BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF020P07

Length=482
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99148.1|  unnamed protein product                                125   6e-32   Coffea canephora [robusta coffee]
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14          122   5e-31   Vitis vinifera
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14          120   4e-30   Sesamum indicum [beniseed]
gb|ADJ68049.1|  auxin responsive protein                                115   4e-28   Catharanthus roseus [chatas]
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14          113   2e-27   Sesamum indicum [beniseed]
emb|CBI26357.3|  unnamed protein product                                111   1e-26   Vitis vinifera
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   107   3e-25   
gb|KJB38278.1|  hypothetical protein B456_006G246000                    106   2e-24   Gossypium raimondii
ref|XP_009611797.1|  PREDICTED: auxin-responsive protein IAA14          104   4e-24   Nicotiana tomentosiformis
gb|KJB38279.1|  hypothetical protein B456_006G246000                    103   4e-24   Gossypium raimondii
gb|AEE25653.1|  auxin-responsive protein                                104   5e-24   Gossypium hirsutum [American cotton]
gb|KJB38280.1|  hypothetical protein B456_006G246000                    104   6e-24   Gossypium raimondii
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    103   2e-23   Gossypium arboreum [tree cotton]
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          101   5e-23   Prunus mume [ume]
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like   99.8    2e-22   Nicotiana sylvestris
gb|KDP40274.1|  hypothetical protein JCGZ_02272                       99.8    2e-22   Jatropha curcas
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like    99.8    2e-22   Nicotiana tomentosiformis
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like   99.0    5e-22   Nicotiana sylvestris
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg           99.0    5e-22   
ref|NP_001240213.1|  auxin-induced protein ali50                      98.2    9e-22   Glycine max [soybeans]
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like   98.2    9e-22   Eucalyptus grandis [rose gum]
ref|XP_007034957.1|  Indole-3-acetic acid inducible 14 isoform 2      97.1    1e-21   
ref|XP_011030585.1|  PREDICTED: auxin-responsive protein IAA14-li...  97.8    2e-21   Populus euphratica
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...  97.8    2e-21   Cicer arietinum [garbanzo]
gb|KHN30563.1|  Auxin-responsive protein IAA14                        97.4    2e-21   Glycine soja [wild soybean]
gb|KHN05057.1|  Auxin-responsive protein IAA14                        97.8    2e-21   Glycine soja [wild soybean]
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...  97.8    2e-21   
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...  97.8    2e-21   Populus euphratica
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like   98.2    2e-21   
ref|NP_001280875.1|  auxin-responsive protein IAA14-like              97.1    3e-21   Malus domestica [apple tree]
gb|AFK42031.1|  unknown                                               95.9    5e-21   Medicago truncatula
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                  96.3    5e-21   Gossypium arboreum [tree cotton]
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like   95.9    8e-21   
gb|KEH42779.1|  auxin-responsive AUX/IAA family protein               94.7    9e-21   Medicago truncatula
gb|KEH42778.1|  auxin-responsive AUX/IAA family protein               95.1    1e-20   Medicago truncatula
gb|KJB28413.1|  hypothetical protein B456_005G046500                  95.1    1e-20   Gossypium raimondii
ref|XP_003591806.1|  Indoleacetic acid-induced-like protein           94.7    1e-20   Medicago truncatula
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...  94.7    2e-20   Populus euphratica
ref|XP_011027545.1|  PREDICTED: auxin-responsive protein IAA14 is...  94.7    2e-20   Populus euphratica
ref|XP_008341049.1|  PREDICTED: auxin-responsive protein IAA7-like    93.6    2e-20   
dbj|BAH15071.1|  indole-3-acetic acid 14 transcription factor like    94.4    3e-20   Malus prunifolia
emb|CDY63910.1|  BnaC01g43640D                                        93.6    4e-20   Brassica napus [oilseed rape]
gb|AFZ78617.1|  hypothetical protein                                  93.6    5e-20   Populus tomentosa [Chinese white poplar]
gb|AFK37379.1|  unknown                                               93.2    6e-20   Medicago truncatula
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                  93.2    6e-20   Arabis alpina [alpine rockcress]
ref|NP_001266070.1|  IAA14                                            93.2    6e-20   Solanum lycopersicum
ref|XP_008362015.1|  PREDICTED: auxin-responsive protein IAA14-like   93.2    7e-20   
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg              93.2    8e-20   Erythranthe guttata [common monkey flower]
ref|XP_002311658.1|  aux/IAA family protein                           93.2    8e-20   Populus trichocarpa [western balsam poplar]
gb|KFK24541.1|  hypothetical protein AALP_AAs58011U000100             92.4    1e-19   Arabis alpina [alpine rockcress]
gb|ADL70639.1|  indole-3-acetic acid inducible 14                     90.5    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70642.1|  indole-3-acetic acid inducible 14                     90.5    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70640.1|  indole-3-acetic acid inducible 14                     90.5    3e-19   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56942.1|  AT4G14550                                            90.5    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974355.1|  auxin-responsive protein IAA7                       90.9    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g           91.3    3e-19   Phaseolus vulgaris [French bean]
emb|CAC84710.1|  aux/IAA protein                                      91.7    3e-19   Populus tremula x Populus tremuloides
gb|AAM65301.1|  indoleacetic acid (IAA)-inducible gene (IAA7)         91.3    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188945.1|  auxin-responsive protein IAA7                       91.3    3e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93627.2|  indole-3-acetic acid inducible 14                     90.1    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002315736.1|  aux/IAA family protein                           91.3    4e-19   Populus trichocarpa [western balsam poplar]
gb|ADB93625.2|  indole-3-acetic acid inducible 14                     90.1    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883395.1|  hypothetical protein ARALYDRAFT_319024           90.9    5e-19   Arabidopsis lyrata subsp. lyrata
gb|ADB93629.2|  indole-3-acetic acid inducible 14                     90.1    5e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93628.1|  indole-3-acetic acid inducible 14                     90.1    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288823.1|  auxin-responsive protein IAA7                    90.9    5e-19   Brassica rapa
gb|ADL70641.1|  indole-3-acetic acid inducible 14                     89.7    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512022.1|  PREDICTED: auxin-responsive protein IAA7         90.5    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006298251.1|  hypothetical protein CARUB_v10014321mg           90.9    6e-19   
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like   90.5    6e-19   Solanum tuberosum [potatoes]
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like   90.1    8e-19   Cucumis melo [Oriental melon]
emb|CAB46059.1|  IAA7 like protein                                    90.1    8e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AFZ78616.1|  hypothetical protein                                  89.4    1e-18   Populus tomentosa [Chinese white poplar]
ref|NP_193191.2|  auxin-responsive protein IAA14                      89.7    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004134097.1|  PREDICTED: auxin-responsive protein IAA14-li...  89.4    1e-18   
ref|XP_010488346.1|  PREDICTED: auxin-responsive protein IAA7-like    89.7    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative         89.7    1e-18   Ricinus communis
ref|XP_004172452.1|  PREDICTED: auxin-responsive protein IAA14-like   89.7    1e-18   
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...  89.4    1e-18   Cucumis sativus [cucumbers]
ref|XP_006414696.1|  hypothetical protein EUTSA_v10026031mg           89.4    2e-18   
ref|XP_004150437.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  89.4    2e-18   
gb|AFK44393.1|  unknown                                               89.0    2e-18   Lotus japonicus
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16             89.0    2e-18   
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like   88.6    3e-18   Cucumis melo [Oriental melon]
ref|XP_010466604.1|  PREDICTED: auxin-responsive protein IAA7-like    87.8    5e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009135842.1|  PREDICTED: auxin-responsive protein IAA7-like    87.4    8e-18   Brassica rapa
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like   87.0    9e-18   Tarenaya hassleriana [spider flower]
ref|NP_001268036.1|  uncharacterized protein LOC100250231             87.0    1e-17   Vitis vinifera
emb|CDY10349.1|  BnaC05g29300D                                        87.0    1e-17   Brassica napus [oilseed rape]
gb|KJB82526.1|  hypothetical protein B456_013G200700                  85.9    1e-17   Gossypium raimondii
gb|AAM21317.1|AF373100_1  auxin-regulated protein                     86.7    1e-17   Populus tremula x Populus tremuloides
ref|XP_010440448.1|  PREDICTED: auxin-responsive protein IAA14-like   86.3    2e-17   Camelina sativa [gold-of-pleasure]
gb|EYU46510.1|  hypothetical protein MIMGU_mgv1a013084mg              86.3    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_010435110.1|  PREDICTED: auxin-responsive protein IAA14        85.9    2e-17   Camelina sativa [gold-of-pleasure]
gb|AFS44507.1|  auxin repressor                                       85.9    2e-17   Fragaria x ananassa
ref|XP_010450026.1|  PREDICTED: auxin-responsive protein IAA14-like   85.9    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002868277.1|  hypothetical protein ARALYDRAFT_493451           85.5    3e-17   
emb|CAN72026.1|  hypothetical protein VITISV_014421                   85.9    3e-17   Vitis vinifera
ref|XP_006406100.1|  hypothetical protein EUTSA_v10021428mg           85.5    4e-17   Eutrema salsugineum [saltwater cress]
gb|EYU33008.1|  hypothetical protein MIMGU_mgv1a012321mg              85.5    4e-17   Erythranthe guttata [common monkey flower]
gb|KJB82525.1|  hypothetical protein B456_013G200700                  85.5    4e-17   Gossypium raimondii
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like   85.1    6e-17   Vitis vinifera
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g           85.1    6e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like   85.1    6e-17   Populus euphratica
ref|XP_004288427.1|  PREDICTED: auxin-responsive protein IAA14-like   84.7    7e-17   Fragaria vesca subsp. vesca
ref|XP_006284476.1|  hypothetical protein CARUB_v10005662mg           84.3    1e-16   Capsella rubella
gb|AEE25654.1|  auxin-responsive protein                              84.0    1e-16   Gossypium hirsutum [American cotton]
gb|KJB44872.1|  hypothetical protein B456_007G276900                  83.6    1e-16   Gossypium raimondii
gb|KJB44873.1|  hypothetical protein B456_007G276900                  83.6    2e-16   Gossypium raimondii
ref|XP_010087762.1|  Auxin-responsive protein IAA7                    84.0    2e-16   
ref|XP_010102292.1|  Auxin-responsive protein IAA16                   83.2    3e-16   Morus notabilis
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                  83.2    3e-16   Gossypium arboreum [tree cotton]
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14        82.8    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g           82.8    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like   82.4    5e-16   Populus euphratica
gb|ABH01143.1|  auxin-regulated protein                               80.5    3e-15   Populus tomentosa [Chinese white poplar]
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg           80.1    3e-15   Capsella rubella
emb|CDY47148.1|  BnaA08g05350D                                        80.1    3e-15   Brassica napus [oilseed rape]
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like   80.1    3e-15   Nelumbo nucifera [Indian lotus]
ref|XP_009107777.1|  PREDICTED: auxin-responsive protein IAA14        79.7    4e-15   Brassica rapa
gb|ABR08763.1|  auxin-resistance protein 3                            77.8    5e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70687.1|  indole-3-acetic acid inducible 17                     77.8    5e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70689.1|  indole-3-acetic acid inducible 17                     77.8    5e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CDY62130.1|  BnaC08g47390D                                        79.3    5e-15   Brassica napus [oilseed rape]
ref|XP_002889499.1|  hypothetical protein ARALYDRAFT_470401           79.3    6e-15   
