  142



>ref|XP_009334732.1| PREDICTED: eukaryotic initiation factor 4A-6-like isoform X1 
[Pyrus x bretschneideri]
Length=414

 Score =   255 bits (651),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 129/144 (90%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQEL-LTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MA  APEGSQFD  QYDAKM E  +  EGQ+FFTSYDEVHDSFDAMGL+ENLLRGIYAYG
Sbjct  1    MAAVAPEGSQFDTHQYDAKMSEFRVGAEGQDFFTSYDEVHDSFDAMGLQENLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY   +CQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFSKGLDVIQQAQSGTGKTATFCSGILQQLDYGLRDCQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKV RALGDYLGVKVHACV
Sbjct  121  LAQQIEKVTRALGDYLGVKVHACV  144



>ref|XP_002514133.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF48087.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=764

 Score =   263 bits (673),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA+ +D+KM ELLT +G++FFT+YDEV++SFD+MGL+ENLLRGIYAYGF
Sbjct  352  MAGLAPEGSQFDAKHFDSKMNELLTADGEDFFTTYDEVYESFDSMGLQENLLRGIYAYGF  411

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  VECQA VLAPTREL
Sbjct  412  EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYALVECQAXVLAPTREL  471

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  472  AQQIEKVMRALGDYLGVKVHACV  494



>ref|XP_001758216.1| predicted protein [Physcomitrella patens]
 gb|EDQ77038.1| predicted protein [Physcomitrella patens]
Length=414

 Score =   254 bits (650),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG-  284
            MAG+APEGSQFDARQYDAKM+ +L+ EG++F ++++EVHD+FD MGL ENLLRGIYAYG 
Sbjct  1    MAGSAPEGSQFDARQYDAKMENILSAEGEDFISTWEEVHDTFDVMGLHENLLRGIYAYGS  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYQLLECQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYL VKVHACV
Sbjct  121  LAQQIEKVMRALGDYLQVKVHACV  144



>ref|XP_002891805.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68064.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 133/144 (92%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+A EG+QFD RQ+D K+ E+L  EGQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAAEGTQFDTRQFDQKLNEVL--EGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDY GVKVHACV
Sbjct  119  LAQQIEKVMRALGDYQGVKVHACV  142



>ref|XP_001765568.1| predicted protein [Physcomitrella patens]
 gb|EDQ69618.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG+APEGSQFDARQYDAKM+ +L  EG++F ++++EVH++FD MGL ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQYDAKMETILGGEGEDFISTWEEVHETFDVMGLHENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYQLLECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYL VKVHACV
Sbjct  121  AQQIEKVMRALGDYLQVKVHACV  143



>ref|NP_175829.1| eukaryotic initiation factor 4A-2 [Arabidopsis thaliana]
 sp|P41377.1|IF4A2_ARATH RecName: Full=Eukaryotic initiation factor 4A-2; Short=eIF-4A-2; 
AltName: Full=ATP-dependent RNA helicase eIF4A-2; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 19 [Arabidopsis 
thaliana]
 gb|AAD25605.1|AC005287_7 Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AAK62368.1|AF386923_1 Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AAL16231.1|AF428462_1 At1g54270/F20D21_52 [Arabidopsis thaliana]
 emb|CAA46189.1| eukaryotic translation initiation factor 4A-2 [Arabidopsis thaliana]
 gb|AAM65512.1| eukaryotic translation initiation factor 4A, putative [Arabidopsis 
thaliana]
 gb|AAP37863.1| At1g54270 [Arabidopsis thaliana]
 dbj|BAE98493.1| Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AEE33073.1| translation initiation factor 4A-2 [Arabidopsis thaliana]
Length=412

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 134/144 (93%), Gaps = 3/144 (2%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQ-EFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG+APEG+QFD RQ+D ++ E+L  +GQ EFFTSYDEVH+SFDAMGL+ENLLRGIYAYG
Sbjct  1    MAGSAPEGTQFDTRQFDQRLNEVL--DGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG  58

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  ++CQALVLAPTRE
Sbjct  59   FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYALLQCQALVLAPTRE  118

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDY GVKVHACV
Sbjct  119  LAQQIEKVMRALGDYQGVKVHACV  142



>gb|ABR18348.1| unknown [Picea sitchensis]
 gb|ACN39814.1| unknown [Picea sitchensis]
 gb|ACN40764.1| unknown [Picea sitchensis]
Length=413