ref|XP_006304183.1|  hypothetical protein CARUB_v10010236mg           79.3    6e-15   Capsella rubella
gb|ABR08758.1|  auxin-resistance protein 3                            77.8    6e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93635.1|  indole-3-acetic acid inducible 17                     78.2    6e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70684.1|  indole-3-acetic acid inducible 17                     77.8    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like   79.3    6e-15   Nelumbo nucifera [Indian lotus]
gb|ADL70685.1|  indole-3-acetic acid inducible 17                     77.8    6e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CAH59413.1|  auxin resistance protein                             79.0    6e-15   Plantago major [cart-track plant]
gb|KDP23667.1|  hypothetical protein JCGZ_23500                       79.3    7e-15   Jatropha curcas
gb|KJB11146.1|  hypothetical protein B456_001G242900                  79.3    7e-15   Gossypium raimondii
ref|NP_001266049.1|  IAA9 protein                                     79.0    8e-15   Solanum lycopersicum
gb|AEE25650.1|  auxin-responsive protein                              79.0    9e-15   Gossypium hirsutum [American cotton]
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member          78.6    1e-14   Ipomoea nil [qian niu]
gb|KDO53919.1|  hypothetical protein CISIN_1g026811mg                 78.2    1e-14   Citrus sinensis [apfelsine]
gb|KJB11145.1|  hypothetical protein B456_001G242900                  78.6    1e-14   Gossypium raimondii
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like   78.6    1e-14   Elaeis guineensis
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg           78.6    1e-14   Citrus clementina [clementine]
gb|KJB11141.1|  hypothetical protein B456_001G242900                  78.6    1e-14   Gossypium raimondii
ref|XP_007050422.1|  Indole-3-acetic acid inducible 14 isoform 2      78.6    1e-14   
emb|CAN63268.1|  hypothetical protein VITISV_013635                   78.6    1e-14   Vitis vinifera
emb|CDY15493.1|  BnaA08g27770D                                        78.2    1e-14   Brassica napus [oilseed rape]
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like      78.2    1e-14   Sesamum indicum [beniseed]
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1      78.6    2e-14   
gb|EPS64756.1|  hypothetical protein M569_10024                       77.8    2e-14   Genlisea aurea
gb|KJB11142.1|  hypothetical protein B456_001G242900                  77.8    2e-14   Gossypium raimondii
ref|XP_009118658.1|  PREDICTED: auxin-responsive protein IAA17-like   77.8    2e-14   Brassica rapa
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14        77.8    2e-14   Tarenaya hassleriana [spider flower]
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                     77.8    2e-14   Solanum tuberosum [potatoes]
emb|CDY32537.1|  BnaA09g50590D                                        77.8    2e-14   Brassica napus [oilseed rape]
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17        77.4    2e-14   Brassica rapa
ref|NP_171921.1|  auxin-responsive protein IAA17                      77.0    3e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64837.1|  putative auxin-induced protein, IAA17/AXR3-1          77.0    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457463.1|  PREDICTED: auxin-responsive protein IAA17        77.0    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009119323.1|  PREDICTED: auxin-responsive protein IAA17-like   76.6    4e-14   Brassica rapa
ref|XP_010483317.1|  PREDICTED: auxin-responsive protein IAA17-like   76.6    4e-14   Camelina sativa [gold-of-pleasure]
emb|CDX89832.1|  BnaA10g02500D                                        76.6    4e-14   
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16        76.6    5e-14   Nicotiana tomentosiformis
ref|XP_010475075.1|  PREDICTED: auxin-responsive protein IAA17-like   76.3    6e-14   Camelina sativa [gold-of-pleasure]
gb|KDP21369.1|  hypothetical protein JCGZ_21840                       76.3    8e-14   Jatropha curcas
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like      75.9    8e-14   Populus euphratica
ref|NP_001288939.1|  auxin-responsive protein IAA16                   75.9    9e-14   Brassica rapa
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760        75.9    1e-13   Amborella trichopoda
emb|CDY50750.1|  BnaAnng10570D                                        75.9    1e-13   Brassica napus [oilseed rape]
emb|CDY10068.1|  BnaC08g43830D                                        75.5    1e-13   Brassica napus [oilseed rape]
ref|XP_002884465.1|  indoleacetic acid-induced protein 16             75.5    1e-13   
emb|CDY18214.1|  BnaC05g02370D                                        75.5    1e-13   Brassica napus [oilseed rape]
emb|CDY41894.1|  BnaC05g47100D                                        75.5    1e-13   Brassica napus [oilseed rape]
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative            75.5    1e-13   Ricinus communis
ref|XP_002302075.1|  auxin-induced protein aux28                      75.1    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g           75.1    2e-13   Phaseolus vulgaris [French bean]
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like   74.7    2e-13   Brassica rapa
emb|CDY30017.1|  BnaC01g39910D                                        74.7    2e-13   Brassica napus [oilseed rape]
ref|XP_004156465.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  74.7    3e-13   
ref|NP_187124.1|  auxin-responsive protein IAA16                      74.3    3e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CDY63072.1|  BnaCnng41350D                                        76.3    3e-13   Brassica napus [oilseed rape]
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                    74.3    3e-13   Nicotiana tabacum [American tobacco]
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16        74.3    3e-13   Prunus mume [ume]
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16        74.3    3e-13   Nicotiana sylvestris
ref|XP_006408158.1|  hypothetical protein EUTSA_v10021441mg           73.9    4e-13   
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg           73.9    4e-13   Eutrema salsugineum [saltwater cress]
emb|CAC84711.1|  aux/IAA protein                                      73.9    5e-13   Populus tremula x Populus tremuloides
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...  73.6    5e-13   Elaeis guineensis
ref|XP_010463960.1|  PREDICTED: auxin-responsive protein IAA16-like   73.6    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...  73.6    5e-13   
ref|XP_006418149.1|  hypothetical protein EUTSA_v10008679mg           73.6    6e-13   Eutrema salsugineum [saltwater cress]
gb|AAC39440.1|  IAA17/AXR3-1 protein                                  73.6    6e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like   73.6    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16        73.6    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002306817.1|  hypothetical protein POPTR_0005s23980g           73.6    6e-13   
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like      73.6    6e-13   Populus euphratica
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                 73.2    7e-13   Citrus sinensis [apfelsine]
ref|NP_001280973.1|  auxin-responsive protein IAA16                   73.6    7e-13   Malus domestica [apple tree]
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16        73.2    7e-13   Pyrus x bretschneideri [bai li]
ref|XP_006383686.1|  auxin-induced protein aux28                      73.2    8e-13   Populus trichocarpa [western balsam poplar]
gb|EPS60474.1|  hypothetical protein M569_14329                       72.4    1e-12   Genlisea aurea
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like   72.4    1e-12   Phoenix dactylifera
gb|KDO48908.1|  hypothetical protein CISIN_1g026005mg                 71.6    1e-12   Citrus sinensis [apfelsine]
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                  72.4    2e-12   Arabis alpina [alpine rockcress]
ref|XP_006471686.1|  PREDICTED: auxin-responsive protein IAA16-li...  72.0    2e-12   
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg           72.8    2e-12   
ref|XP_006432921.1|  hypothetical protein CICLE_v10002290mg           72.0    2e-12   
gb|KGN60808.1|  hypothetical protein Csa_2G010920                     72.0    2e-12   Cucumis sativus [cucumbers]
ref|XP_010923479.1|  PREDICTED: auxin-responsive protein IAA30-li...  72.0    2e-12   Elaeis guineensis
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg           72.0    2e-12   Citrus clementina [clementine]
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like   72.0    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...  72.0    2e-12   Elaeis guineensis
ref|XP_006432922.1|  hypothetical protein CICLE_v10002290mg           71.6    2e-12   Citrus clementina [clementine]
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg           71.2    3e-12   Citrus clementina [clementine]
gb|KDO48906.1|  hypothetical protein CISIN_1g026005mg                 71.2    3e-12   Citrus sinensis [apfelsine]
ref|XP_006443920.1|  hypothetical protein CICLE_v10022032mg           71.2    3e-12   
gb|KDO48907.1|  hypothetical protein CISIN_1g026005mg                 71.2    3e-12   Citrus sinensis [apfelsine]
dbj|BAJ34138.1|  unnamed protein product                              71.2    4e-12   Eutrema halophilum
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                 71.2    4e-12   Citrus sinensis [apfelsine]
gb|KDO48904.1|  hypothetical protein CISIN_1g026005mg                 70.9    5e-12   Citrus sinensis [apfelsine]
ref|XP_008455992.1|  PREDICTED: auxin-responsive protein IAA16 is...  70.9    5e-12   Cucumis melo [Oriental melon]
ref|XP_010679165.1|  PREDICTED: auxin-responsive protein IAA14-like   71.2    5e-12   
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...  70.5    6e-12   Cucumis melo [Oriental melon]
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like   70.5    7e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010550916.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  70.1    8e-12   Tarenaya hassleriana [spider flower]
gb|ABD98055.1|  auxin-regulated protein                               70.1    1e-11   Striga asiatica [witchweed]
ref|XP_006575865.1|  PREDICTED: auxin-induced protein AUX28-like      69.3    1e-11   
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like   69.7    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK31703.1|  hypothetical protein AALP_AA6G148100                  68.6    3e-11   Arabis alpina [alpine rockcress]
gb|ACU18407.1|  unknown                                               68.6    3e-11   Glycine max [soybeans]
gb|KHN18836.1|  Auxin-induced protein AUX28                           68.6    3e-11   Glycine soja [wild soybean]
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like   68.6    3e-11   Phoenix dactylifera
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like   68.2    3e-11   Sesamum indicum [beniseed]
ref|XP_006418150.1|  hypothetical protein EUTSA_v10008679mg           68.2    4e-11   Eutrema salsugineum [saltwater cress]
gb|KJB42200.1|  hypothetical protein B456_007G141900                  67.8    5e-11   Gossypium raimondii
gb|KHG04941.1|  Auxin-induced AUX28                                   67.8    5e-11   Gossypium arboreum [tree cotton]
ref|XP_009398379.1|  PREDICTED: auxin-responsive protein IAA30-like   67.8    6e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275031.1|  auxin-responsive protein IAA14-like              66.6    1e-10   Solanum tuberosum [potatoes]
ref|NP_001239753.1|  uncharacterized protein LOC100781847             66.6    1e-10   Glycine max [soybeans]
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16        66.6    1e-10   Fragaria vesca subsp. vesca
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like   66.6    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001237212.1|  uncharacterized protein LOC100499872             65.9    2e-10   
ref|NP_001266039.1|  IAA7 protein                                     65.9    2e-10   Solanum lycopersicum
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...  65.9    2e-10   
ref|XP_010522504.1|  PREDICTED: auxin-responsive protein IAA17-like   65.9    3e-10   Tarenaya hassleriana [spider flower]
ref|NP_001241599.1|  uncharacterized protein LOC100803065             65.5    4e-10   Glycine max [soybeans]
gb|AFK36086.1|  unknown                                               65.5    4e-10   Lotus japonicus
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like      65.1    5e-10   Cicer arietinum [garbanzo]
dbj|BAI94494.1|  Aux/IAA protein                                      64.7    6e-10   Dianthus caryophyllus [carnation]
gb|AFK36684.1|  unknown                                               64.3    7e-10   Lotus japonicus
ref|XP_010556884.1|  PREDICTED: auxin-responsive protein IAA17        64.7    7e-10   Tarenaya hassleriana [spider flower]
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like      64.3    9e-10   Fragaria vesca subsp. vesca
gb|KHN22078.1|  Auxin-responsive protein IAA16                        64.3    1e-09   Glycine soja [wild soybean]
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like   63.5    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g           63.5    2e-09   Phaseolus vulgaris [French bean]
ref|XP_011081682.1|  PREDICTED: auxin-responsive protein IAA14        62.8    2e-09   Sesamum indicum [beniseed]
ref|XP_002299625.1|  auxin-induced protein IAA4                       62.8    2e-09   Populus trichocarpa [western balsam poplar]
gb|ACL81167.1|  auxin-responsive protein IAA1                         63.5    3e-09   Mirabilis jalapa
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg              62.8    3e-09   Erythranthe guttata [common monkey flower]
gb|AFZ78621.1|  hypothetical protein                                  62.4    4e-09   Populus tomentosa [Chinese white poplar]
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative          61.6    5e-09   
gb|ACJ83896.1|  unknown                                               62.4    5e-09   Medicago truncatula
ref|XP_007024033.1|  AUX/IAA transcriptional regulator family pro...  61.6    6e-09   Theobroma cacao [chocolate]
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...  61.2    1e-08   Cucumis melo [Oriental melon]
ref|XP_008462707.1|  PREDICTED: auxin-induced protein AUX28-like ...  60.8    1e-08   Cucumis melo [Oriental melon]
sp|Q75GK0.1|IAA11_ORYSJ  RecName: Full=Auxin-responsive protein I...  61.2    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like   60.8    1e-08   Cucumis sativus [cucumbers]
ref|NP_001050713.2|  Os03g0633500                                     61.2    1e-08   
ref|XP_011045352.1|  PREDICTED: auxin-responsive protein IAA1         60.8    1e-08   Populus euphratica
gb|AGV54230.1|  auxin-induced protein AUX28                           61.2    1e-08   Phaseolus vulgaris [French bean]
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g           61.2    1e-08   Phaseolus vulgaris [French bean]
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like      61.2    2e-08   Glycine max [soybeans]
gb|AAC49055.1|  IAA14                                                 59.7    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003562220.2|  PREDICTED: auxin-responsive protein IAA30-like   60.5    2e-08   Brachypodium distachyon [annual false brome]
ref|XP_010249884.1|  PREDICTED: auxin-responsive protein IAA1         60.1    2e-08   Nelumbo nucifera [Indian lotus]
gb|AGV54609.1|  auxin-induced protein                                 60.8    2e-08   Phaseolus vulgaris [French bean]
ref|NP_001236693.1|  auxin-induced protein AUX28                      60.5    3e-08   
ref|XP_010254225.1|  PREDICTED: auxin-responsive protein IAA1-like    59.7    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like   60.8    3e-08   Eucalyptus grandis [rose gum]
gb|ACU21378.1|  unknown                                               60.5    3e-08   Glycine max [soybeans]
ref|XP_004172702.1|  PREDICTED: auxin-induced protein AUX28-like      59.7    3e-08   
gb|KHN02537.1|  Auxin-induced protein AUX28                           60.5    3e-08   
ref|NP_001267662.1|  auxin-induced protein AUX28-like                 59.7    4e-08   
gb|AFK43673.1|  unknown                                               60.1    5e-08   
ref|XP_008809254.1|  PREDICTED: auxin-responsive protein IAA1-like    58.9    5e-08   
gb|AFK44192.1|  unknown                                               59.3    7e-08   
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like   58.9    9e-08   
gb|EYU24679.1|  hypothetical protein MIMGU_mgv1a023210mg              57.4    9e-08   
ref|XP_010925112.1|  PREDICTED: auxin-responsive protein IAA1-like    58.5    9e-08   
ref|XP_008451270.1|  PREDICTED: auxin-induced protein AUX28-like      58.5    1e-07   
dbj|BAK01326.1|  predicted protein                                    58.5    1e-07   
dbj|BAJ84870.1|  predicted protein                                    58.5    2e-07   
gb|AAC36584.1|  putative IAA-related protein                          57.0    2e-07   
ref|XP_011072281.1|  PREDICTED: auxin-responsive protein IAA1-like    57.4    2e-07   
dbj|BAJ97201.1|  predicted protein                                    57.8    2e-07   
ref|XP_002517529.1|  Auxin-responsive protein IAA1, putative          57.0    3e-07   
gb|EMT20161.1|  Auxin-responsive protein IAA30                        58.2    3e-07   
dbj|BAK05607.1|  predicted protein                                    57.0    4e-07   
ref|XP_006427106.1|  hypothetical protein CICLE_v10026522mg           56.6    4e-07   
ref|NP_001266055.1|  IAA10 protein                                    56.6    4e-07   
emb|CAE00638.1|  IAA1 protein                                         57.0    4e-07   
gb|ABY65168.1|  At1g04250-like protein                                55.1    4e-07   
gb|KJB56687.1|  hypothetical protein B456_009G132200                  55.8    4e-07   
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like      57.0    5e-07   
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like      57.0    6e-07   
gb|KJB56686.1|  hypothetical protein B456_009G132200                  55.8    7e-07   
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like      56.6    8e-07   
emb|CAD30274.1|  IAA16 protein                                        55.8    8e-07   
gb|EAZ27868.1|  hypothetical protein OsJ_11821                        56.2    9e-07   
gb|ABY65124.1|  At1g04250                                             53.9    9e-07   
ref|XP_004981819.1|  PREDICTED: auxin-responsive protein IAA13-li...  55.8    1e-06   
ref|XP_004981820.1|  PREDICTED: auxin-responsive protein IAA13-li...  55.8    1e-06   
gb|KEH43016.1|  auxin-responsive AUX/IAA family protein               55.8    1e-06   
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein               55.8    1e-06   
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like      55.8    1e-06   
emb|CBI35213.3|  unnamed protein product                              54.3    1e-06   
gb|AAM96891.1|  auxin-responsive protein IAA1                         54.7    2e-06   
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like   55.5    2e-06   
ref|NP_001290520.1|  auxin-responsive protein IAA1                    54.7    2e-06   
gb|KDO58189.1|  hypothetical protein CISIN_1g044582mg                 54.3    2e-06   
emb|CDP06818.1|  unnamed protein product                              54.7    3e-06   
gb|AFK42876.1|  unknown                                               54.3    5e-06   
gb|ACF87179.1|  unknown                                               54.3    5e-06   
gb|ACJ84642.1|  unknown                                               54.3    5e-06   
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like      54.3    5e-06   
gb|KDP37176.1|  hypothetical protein JCGZ_06232                       53.9    5e-06   
gb|ACU19136.1|  unknown                                               53.9    5e-06   
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like   53.9    5e-06   
emb|CBI28126.3|  unnamed protein product                              53.5    5e-06   
ref|XP_006465436.1|  PREDICTED: auxin-responsive protein IAA17-like   53.1    6e-06   
ref|XP_009385622.1|  PREDICTED: auxin-responsive protein IAA1         53.5    6e-06   
ref|XP_006664171.1|  PREDICTED: auxin-responsive protein IAA30-like   53.9    6e-06   
ref|NP_001266034.1|  IAA6 protein                                     54.3    6e-06   
ref|XP_006650321.1|  PREDICTED: auxin-responsive protein IAA11-like   53.5    7e-06   
ref|XP_002284861.1|  PREDICTED: auxin-responsive protein IAA1-like    53.5    7e-06   
gb|KHN31465.1|  Auxin-responsive protein IAA16                        53.5    8e-06   
ref|XP_009774251.1|  PREDICTED: auxin-responsive protein IAA16-like   52.8    1e-05   
ref|XP_006366663.1|  PREDICTED: auxin-responsive protein IAA16-like   52.8    1e-05   
gb|EMS64858.1|  Auxin-responsive protein IAA30                        53.5    1e-05   
gb|EPS59988.1|  auxin-regulated protein                               53.5    1e-05   
ref|XP_007013279.1|  Indoleacetic acid-induced protein 16, putative   52.8    1e-05   
ref|XP_004146959.1|  PREDICTED: auxin-induced protein 22D-like        52.0    2e-05   
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like   52.8    2e-05   
ref|NP_001266077.1|  IAA15                                            52.4    2e-05   
emb|CBW30571.1|  auxin-responsive protein iaa27                       52.0    3e-05   
gb|AEA86335.1|  auxin-responsive protein IAA                          50.1    3e-05   
ref|XP_009611025.1|  PREDICTED: auxin-responsive protein IAA17-like   51.2    4e-05   
ref|NP_001067209.1|  Os12g0601300                                     51.2    6e-05   
ref|XP_009782640.1|  PREDICTED: auxin-responsive protein IAA17-like   50.4    6e-05   
ref|XP_010936161.1|  PREDICTED: auxin-induced protein 22D             50.4    7e-05   
ref|XP_002531289.1|  Auxin-induced protein 22D, putative              50.1    9e-05   
gb|ADL36587.1|  ARF domain class transcription factor                 49.7    9e-05   
ref|XP_010323008.1|  PREDICTED: IAA2 isoform X1                       48.9    1e-04   
gb|ABI84256.1|  aux/IAA protein                                       48.5    1e-04   
tpg|DAA55064.1|  TPA: hypothetical protein ZEAMMB73_489535            50.1    1e-04   
ref|NP_001266042.1|  IAA2                                             48.9    1e-04   
ref|XP_009614298.1|  PREDICTED: auxin-responsive protein IAA27-like   50.1    1e-04   
ref|XP_008451269.1|  PREDICTED: auxin-induced protein 22D-like        49.7    1e-04   
ref|XP_006343091.1|  PREDICTED: auxin-responsive protein IAA27-like   50.1    2e-04   
ref|XP_009395806.1|  PREDICTED: auxin-responsive protein IAA1-like    49.3    2e-04   
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like   50.1    2e-04   
ref|XP_009112194.1|  PREDICTED: auxin-responsive protein IAA9-lik...  49.7    2e-04   
ref|XP_006343103.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  49.7    2e-04   
ref|XP_009112193.1|  PREDICTED: auxin-responsive protein IAA9-lik...  49.7    2e-04   
gb|ABD98054.1|  auxin-regulated protein                               49.7    2e-04   
ref|XP_008811586.1|  PREDICTED: auxin-responsive protein IAA1-like    48.9    3e-04   
gb|KHN03839.1|  Auxin-induced protein 22D                             48.9    3e-04   
ref|NP_001242395.1|  uncharacterized protein LOC100799875             48.5    3e-04   
gb|ACF88333.1|  unknown                                               49.3    3e-04   
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like   49.3    3e-04   
ref|XP_009416094.1|  PREDICTED: auxin-responsive protein IAA1-lik...  48.5    3e-04   
tpg|DAA55065.1|  TPA: hypothetical protein ZEAMMB73_489535            48.9    4e-04   
emb|CDY18679.1|  BnaA09g07160D                                        48.9    4e-04   
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member   48.9    4e-04   
ref|XP_010025015.1|  PREDICTED: auxin-induced protein 22D-like        48.1    4e-04   
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like   48.9    4e-04   
gb|KHN18839.1|  Auxin-induced protein 22D                             48.1    4e-04   
ref|NP_001242729.1|  uncharacterized protein LOC100780752             48.1    4e-04   
ref|XP_009416093.1|  PREDICTED: auxin-responsive protein IAA1-lik...  48.1    5e-04   
ref|XP_003637872.1|  Auxin-responsive aux/iaa gene family member      47.8    5e-04   
ref|XP_007144687.1|  hypothetical protein PHAVU_007G176700g           47.8    5e-04   
ref|XP_009612692.1|  PREDICTED: auxin-responsive protein IAA4-like    47.8    5e-04   
ref|XP_009765454.1|  PREDICTED: auxin-responsive protein IAA4-like    47.8    6e-04   
ref|XP_009364491.1|  PREDICTED: auxin-responsive protein IAA4-like    47.8    6e-04   
ref|XP_002438435.1|  hypothetical protein SORBIDRAFT_10g019590        48.1    7e-04   
ref|XP_003637871.1|  Auxin-responsive aux/iaa gene family member      47.8    7e-04   
gb|ADC29391.2|  indole-3-acetic acid inducible 8                      47.8    8e-04   
ref|XP_011079948.1|  PREDICTED: auxin-induced protein 22D-like        47.4    8e-04   
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like      47.8    8e-04   
emb|CDO99147.1|  unnamed protein product                              47.4    8e-04   
gb|ACU19616.1|  unknown                                               47.8    9e-04   
ref|XP_010110305.1|  Auxin-responsive protein IAA17                   47.4    9e-04   
ref|XP_003554705.1|  PREDICTED: auxin-responsive protein IAA16-li...  47.8    0.001   
gb|KEH27147.1|  auxin response factor                                 47.8    0.001   
gb|AFK45766.1|  unknown                                               47.8    0.001   
ref|XP_006833393.1|  hypothetical protein AMTR_s00109p00120700        48.1    0.001   
gb|ADC29393.2|  indole-3-acetic acid inducible 8                      47.8    0.001   
gb|ADL70561.1|  indole-3-acetic acid inducible 8                      47.8    0.001   
gb|ADL70565.1|  indole-3-acetic acid inducible 8                      47.8    0.001   
gb|ADL70568.1|  indole-3-acetic acid inducible 8                      47.4    0.001   
gb|ADL70566.1|  indole-3-acetic acid inducible 8                      47.8    0.001   
ref|XP_007201398.1|  hypothetical protein PRUPE_ppa010342mg           47.0    0.001   
gb|ADL70564.1|  indole-3-acetic acid inducible 8                      47.8    0.001   
gb|ADL70563.1|  indole-3-acetic acid inducible 8                      47.8    0.001   