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG   + + FDARQYDAKM+E+L+ EG E F SYDEVH+SFD MGL ENLLRGIYAYGF
Sbjct  1    MAGVVADATLFDARQYDAKMKEILSTEGDELFASYDEVHESFDEMGLHENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLLDCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYL VKVHACV
Sbjct  121  AQQIEKVMRALGDYLQVKVHACV  143



>ref|XP_010324046.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Solanum lycopersicum]
Length=413

 Score =   253 bits (645),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAGAAP+GSQFDARQ+D+KM ELL  EGQEFFTSYDE +D+FDAM LKE+LL+GIYAYGF
Sbjct  1    MAGAAPDGSQFDARQFDSKMTELLNAEGQEFFTSYDEAYDTFDAMELKEDLLKGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQ+QSGTGKTATFCSGVLQQLDY+ + CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGLDVIQQSQSGTGKTATFCSGVLQQLDYELLGCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVM ALG  L VKVHACV
Sbjct  121  AQQIEKVMEALGQCLKVKVHACV  143



>ref|XP_001771324.1| predicted protein [Physcomitrella patens]
 gb|EDQ63884.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG+APEGSQFDARQYDAKM+ +L  EG++F ++++EVH++FD M L ENLLRGIYAYGF
Sbjct  1    MAGSAPEGSQFDARQYDAKMETVLAGEGEDFISTWEEVHETFDVMDLHENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  +ECQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFTKGLDVIQQAQSGTGKTATFCSGILQQLDYQLLECQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYL VKVHACV
Sbjct  121  AQQIEKVMRALGDYLQVKVHACV  143



>ref|XP_010090077.1| Eukaryotic initiation factor 4A-15 [Morus notabilis]
 gb|EXB38874.1| Eukaryotic initiation factor 4A-15 [Morus notabilis]
Length=857

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 135/143 (94%), Gaps = 1/143 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG A EGSQFDARQ+DAKM ++L+ +GQ+FFT+YDEV+D+FDAMGL ENLLRGIYAYGF
Sbjct  446  MAGVA-EGSQFDARQFDAKMNDILSADGQDFFTTYDEVYDTFDAMGLHENLLRGIYAYGF  504

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC GLDVIQQAQSGTGKTATFCSGVLQQL+Y  VECQALVLAPTREL
Sbjct  505  EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLEYGLVECQALVLAPTREL  564

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  565  AQQIEKVMRALGDYLGVKVHACV  587



>ref|XP_004508240.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cicer 
arietinum]
Length=859

 Score =   260 bits (664),  Expect = 6e-78, Method: Composition-based stats.
 Identities = 120/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  105  VMAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            VMAG APEGSQFDA++YD KM +L+  +G++FF + DEV+DSFDAMGL+ENLLRGIYAYG
Sbjct  446  VMAGEAPEGSQFDAKKYDDKMNDLIAADGEDFFGTSDEVYDSFDAMGLQENLLRGIYAYG  505

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY+  +CQALVLAPTRE
Sbjct  506  FEKPSAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYNVTQCQALVLAPTRE  565

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  566  LAQQIEKVMRALGDYLGVKVHACV  589



>ref|XP_011470735.1| PREDICTED: eukaryotic initiation factor 4A-9 [Fragaria vesca 
subsp. vesca]
Length=801

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  117  AAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKP  296
            AAPEGSQFD  Q+D +M ELLT EGQ+FFTSYDEV+DSFD MGL+ENLLRGIYAYGFEKP
Sbjct  392  AAPEGSQFDTHQFDNRMNELLTAEGQDFFTSYDEVYDSFDNMGLQENLLRGIYAYGFEKP  451

Query  297  SAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQ  476
            SAIQQRGIVPF  GLDVIQQAQSGTGKTATFCSG+LQQLDY  ++CQALVLAPTRELAQQ
Sbjct  452  SAIQQRGIVPFIKGLDVIQQAQSGTGKTATFCSGILQQLDYSLLDCQALVLAPTRELAQQ  511

Query  477  IEKVMRALGDYLGVKVHACV  536
            IEKVMRALGDYLGVKVHACV
Sbjct  512  IEKVMRALGDYLGVKVHACV  531



>gb|AAN74636.1| DEAD box RNA helicase [Pisum sativum]
Length=413

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGF  287
            MAG APEGSQFDA ++DA+M +L+  +G EF+T  DEV +SFDAMGL+ENLLRGIYAYGF
Sbjct  1    MAGLAPEGSQFDAGKFDARMNDLMAGDGNEFYTISDEVCESFDAMGLQENLLRGIYAYGF  60