>emb|CDO99148.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 4/104 (4%)
 Frame = +2

Query  179  EHGGLNLKATElclglpgggggN--ESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  352
            EHGGLNLKATELCLGLPGGGG    ++ESLK+TGKRGFSETVDLKLNLQ   +  +DLKE
Sbjct  8    EHGGLNLKATELCLGLPGGGGCAGADTESLKITGKRGFSETVDLKLNLQPN-EPVVDLKE  66

Query  353  KMKSPSKEPNKDPIKPPS-KAQVVGWPPVRNYRKNIMAXKGSPE  481
            KMK+P+KE  KDP+KPP+ KAQVVGWPPVR++RKNIMA K + E
Sbjct  67   KMKAPAKEATKDPVKPPAAKAQVVGWPPVRSFRKNIMAQKSNTE  110



>ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera]
Length=243

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 90/118 (76%), Gaps = 7/118 (6%)
 Frame = +2

Query  143  MEVGRKIGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  322
            MEVGRK+ SML    G + K TELCLGLPGGGG  E+E+LK +GKRGFSETVDLKLNLQS
Sbjct  1    MEVGRKMSSMLGAERGFDFKETELCLGLPGGGG-GEAETLKASGKRGFSETVDLKLNLQS  59

Query  323  AADSSLDLKEKMKSPSKEPN-----KDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
              +S +DL E +K P KE N     KDP KPP+KAQVVGWPPVR++RKNIMA K S E
Sbjct  60   K-ESVVDLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRSFRKNIMAQKNSSE  116



>ref|XP_011091113.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=241

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 89/113 (79%), Gaps = 7/113 (6%)
 Frame = +2

Query  143  MEVGRKIGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  322
            MEVGRK+G +LAE  GLNLK TELCLGLPGGGGG +    K+TGKRGFSETVDLKLNLQ 
Sbjct  1    MEVGRKMGGLLAEEQGLNLKETELCLGLPGGGGGAD----KITGKRGFSETVDLKLNLQP  56

Query  323  AADSSLDLKEK--MKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGS  475
               ++LDLKE   M  P   P KDP+KPP+KAQVVGWPPVR++RKNIMA + S
Sbjct  57   NESAALDLKETSAMDKPVLPP-KDPVKPPAKAQVVGWPPVRSFRKNIMAHQKS  108



>gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus]
Length=242

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 86/107 (80%), Gaps = 6/107 (6%)
 Frame = +2

Query  179  EHGGLNLKATElclglpgggggNESE----SLKVTGKRGFSETVDLKLNLQSAADSSLDL  346
            E  GLNLK TELCLGLPGGGGG   E    S+++TGKRGFSETVDLKLNLQS   SS+DL
Sbjct  2    EVHGLNLKETELCLGLPGGGGGGTGEITDQSMRITGKRGFSETVDLKLNLQSNDQSSVDL  61

Query  347  KEKMKSP-SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             EK+K+P SKE N KDP+KPP+KAQVVGWPPVR +RKNIMA K + E
Sbjct  62   NEKVKNPPSKETNSKDPVKPPAKAQVVGWPPVRAFRKNIMAQKNNTE  108



>ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=251

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 92/121 (76%), Gaps = 10/121 (8%)
 Frame = +2

Query  143  MEVGRKIGSMLAEH--GGLNLKATElclglpgggggNESES---LKVTGKRGFSETVDLK  307
            MEVGR +  MLAE    GLNLK TELCLGLPGGGGG ES +   +K+TGKRGFSETVDLK
Sbjct  1    MEVGRNMAGMLAEEHDDGLNLKETELCLGLPGGGGGGESTATDPIKITGKRGFSETVDLK  60

Query  308  LNL-QSAADSSLDLKEKMKSPSKE----PNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKG  472
            L L QS   ++LDLKE +K+ S E    P KDPIKPP+KAQVVGWPPVR++RKN M+ + 
Sbjct  61   LKLHQSNEPAALDLKENIKNSSHENPMLPPKDPIKPPAKAQVVGWPPVRSFRKNAMSHQK  120

Query  473  S  475
            S
Sbjct  121  S  121



>emb|CBI26357.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 84/112 (75%), Gaps = 7/112 (6%)
 Frame = +2

Query  161  IGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  340
            + SML    G + K TELCLGLPGGGG  E+E+LK +GKRGFSETVDLKLNLQS  +S +
Sbjct  1    MSSMLGAERGFDFKETELCLGLPGGGG-GEAETLKASGKRGFSETVDLKLNLQSK-ESVV  58

Query  341  DLKEKMKSPSKEPN-----KDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
            DL E +K P KE N     KDP KPP+KAQVVGWPPVR++RKNIMA K S E
Sbjct  59   DLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRSFRKNIMAQKNSSE  110



>ref|XP_007034956.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
 gb|EOY05882.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
Length=254

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 83/119 (70%), Gaps = 13/119 (11%)
 Frame = +2

Query  143  MEVGRKIGSMLAEHGGLNLKATElc------lglpgggggNESESLKVTGKRGFSETVDL  304
            MEV RK+ +ML     LN K TELC       G  GGGGGNE E+ K TGKRGFSETVDL
Sbjct  1    MEVSRKMANMLGAERDLNFKETELCLGLPGGGGGGGGGGGNEVETPKTTGKRGFSETVDL  60

Query  305  KLNLQSAADSSLDLKEKMKSPSKE------PNKDPIKPPSKAQVVGWPPVRNYRKNIMA  463
            KLNLQS  ++ +DL + +++ SKE        KDP KPP+KAQVVGWPPVR+YRKNIMA
Sbjct  61   KLNLQSK-ETGMDLNKNIENGSKEKTLLPACTKDPAKPPAKAQVVGWPPVRSYRKNIMA  118



>gb|KJB38278.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=294

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 84/119 (71%), Gaps = 12/119 (10%)
 Frame = +2

Query  140  SMEVGRKIGSMLAEHGGLNLKATElclg----lpgggggNESESL---KVTGKRGFSETV  298
            SMEVGRK+ +ML     LN K TELCLG    +     GNE+ES    K  GKRGFSETV
Sbjct  45   SMEVGRKMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETV  104

Query  299  DLKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMA  463
            DLKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQVVGWPPVR+YRKNIMA
Sbjct  105  DLKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMA  162



>ref|XP_009611797.1| PREDICTED: auxin-responsive protein IAA14 [Nicotiana tomentosiformis]
Length=243

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 79/117 (68%), Gaps = 14/117 (12%)
 Frame = +2

Query  143  MEVGRKIGSMLAEHGGLNLKATElclg----lpgggggNESESLKVTGKRGFSETVDLKL  310
            MEV RK+         LNLK TELCLG           +++    +  KRGFSETVDLKL
Sbjct  1    MEVSRKMD--------LNLKETELCLGLPGGEVRAAIADQNNIDSINKKRGFSETVDLKL  52

Query  311  NLQSAADSSLDLK-EKMKSPSKEP-NKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGS  475
            NLQS   S LDLK +KMK+PSKE  NKD  KPP+KAQVVGWPPVR++RKNIMA KGS
Sbjct  53   NLQSNDSSGLDLKKDKMKNPSKETCNKDSAKPPAKAQVVGWPPVRSFRKNIMAQKGS  109



>gb|KJB38279.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=217

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 84/120 (70%), Gaps = 12/120 (10%)
 Frame = +2

Query  143  MEVGRKIGSMLAEHGGLNLKATElclg----lpgggggNESESL---KVTGKRGFSETVD  301
            MEVGRK+ +ML     LN K TELCLG    +     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  302  LKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            LKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQVVGWPPVR+YRKNIMA +
Sbjct  61   LKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMANQ  119



>gb|AEE25653.1| auxin-responsive protein [Gossypium hirsutum]
Length=249

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 84/120 (70%), Gaps = 12/120 (10%)
 Frame = +2

Query  143  MEVGRKIGSMLAEHGGLNLKATElclg----lpgggggNESESL---KVTGKRGFSETVD  301
            MEVGRK+ +ML     LN K TELCLG    +     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTEHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  302  LKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            LKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQVVGWPPVR+YRKNIMA +
Sbjct  61   LKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMANQ  119



>gb|KJB38280.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=249

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 84/120 (70%), Gaps = 12/120 (10%)
 Frame = +2

Query  143  MEVGRKIGSMLAEHGGLNLKATElclg----lpgggggNESESL---KVTGKRGFSETVD  301
            MEVGRK+ +ML     LN K TELCLG    +     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  302  LKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            LKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQVVGWPPVR+YRKNIMA +
Sbjct  61   LKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMANQ  119



>gb|KHF98789.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=249

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 84/120 (70%), Gaps = 12/120 (10%)
 Frame = +2

Query  143  MEVGRKIGSMLAEHGGLNLKATElclg----lpgggggNESESL---KVTGKRGFSETVD  301
            MEVGRK+ +ML     LN K TELCLG    +     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTEHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  302  LKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            LKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQ+VGWPPVR+YRKNIMA +
Sbjct  61   LKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQMVGWPPVRSYRKNIMANQ  119



>ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume]
Length=248

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 83/118 (70%), Gaps = 11/118 (9%)
 Frame = +2

Query  149  VGRKIGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAA  328
            V RK+ +ML     LNLK TELCLGLPGGG   E E+ + TGKRGFSET+DLKLNLQS  
Sbjct  6    VSRKMPNMLGVERDLNLKETELCLGLPGGGTVPEPETPRATGKRGFSETIDLKLNLQSKE  65

Query  329  DSSLDLKEKMKS-PSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
            D    L +K+K+  SKE N      K P KPP+KAQVVGWPPVR+YRKNIMA K S E
Sbjct  66   D----LNDKVKNNASKEKNNLLTCTKYPAKPPAKAQVVGWPPVRSYRKNIMAQKSSSE  119



>ref|XP_009777122.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=223

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 63/77 (82%), Gaps = 4/77 (5%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQS-AADSSLDLKEKMKSPSKE---PNKDPIKPPSKAQVVGWP  430
            K+ GKRGFSETVDLKLN Q+  + S++DLKEK+K+P+ +    NKD +KPP+KAQVVGWP
Sbjct  20   KIKGKRGFSETVDLKLNFQTNDSSSAMDLKEKIKTPTTKEIASNKDSVKPPAKAQVVGWP  79

Query  431  PVRNYRKNIMAXKGSPE  481
            PVR++RKN+MA K + E
Sbjct  80   PVRSFRKNVMAQKNNTE  96



>gb|KDP40274.1| hypothetical protein JCGZ_02272 [Jatropha curcas]
Length=241

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 75/102 (74%), Gaps = 9/102 (9%)
 Frame = +2

Query  179  EHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKM  358
            E   LN K TELCLGLPGGG   E E+ K TGKRGF+ETVDLKLNLQ A D  +DL E +
Sbjct  9    ERADLNFKETELCLGLPGGGK-TEVETPKATGKRGFAETVDLKLNLQ-AKDGVMDLNENI  66

Query  359  KSPSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMA  463
            K+ SK+ N       KDP KPP+KAQVVGWPPVR+YRKNIMA
Sbjct  67   KNASKDKNHLPTSTIKDPAKPPAKAQVVGWPPVRSYRKNIMA  108



>ref|XP_009591035.1| PREDICTED: auxin-responsive protein IAA7-like [Nicotiana tomentosiformis]
Length=225

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 63/78 (81%), Gaps = 5/78 (6%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQS-AADSSLDLKEKMKSPSKE----PNKDPIKPPSKAQVVGW  427
            K+ GKRGFSETVDLKLN Q+  + S++DLKEK+K+P+ +     NKD +KPP+KAQVVGW
Sbjct  20   KIKGKRGFSETVDLKLNFQTNDSSSAMDLKEKIKTPTTKEIANCNKDSVKPPAKAQVVGW  79

Query  428  PPVRNYRKNIMAXKGSPE  481
            PPVR++RKN+MA K + E
Sbjct  80   PPVRSFRKNVMAQKNNTE  97



>ref|XP_009776553.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=244

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 57/70 (81%), Gaps = 4/70 (6%)
 Frame = +2

Query  266  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEP-NKDPIKPPSKAQVVGWPPVRN  442
            +T KRGFSETVDLKLNLQS  D S   KEK+K+PSKE  NKD  KPP+K QVVGWPPVR+
Sbjct  42   ITKKRGFSETVDLKLNLQSNLDLS---KEKIKNPSKETCNKDSAKPPAKTQVVGWPPVRS  98

Query  443  YRKNIMAXKG  472
            YRKNIMA KG
Sbjct  99   YRKNIMAQKG  108



>ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
Length=239

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 78/111 (70%), Gaps = 9/111 (8%)
 Frame = +2

Query  167  SMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDL  346
            +ML     LNLK TELCLGLPGGG   E E+ + TGKRGFSET+DLKLNLQS  D + ++
Sbjct  3    NMLGVERDLNLKETELCLGLPGGGTVPEPETPRATGKRGFSETIDLKLNLQSKEDLNDNV  62

Query  347  KEKMKSPSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
            K      SKE N      KDP KPP+KAQVVGWPPVR+YRKNIMA K S E
Sbjct  63   K---NIASKEKNNLLTCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKSSSE  110



>ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max]
 gb|ACR39367.1| Aux/IAA protein [Glycine max]
Length=239

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 73/105 (70%), Gaps = 6/105 (6%)
 Frame = +2

Query  161  IGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  340
            + +ML    GL+L   E  L L   GGG+E E+ + TGKRGFSETVDLKLNLQ+  D   
Sbjct  1    MTTMLTNEHGLSLNLKETELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLQTKED---  57

Query  341  DLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
             L E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA +
Sbjct  58   -LNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQ  101



>ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-like [Eucalyptus grandis]
 gb|KCW60450.1| hypothetical protein EUGRSUZ_H03170 [Eucalyptus grandis]
Length=243

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 78/105 (74%), Gaps = 8/105 (8%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTGKRGFSET-VDLKLNLQSA-ADSSLDLKEKMKS  364
            LN K TELCLGLPGGGGG E E+ + TGKRGFSET VDLKLNLQ+  A S +DLKE MKS
Sbjct  10   LNFKETELCLGLPGGGGGAEVEAPRATGKRGFSETEVDLKLNLQAKDASSVVDLKEAMKS  69

Query  365  PSK------EPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
              K       P KDP KPP+KAQVVGWPPVR+YRKN+M  + S +
Sbjct  70   NEKTLLAGASPAKDPAKPPAKAQVVGWPPVRSYRKNMMVAQKSTD  114



>ref|XP_007034957.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOY05883.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=204

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 61/79 (77%), Gaps = 7/79 (9%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKE------PNKDPIKPPS  406
            NE E+ K TGKRGFSETVDLKLNLQS  ++ +DL + +++ SKE        KDP KPP+
Sbjct  4    NEVETPKTTGKRGFSETVDLKLNLQSK-ETGMDLNKNIENGSKEKTLLPACTKDPAKPPA  62

Query  407  KAQVVGWPPVRNYRKNIMA  463
            KAQVVGWPPVR+YRKNIMA
Sbjct  63   KAQVVGWPPVRSYRKNIMA  81



>ref|XP_011030585.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 76/110 (69%), Gaps = 10/110 (9%)
 Frame = +2

Query  179  EHGGLNLKATElclgl-pgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK  355
            E   LN K TELCLGL    G  NE E+ K TGKRGF+ETVDLKLNLQ A +  +DL E 
Sbjct  10   ERADLNYKETELCLGLPGAVGVKNEVETHKATGKRGFAETVDLKLNLQ-AKEGVMDLNEN  68

Query  356  MKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
            +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN++A K + E
Sbjct  69   IKNIASKDKNQLPAATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASE  118



>ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer 
arietinum]
Length=240

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 74/106 (70%), Gaps = 6/106 (6%)
 Frame = +2

Query  161  IGSMLAEHGGLNLKATE-lclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSS  337
            + +++ +  GLNLK TE       GGG G+E E+ +  GKRGFSETVDLKLNLQS  +  
Sbjct  1    MATLIGKESGLNLKETELCLGLPGGGGSGSEVETQRAAGKRGFSETVDLKLNLQSNKE--  58

Query  338  LDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
             DL +  K+ SK+    KDP KPP+KAQVVGWPPVR+YRKN+MA K
Sbjct  59   -DLNDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQK  103



>gb|KHN30563.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=233

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 71/102 (70%), Gaps = 6/102 (6%)
 Frame = +2

Query  170  MLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLK  349
            ML    GL+L   E  L L   GGG+E E+ + TGKRGFSETVDLKLNLQ+  D    L 
Sbjct  1    MLTNEHGLSLNLKETELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLQTKED----LN  56

Query  350  EKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA +
Sbjct  57   ENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQ  98



>gb|KHN05057.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=245

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 78/112 (70%), Gaps = 13/112 (12%)
 Frame = +2

Query  161  IGSMLAEHGGLNLKATElclglpggggg-------NESESLKVTGKRGFSETVDLKLNLQ  319
            + +ML +  GLNLK TELCLGLPGG          +E E+ + TGKRGFSETVDLKLNL 
Sbjct  1    MATMLTKEHGLNLKETELCLGLPGGELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLH  60

Query  320  SAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            S  D    L E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA +
Sbjct  61   SKED----LNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQ  108



>ref|XP_004495391.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Cicer 
arietinum]
Length=244

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 74/106 (70%), Gaps = 6/106 (6%)
 Frame = +2