Query  288  EKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTREL  467
            EKPSAIQQRGIVPFC G DVIQQAQSGTGKTATFCSGVLQQLDY+  +CQALVLAPTREL
Sbjct  61   EKPSAIQQRGIVPFCKGHDVIQQAQSGTGKTATFCSGVLQQLDYNVTQCQALVLAPTREL  120

Query  468  AQQIEKVMRALGDYLGVKVHACV  536
            AQQIEKVMRALGDYLGVKVHACV
Sbjct  121  AQQIEKVMRALGDYLGVKVHACV  143



>emb|CDY49861.1| BnaA02g16100D [Brassica napus]
Length=427

 Score =   248 bits (633),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = +3

Query  105  VMAGAAPEGSQFDARQYDAKMQELLTVEGQE-FFTSYDEVHDSFDAMGLKENLLRGIYAY  281
            VMAG A EG+Q+D RQ+D+KM  +L  EG+E F+T+YDEV DSFDAM LK +LLRGIYAY
Sbjct  13   VMAGMASEGTQYDPRQFDSKMNAILGEEGEETFYTTYDEVCDSFDAMELKSDLLRGIYAY  72

Query  282  GFEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTR  461
            GFEKPSAIQQRGI+PFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTR
Sbjct  73   GFEKPSAIQQRGIIPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTR  132

Query  462  ELAQQIEKVMRALGDYLGVKVHACV  536
            ELAQQIEKVMRALGDYLGVKVHACV
Sbjct  133  ELAQQIEKVMRALGDYLGVKVHACV  157



>ref|XP_009779503.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Nicotiana 
sylvestris]
Length=409

 Score =   247 bits (630),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  138  FDARQYDAKMQELLTVEGQEFFTSYDEVHDSFDAMGLKENLLRGIYAYGFEKPSAIQQRG  317
            FDARQ+DAK+ ELL+ +GQEFFT YDEV+DSFD MGLKENL+RGIYAYGFEKPSAIQQRG
Sbjct  7    FDARQFDAKITELLSGDGQEFFTPYDEVYDSFDNMGLKENLVRGIYAYGFEKPSAIQQRG  66

Query  318  IVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRELAQQIEKVMRA  497
            IVPFC GLDVIQQAQSGTGKTATFCSGVL QLDY+ +ECQALVLAPTRELAQQIEKVMRA
Sbjct  67   IVPFCKGLDVIQQAQSGTGKTATFCSGVLNQLDYELLECQALVLAPTRELAQQIEKVMRA  126

Query  498  LGDYLGVKVHACV  536
            LGDYLGVK HACV
Sbjct  127  LGDYLGVKAHACV  139



>emb|CDY53867.1| BnaC02g46260D [Brassica napus]
Length=422

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQE-FFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG A EG+Q+D RQ+D+KM  +L  EG+E F+T+YDEV DSFDAM LK +LLRGIYAYG
Sbjct  1    MAGMASEGTQYDPRQFDSKMNAILGEEGEETFYTTYDEVCDSFDAMELKSDLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGI+PFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIIPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



>ref|XP_009127948.1| PREDICTED: eukaryotic initiation factor 4A-3 isoform X1 [Brassica 
rapa]
Length=414

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = +3

Query  108  MAGAAPEGSQFDARQYDAKMQELLTVEGQE-FFTSYDEVHDSFDAMGLKENLLRGIYAYG  284
            MAG A EG+Q+D RQ+D+KM  +L  EG+E F+T+YDEV DSFDAM LK +LLRGIYAYG
Sbjct  1    MAGMASEGTQYDPRQFDSKMNAILGEEGEETFYTTYDEVCDSFDAMELKSDLLRGIYAYG  60

Query  285  FEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLDYDKVECQALVLAPTRE  464
            FEKPSAIQQRGI+PFC GLDVIQQAQSGTGKTATFCSGVLQQLDY  V+CQALVLAPTRE
Sbjct  61   FEKPSAIQQRGIIPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYTLVQCQALVLAPTRE  120

Query  465  LAQQIEKVMRALGDYLGVKVHACV  536
            LAQQIEKVMRALGDYLGVKVHACV
Sbjct  121  LAQQIEKVMRALGDYLGVKVHACV  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000