Query  161  IGSMLAEHGGLNLKATE-lclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSS  337
            + +++ +  GLNLK TE       GGG G+E E+ +  GKRGFSETVDLKLNLQS  +  
Sbjct  1    MATLIGKESGLNLKETELCLGLPGGGGSGSEVETQRAAGKRGFSETVDLKLNLQSNKE--  58

Query  338  LDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
             DL +  K+ SK+    KDP KPP+KAQVVGWPPVR+YRKN+MA K
Sbjct  59   -DLNDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQK  103



>ref|XP_011030586.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 76/110 (69%), Gaps = 10/110 (9%)
 Frame = +2

Query  179  EHGGLNLKATElclgl-pgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK  355
            E   LN K TELCLGL    G  NE E+ K TGKRGF+ETVDLKLNLQ A +  +DL E 
Sbjct  10   ERADLNYKETELCLGLPGAVGVKNEVETHKATGKRGFAETVDLKLNLQ-AKEGVMDLNEN  68

Query  356  MKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
            +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN++A K + E
Sbjct  69   IKNIASKDKNQLPAATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASE  118



>ref|XP_003556389.2| PREDICTED: auxin-responsive protein IAA14-like [Glycine max]
Length=331

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 78/115 (68%), Gaps = 15/115 (13%)
 Frame = +2

Query  158  KIGSMLAEHGGLNLKATElc---------lglpgggggNESESLKVTGKRGFSETVDLKL  310
            ++ +ML +  GLNLK TELC          G  GGGGG E E+ + TGKRGFSETVDLKL
Sbjct  84   EMATMLTKEHGLNLKETELCLGLPGGGGGGGGGGGGGGGEVETPRATGKRGFSETVDLKL  143

Query  311  NLQSAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            NL S  D    L E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA +
Sbjct  144  NLHSKED----LNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQ  194



>ref|NP_001280875.1| auxin-responsive protein IAA14-like [Malus domestica]
 gb|ADL36585.1| ARF domain class transcription factor [Malus domestica]
Length=244

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 74/110 (67%), Gaps = 5/110 (5%)
 Frame = +2

Query  167  SMLAEHGGLNLKATElclgl--pgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  340
            SML     LNL+ TELCLGL   G     E E+ K TGKRGFSET+DLKLNLQS  D + 
Sbjct  3    SMLGVERDLNLRETELCLGLPGGGTTTVAEPETAKTTGKRGFSETIDLKLNLQSKEDLND  62

Query  341  DLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
            ++K    K K+      KDP KPP+KAQVVGWPPVR+YRKNIMA K + E
Sbjct  63   NVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSYRKNIMAQKNTSE  112



>gb|AFK42031.1| unknown [Medicago truncatula]
Length=214

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 71/99 (72%), Gaps = 9/99 (9%)
 Frame = +2

Query  188  GLNLKATElc-----lglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  352
            GLNLK TELC      G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  353  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MA K
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQK  101



>gb|KHG01271.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=248

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = +2

Query  245  NESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVV  421
            NE ES  K TGKRG+SETVDLKLNLQS  +  +DL + +++ SKE N  P KPP+KAQV+
Sbjct  38   NEVESSPKTTGKRGYSETVDLKLNLQSK-EGCMDLNQNLENGSKEKNHHPAKPPAKAQVL  96

Query  422  GWPPVRNYRKNIMAXK  469
            GWPPVR+YRKNIMA +
Sbjct  97   GWPPVRSYRKNIMANQ  112



>ref|XP_009337294.1| PREDICTED: auxin-responsive protein IAA14-like [Pyrus x bretschneideri]
Length=244

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 74/110 (67%), Gaps = 5/110 (5%)
 Frame = +2

Query  167  SMLAEHGGLNLKATElclgl--pgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  340
            SML     LNL+ TELCLGL   G     E E+ K TGKRGFSETVDLKLNLQS  D + 
Sbjct  3    SMLGVERDLNLRETELCLGLPGGGTTTVAEPETAKTTGKRGFSETVDLKLNLQSKEDLND  62

Query  341  DLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
            ++K    K K+      KDP KPP+KAQVVGWPPVR+YRKNIM+ K + E
Sbjct  63   NVKNIASKDKNNLLSCTKDPSKPPAKAQVVGWPPVRSYRKNIMSQKNTSE  112



>gb|KEH42779.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=204

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 71/99 (72%), Gaps = 9/99 (9%)
 Frame = +2

Query  188  GLNLKATElc-----lglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  352
            GLNLK TELC      G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  353  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MA K
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQK  101



>gb|KEH42778.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=239

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 71/99 (72%), Gaps = 9/99 (9%)
 Frame = +2

Query  188  GLNLKATElc-----lglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  352
            GLNLK TELC      G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  353  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MA K
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQK  101



>gb|KJB28413.1| hypothetical protein B456_005G046500 [Gossypium raimondii]
Length=248

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = +2

Query  245  NESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVV  421
            NE ES  K TGKRG+SETVDLKLNLQS  +  +DL + +++ SKE N  P KPP+KAQV+
Sbjct  38   NEVESSPKTTGKRGYSETVDLKLNLQSK-EGCMDLNQNLENGSKEKNHLPAKPPAKAQVL  96

Query  422  GWPPVRNYRKNIMAXK  469
            GWPPVR+YRKNIMA +
Sbjct  97   GWPPVRSYRKNIMANQ  112



>ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AES62057.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=236

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 71/99 (72%), Gaps = 9/99 (9%)
 Frame = +2

Query  188  GLNLKATElc-----lglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  352
            GLNLK TELC      G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  353  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MA K
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQK  101



>ref|XP_011027555.1| PREDICTED: auxin-responsive protein IAA14 isoform X2 [Populus 
euphratica]
 ref|XP_011029891.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 77/112 (69%), Gaps = 11/112 (10%)
 Frame = +2

Query  176  AEHGGLNLKATElclgl-pgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLK  349
            AE   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL 
Sbjct  8    AERTDLNYKETELCLGLPGAVGAKNEVETPSKATGKRGFAETVDLKLNLQ-AKEGVMDLN  66

Query  350  EKMKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
            E +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN+MA K + E
Sbjct  67   ENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASE  118



>ref|XP_011027545.1| PREDICTED: auxin-responsive protein IAA14 isoform X1 [Populus 
euphratica]
 ref|XP_011029890.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 77/112 (69%), Gaps = 11/112 (10%)
 Frame = +2

Query  176  AEHGGLNLKATElclgl-pgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLK  349
            AE   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL 
Sbjct  8    AERTDLNYKETELCLGLPGAVGAKNEVETPSKATGKRGFAETVDLKLNLQ-AKEGVMDLN  66

Query  350  EKMKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
            E +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN+MA K + E
Sbjct  67   ENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASE  118



>ref|XP_008341049.1| PREDICTED: auxin-responsive protein IAA7-like [Malus domestica]
Length=173

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 75/109 (69%), Gaps = 4/109 (4%)
 Frame = +2

Query  167  SMLAEHGGLNLKATElclglpgggggNESE-SLKVTGKRGFSETVDLKLNLQSAADSSLD  343
            SML     LNL+ TELCLGLPGGG    +E   K TGKRGFSETVDLKL LQS  D + +
Sbjct  3    SMLGVECDLNLRETELCLGLPGGGTSTVAEPETKATGKRGFSETVDLKLKLQSKDDLNDN  62

Query  344  LK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
            +K    + K+      KDP KPP+KAQVVGWPPVR+YRKNIMA K + E
Sbjct  63   VKNIASREKNDLLSCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKNTSE  111



>dbj|BAH15071.1| indole-3-acetic acid 14 transcription factor like [Malus prunifolia]
Length=243

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 73/110 (66%), Gaps = 5/110 (5%)
 Frame = +2

Query  167  SMLAEHGGLNLKATElclgl--pgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  340
            SML     LNL+  ELCLGL   G     E E+ K TGKRGFSET+DLKLNLQS  D + 
Sbjct  3    SMLGVERDLNLREAELCLGLPGGGTTTVAEPETAKTTGKRGFSETIDLKLNLQSKEDLND  62

Query  341  DLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
            ++K    K K+      KDP KPP+KAQVVGWPPVR+YRKN+MA K + E
Sbjct  63   NVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSYRKNVMAQKNTSE  112



>emb|CDY63910.1| BnaC01g43640D [Brassica napus]
 emb|CDY30781.1| BnaC07g16810D [Brassica napus]
Length=240

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 66/91 (73%), Gaps = 1/91 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLKATELCL LPGG    ++ +    G KRGFSETVDL LNLQS  + ++DL     S 
Sbjct  6    MNLKATELCLSLPGGAETLDTPAKSAVGNKRGFSETVDLMLNLQSNKERAIDLNNATASK  65

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIM  460
             K   KDP+KPP+KAQVVGWPPVRNYRKNIM
Sbjct  66   QKTLLKDPVKPPAKAQVVGWPPVRNYRKNIM  96



>gb|AFZ78617.1| hypothetical protein [Populus tomentosa]
Length=248

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 60/81 (74%), Gaps = 9/81 (11%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN-------KDPIKPPSKAQV  418
            K TGKRGF+ETVDLKLNLQ A D  +DL + +K+  SK+ N       KDP KPP+KAQV
Sbjct  39   KATGKRGFAETVDLKLNLQ-AKDGVMDLNDNIKNITSKDKNHLPAAAIKDPAKPPAKAQV  97

Query  419  VGWPPVRNYRKNIMAXKGSPE  481
            VGWPPVR+YRKN+MA K + E
Sbjct  98   VGWPPVRSYRKNVMAQKNASE  118



>gb|AFK37379.1| unknown [Medicago truncatula]
Length=236

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 71/99 (72%), Gaps = 9/99 (9%)
 Frame = +2

Query  188  GLNLKATElc-----lglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  352
            GLNLK TELC      G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  353  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            K  S  K   KDP KPP+KAQVVGWPPVR+Y+KN+MA K
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYKKNMMAQK  101



>gb|KFK39592.1| hypothetical protein AALP_AA3G264300 [Arabis alpina]
Length=235

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + ++DL     +P
Sbjct  6    MNLKATELCLGLPGGTEAVESPAKSAVGNKRGFSETVDLMLNLQSNKEEAVDLNNIAAAP  65

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
             +   KDP KPP+KAQVVGWPPVRNYRKN+M  +
Sbjct  66   KESLLKDPTKPPAKAQVVGWPPVRNYRKNMMTQQ  99



>ref|NP_001266070.1| IAA14 [Solanum lycopersicum]
 gb|AEX00357.1| IAA14 [Solanum lycopersicum]
Length=236

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 58/80 (73%), Gaps = 7/80 (9%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAAD--SSLDLKEKMKS---PSKE--PNKDPIKPPSKAQVV  421
            KV GKRGFSETVDLKLN   A+D  S      KMKS    +KE   NKDPIKPP+KAQVV
Sbjct  32   KVNGKRGFSETVDLKLNFHQASDDISCAMENNKMKSSVTTTKEVVCNKDPIKPPAKAQVV  91

Query  422  GWPPVRNYRKNIMAXKGSPE  481
            GWPPVR++RKN+MA K + E
Sbjct  92   GWPPVRSFRKNVMAQKSNTE  111



>ref|XP_008362015.1| PREDICTED: auxin-responsive protein IAA14-like [Malus domestica]
Length=244

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 75/109 (69%), Gaps = 4/109 (4%)
 Frame = +2

Query  167  SMLAEHGGLNLKATElclglpgggggNESE-SLKVTGKRGFSETVDLKLNLQSAADSSLD  343
            SML     LNL+ TELCLGLPGGG    +E   K TGKRGFSETVDLKL LQS  D + +
Sbjct  3    SMLGVECDLNLRETELCLGLPGGGTSTVAEPETKATGKRGFSETVDLKLKLQSKDDLNDN  62

Query  344  LK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
            +K    + K+      KDP KPP+KAQVVGWPPVR+YRKNIMA K + E
Sbjct  63   VKNIASREKNDLLSCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKNTSE  111



>gb|EYU32514.1| hypothetical protein MIMGU_mgv1a012542mg [Erythranthe guttata]
Length=247

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 79/112 (71%), Gaps = 7/112 (6%)
 Frame = +2

Query  149  VGRKIGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS--  322
            VGRK+  +     GLN   TELCLGLPGGGGG  ++ +K TGKRGFSETVDLKLNLQS  
Sbjct  4    VGRKMAGL----HGLNFMETELCLGLPGGGGGESTDPIKTTGKRGFSETVDLKLNLQSNE  59

Query  323  -AADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGS  475
              + S L      +  +  P KDPIKPP+KAQVVGWPPVR++RKNI++ + S
Sbjct  60   PPSSSDLINISSTEINAMLPPKDPIKPPAKAQVVGWPPVRSFRKNIISHQKS  111



>ref|XP_002311658.1| aux/IAA family protein [Populus trichocarpa]
 gb|ABK95711.1| unknown [Populus trichocarpa]
 gb|EEE89025.1| aux/IAA family protein [Populus trichocarpa]
Length=248

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 60/81 (74%), Gaps = 9/81 (11%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN-------KDPIKPPSKAQV  418
            K TGKRGF+ETVDLKLNLQ A +  +DL E +K+  SK+ N       KDP KPP+KAQV
Sbjct  39   KATGKRGFAETVDLKLNLQ-AKEGVMDLNENIKNITSKDKNHLPAVTIKDPAKPPAKAQV  97

Query  419  VGWPPVRNYRKNIMAXKGSPE  481
            VGWPPVR+YRKN+MA K + E
Sbjct  98   VGWPPVRSYRKNVMAQKNASE  118



>gb|KFK24541.1| hypothetical protein AALP_AAs58011U000100 [Arabis alpina]
Length=230

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS   + +DL     S 
Sbjct  1    MNLKETELCLGLPGGLETVESPAKSGVGNKRGFSETVDLKLNLQSNKQAPIDLNVAGTSR  60

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             K   KDP KPP+KAQVVGWPPVRNYRKNIMA + S E
Sbjct  61   EKTLLKDPSKPPAKAQVVGWPPVRNYRKNIMANQKSSE  98



>gb|ADL70639.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=171

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGE  98



>gb|ADL70642.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70650.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=172

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGE  98



>gb|ADL70640.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=172

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGE  98



>dbj|BAH56942.1| AT4G14550 [Arabidopsis thaliana]
Length=183

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +2

Query  266  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            V  KRGFSETVDLKLNLQS     +DL        K   KDP KPP+KAQVVGWPPVRNY
Sbjct  27   VGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNY  86

Query  446  RKNIMAXKGSPE  481
            RKN+MA + S E
Sbjct  87   RKNVMANQKSGE  98



>ref|NP_974355.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76709.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=210

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DLK     P
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  65

Query  368  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M  +
Sbjct  66   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQ  100



>ref|XP_007143877.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
 gb|ESW15871.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
Length=244

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 77/117 (66%), Gaps = 14/117 (12%)
 Frame = +2

Query  161  IGSMLAEHGGLNLKATElc--------lglpgggggNESESLKVTGKRGFSETVDLKLNL  316
            + +ML +   LNLK TELC         G  GGGGG+E E+ + TGKRGFSETVDLKLNL
Sbjct  1    MATMLGKEHHLNLKETELCLGLPGAGGGGGSGGGGGSEVETPRATGKRGFSETVDLKLNL  60

Query  317  QSAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
            Q+  D    L E +K+  +E    KDP K P+KAQVVGWPPVR+YRKN+M  K S E
Sbjct  61   QAKED----LNENLKNAPEEKTLLKDPTKQPAKAQVVGWPPVRSYRKNMMTQKVSTE  113



>emb|CAC84710.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=277

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 74/111 (67%), Gaps = 11/111 (10%)
 Frame = +2

Query  179  EHGGLNLKATElclgl-pgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLKE  352
            E   LN KATELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL E
Sbjct  10   ERADLNYKATELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQ-AKEGVMDLNE  68

Query  353  KMKSPSKEPN--------KDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             + + + E          KDP KPP+KAQVVGWPPVR+YRKN++A K + E
Sbjct  69   NINNIASEDKNHLPSATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASE  119



>gb|AAM65301.1| indoleacetic acid (IAA)-inducible gene (IAA7) [Arabidopsis thaliana]
Length=238

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DLK     P
Sbjct  1    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  60

Query  368  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M  +
Sbjct  61   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQ  95



>ref|NP_188945.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 sp|Q38825.1|IAA7_ARATH RecName: Full=Auxin-responsive protein IAA7; AltName: Full=Auxin 
resistant 2; AltName: Full=Indoleacetic acid-induced protein 
7 [Arabidopsis thaliana]
 gb|AAG48759.1|AF332395_1 indoleacetic acid-inducible protein IAA7 [Arabidopsis thaliana]
 gb|AAC49048.1| IAA7 [Arabidopsis thaliana]
 dbj|BAB02096.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAK96842.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAL66876.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76710.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=243

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DLK     P
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  65

Query  368  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M  +
Sbjct  66   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQ  100



>gb|ADB93627.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=191

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGE  98



>ref|XP_002315736.1| aux/IAA family protein [Populus trichocarpa]
 gb|EEF01907.1| aux/IAA family protein [Populus trichocarpa]
Length=277

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 76/111 (68%), Gaps = 11/111 (10%)
 Frame = +2

Query  179  EHGGLNLKATElclgl-pgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLKE  352
            E   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL E
Sbjct  10   EMADLNYKETELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQ-AKEGVMDLNE  68

Query  353  KMKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN++A K + E
Sbjct  69   NIKNIASKDKNHLPADTIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASE  119



>gb|ADB93625.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADB93626.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70643.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70644.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70645.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70646.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=190

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGE  98



>ref|XP_002883395.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59654.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DL     +P
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLNNVAAAP  65

Query  368  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M  +
Sbjct  66   KEKTTLKDPSKPPTKAQVVGWPPVRNYRKNMMTQQ  100



>gb|ADB93629.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=190

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETIESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGE  98



>gb|ADB93628.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70647.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70648.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70649.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70651.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=189

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGE  98



>ref|NP_001288823.1| auxin-responsive protein IAA7 [Brassica rapa]
 dbj|BAF81520.1| auxin-responsive protein IAA [Brassica rapa]
Length=242

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 71/96 (74%), Gaps = 4/96 (4%)
 Frame = +2

Query  191  LNLKATElclglpgggggNES-ESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLKATELCLGLPGG   NE+ E   V  KRGFSETVDL LNLQS  + ++DL   + S 
Sbjct  6    INLKATELCLGLPGGAEANENLEKSAVGNKRGFSETVDLMLNLQSNKEGAVDLNN-VASA  64

Query  368  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            SK+    KDP KPP+KAQVVGWPPVRNYRKNI+  +
Sbjct  65   SKDKTLLKDPAKPPAKAQVVGWPPVRNYRKNIITQQ  100



>gb|ADL70641.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=190

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLK TELCLGLPG     ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGCTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNVNGAPK  60

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGE  98



>ref|XP_010512022.1| PREDICTED: auxin-responsive protein IAA7 [Camelina sativa]
Length=242

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 70/96 (73%), Gaps = 4/96 (4%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DL   + + 
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLNN-VAAS  64

Query  368  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            +KE    KDP KPP+KAQVVGWPPVRNYRKNIM  +
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQ  100



>ref|XP_006298251.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
 gb|EOA31149.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
Length=285

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  266  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVR  439
            V  KRGFSETVDL LNLQS  + S+DL     SP KE N  KDP KPP+KAQVVGWPPVR
Sbjct  83   VGSKRGFSETVDLMLNLQSNKEGSVDLNNVAASP-KEKNLIKDPAKPPAKAQVVGWPPVR  141

Query  440  NYRKNIMAXK  469
            NYRKNIM  +
Sbjct  142  NYRKNIMTQQ  151



>ref|XP_006362195.1| PREDICTED: auxin-responsive protein IAA14-like [Solanum tuberosum]
Length=238

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 57/80 (71%), Gaps = 7/80 (9%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAAD--SSLDLKEKMK---SPSKE--PNKDPIKPPSKAQVV  421
            K+ GKRGFSETVDLKLN   A D  S      KMK   + +KE   NKDPIKPP+KAQVV
Sbjct  34   KINGKRGFSETVDLKLNFHQANDDISCAMENNKMKNSVTTTKEVVCNKDPIKPPAKAQVV  93

Query  422  GWPPVRNYRKNIMAXKGSPE  481
            GWPPVR++RKN+MA K + E
Sbjct  94   GWPPVRSFRKNVMAQKSNTE  113



>ref|XP_008438588.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=237

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 68/114 (60%), Gaps = 16/114 (14%)
 Frame = +2

Query  143  MEVGRKIGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  322
            MEV RK+ +ML     L L             GG E E+ K  GKRGFSETVDLKLN+QS
Sbjct  1    MEVSRKMVNMLETDLCLGLPG-----------GGAEPETPKANGKRGFSETVDLKLNIQS  49

Query  323  AADSSLDLKEKMKSPSKE-----PNKDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
                ++DL  K    S +      +KDP KPP+KAQVVGWPPVR+YRKN M+ K
Sbjct  50   KTGVTVDLTPKNSDTSTDEENLITSKDPAKPPAKAQVVGWPPVRSYRKNAMSQK  103



>emb|CAB46059.1| IAA7 like protein [Arabidopsis thaliana]
 emb|CAB78497.1| IAA7 like protein [Arabidopsis thaliana]
Length=234

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGE  98



>gb|AFZ78616.1| hypothetical protein [Populus tomentosa]
Length=211

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 73/111 (66%), Gaps = 11/111 (10%)
 Frame = +2

Query  179  EHGGLNLKATElclgl-pgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLKE  352
            E   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL E
Sbjct  10   ERADLNYKETELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQ-AKEGVMDLNE  68

Query  353  KMKSPSKEPN--------KDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             + + + E          KDP KPP+KAQVVGWPPVR+YRKN++A K + E
Sbjct  69   NINNIASEDKNHLPSATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASE  119



>ref|NP_193191.2| auxin-responsive protein IAA14 [Arabidopsis thaliana]
 sp|Q38832.2|IAA14_ARATH RecName: Full=Auxin-responsive protein IAA14; AltName: Full=Indoleacetic 
acid-induced protein 14; AltName: Full=Protein SOLITARY 
ROOT [Arabidopsis thaliana]
 gb|AAG50096.1|AF334718_1 IAA14 [Arabidopsis thaliana]
 dbj|BAF00338.1| IAA14 [Arabidopsis thaliana]
 dbj|BAH30518.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83459.1| auxin-responsive protein IAA14 [Arabidopsis thaliana]
Length=228

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGE  98



>ref|XP_004134097.1| PREDICTED: auxin-responsive protein IAA14-like isoform 2 [Cucumis 
sativus]
Length=220

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 69/116 (59%), Gaps = 16/116 (14%)
 Frame = +2

Query  143  MEVGRKIGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  322
            MEV RK+ +ML     L L             GG E E+ K  GKRGFSETVDLKLN+QS
Sbjct  1    MEVSRKMVNMLETDLCLGLPG-----------GGAEPETPKANGKRGFSETVDLKLNIQS  49

Query  323  AADSSLDLKEKMKSPSKE-----PNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGS  475
                ++DL  +    S +      +KDP KPP+KAQVVGWPPVR+YRKN M+ K S
Sbjct  50   KPGVTVDLTPQNNDTSTDEESLIASKDPAKPPAKAQVVGWPPVRSYRKNAMSQKSS  105



>ref|XP_010488346.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 70/96 (73%), Gaps = 4/96 (4%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NL+ATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DL   + + 
Sbjct  6    MNLRATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLNN-VAAS  64

Query  368  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            +KE    KDP KPP+KAQVVGWPPVRNYRKNIM  +
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQ  100



>ref|XP_002531288.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
 gb|EEF31101.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
Length=257

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 70/98 (71%), Gaps = 5/98 (5%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDL---KEKMK  361
            +N + TEL LGLPGG   N+SE  KV GKRGFSETVDLKLNL +   S  D+   +E MK
Sbjct  15   INFEETELRLGLPGGSNVNDSEFAKVNGKRGFSETVDLKLNLSTKEPSGKDVIVGEETMK  74

Query  362  SPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
              +  P+   DP KPP+KAQVVGWPP+R++RKN+MA +
Sbjct  75   EKATVPSSSNDPAKPPAKAQVVGWPPIRSFRKNVMAVQ  112



>ref|XP_004172452.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis sativus]
 gb|KGN61643.1| hypothetical protein Csa_2G200420 [Cucumis sativus]
Length=256

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 59/90 (66%), Gaps = 14/90 (16%)
 Frame = +2

Query  248  ESESLKVTGKRGFSETVDLKLNLQS-------AADSSLDLKEKMKSPSKEPN-------K  385
            +  SLK +GKRGFSETVDLKLNLQS            +DL E +K+ S   +       K
Sbjct  34   DQTSLKASGKRGFSETVDLKLNLQSKDGGGGVGVGVGVDLNENIKNVSTNVDGEKSLCSK  93

Query  386  DPIKPPSKAQVVGWPPVRNYRKNIMAXKGS  475
            DP KPP+KAQVVGWPPVR+YRKN+MA K +
Sbjct  94   DPAKPPAKAQVVGWPPVRSYRKNVMAQKNT  123



>ref|XP_004134096.1| PREDICTED: auxin-responsive protein IAA14-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162257.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
 gb|KGN56916.1| hypothetical protein Csa_3G143570 [Cucumis sativus]
Length=237

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 69/116 (59%), Gaps = 16/116 (14%)
 Frame = +2

Query  143  MEVGRKIGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  322
            MEV RK+ +ML     L L             GG E E+ K  GKRGFSETVDLKLN+QS
Sbjct  1    MEVSRKMVNMLETDLCLGLPG-----------GGAEPETPKANGKRGFSETVDLKLNIQS  49

Query  323  AADSSLDLKEKMKSPSKE-----PNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGS  475
                ++DL  +    S +      +KDP KPP+KAQVVGWPPVR+YRKN M+ K S
Sbjct  50   KPGVTVDLTPQNNDTSTDEESLIASKDPAKPPAKAQVVGWPPVRSYRKNAMSQKSS  105



>ref|XP_006414696.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
 gb|ESQ56149.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
Length=257

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 51/72 (71%), Gaps = 2/72 (3%)
 Frame = +2

Query  266  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            V  KRGFSETVD KLNLQS     +DL   +    KE  KDP KPP+KAQVVGWPPVRNY
Sbjct  55   VGNKRGFSETVDFKLNLQSNKQGHVDLN--VTVAHKEKTKDPAKPPAKAQVVGWPPVRNY  112

Query  446  RKNIMAXKGSPE  481
            RK++MA + S E
Sbjct  113  RKSVMAHQKSSE  124



>ref|XP_004150437.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
Length=264

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 59/90 (66%), Gaps = 14/90 (16%)
 Frame = +2

Query  248  ESESLKVTGKRGFSETVDLKLNLQS-------AADSSLDLKEKMKSPSKEPN-------K  385
            +  SLK +GKRGFSETVDLKLNLQS            +DL E +K+ S   +       K
Sbjct  34   DQTSLKASGKRGFSETVDLKLNLQSKDGGGGVGVGVGVDLNENIKNVSTNVDGEKSLCSK  93

Query  386  DPIKPPSKAQVVGWPPVRNYRKNIMAXKGS  475
            DP KPP+KAQVVGWPPVR+YRKN+MA K +
Sbjct  94   DPAKPPAKAQVVGWPPVRSYRKNVMAQKNT  123



>gb|AFK44393.1| unknown [Lotus japonicus]
Length=242

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 70/99 (71%), Gaps = 10/99 (10%)
 Frame = +2

Query  191  LNLKATElc----lglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKM  358
            LNLK TELC     G  GGGG ++ E+ +  GKRGFSETVDLKLNLQS  D    L + +
Sbjct  12   LNLKETELCLGLPGGGGGGGGSDQVETPRSNGKRGFSETVDLKLNLQSKED----LNDDV  67

Query  359  KSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+M  K
Sbjct  68   KNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMVQK  106



>ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
Length=249

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEP--NKDPIKPPSKAQV  418
            N+ E  K  GKRGFSETVDLKLNL +A ++  D  EK+K  S     + DP KPP+KAQV
Sbjct  32   NDGEMTKNNGKRGFSETVDLKLNLSTAKEAVADEAEKVKKKSTVAPRSADPAKPPAKAQV  91

Query  419  VGWPPVRNYRKNIMAXK  469
            VGWPPVR++RKNIMA +
Sbjct  92   VGWPPVRSFRKNIMAVQ  108



>ref|XP_008465181.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=256

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 59/90 (66%), Gaps = 14/90 (16%)
 Frame = +2

Query  248  ESESLKVTGKRGFSETVDLKLNLQS-------AADSSLDLKEKMKSPSKEPN-------K  385
            +  SLK +GKRGFSETVDLKLNLQS            +DL E +K+ S   +       K
Sbjct  34   DQTSLKSSGKRGFSETVDLKLNLQSKDGGGGGGVGVGVDLNENVKNVSTNVDGEKSLCSK  93

Query  386  DPIKPPSKAQVVGWPPVRNYRKNIMAXKGS  475
            DP KPP+KAQVVGWPPVR+YRKN+MA K +
Sbjct  94   DPAKPPAKAQVVGWPPVRSYRKNVMAQKNT  123



>ref|XP_010466604.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 69/96 (72%), Gaps = 4/96 (4%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLKATELCLGLPGG    ES +    G KR FSETVDL LNLQS  + S+DL   + + 
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRSFSETVDLMLNLQSNKEGSVDLNN-VAAS  64

Query  368  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            +KE    KDP KPP+KAQVVGWPPVRNYRKNIM  +
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQ  100



>ref|XP_009135842.1| PREDICTED: auxin-responsive protein IAA7-like [Brassica rapa]
 emb|CDX92973.1| BnaA03g36950D [Brassica napus]
Length=237

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NL ATELCLGLPGG    ES +   V  KRGFSET+DL LNLQ   + ++DL     S 
Sbjct  6    MNLNATELCLGLPGGTKAVESPAKSSVRNKRGFSETMDLMLNLQCNKEETVDLNNATASK  65

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
             K   KDP KPP+KAQVVGWPPVRNYRKN+M  +
Sbjct  66   EKTLLKDPAKPPAKAQVVGWPPVRNYRKNMMTQQ  99



>ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-like [Tarenaya hassleriana]
Length=235

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  454
            KRGFSETVDLKLNLQ+  +  +DL    K  S   +KD  KPP+KAQVVGWPPVRNYRKN
Sbjct  41   KRGFSETVDLKLNLQTNKEGVVDLNNVAKDKSLLVSKDHAKPPAKAQVVGWPPVRNYRKN  100

Query  455  IMAXKGS  475
            +MA + S
Sbjct  101  MMAHQKS  107



>ref|NP_001268036.1| uncharacterized protein LOC100250231 [Vitis vinifera]
 gb|ADR80321.1| indole-3-acetic acid-induced protein 16 [Vitis vinifera]
Length=238

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSK-EPNKDPIKPPSKAQVVGWPPVR  439
            K +GKRGFSETVDLKLNL S  DS  D  EKMK  S   P+ DP KPP+KAQVVGWPPVR
Sbjct  39   KTSGKRGFSETVDLKLNLLSK-DSVADQAEKMKEKSALPPSNDPAKPPAKAQVVGWPPVR  97

Query  440  NYRKNIMAXK  469
            ++RKNI+  +
Sbjct  98   SFRKNILTVQ  107



>emb|CDY10349.1| BnaC05g29300D [Brassica napus]
Length=246

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 68/94 (72%), Gaps = 4/94 (4%)
 Frame = +2

Query  197  LKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSK  373
            L ATELCLGLPGG   NE+ +    G KRGFSETVDL LNLQS  + ++DL   + S SK
Sbjct  12   LYATELCLGLPGGAEANENLAKSAVGNKRGFSETVDLMLNLQSNKEGAVDLNN-VASASK  70

Query  374  EPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            E    KDP KPP+KAQVVGWPPVRNYRKNI+  +
Sbjct  71   ETTLLKDPAKPPAKAQVVGWPPVRNYRKNIITQQ  104



>gb|KJB82526.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=194

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  424
            N+ E+ K  GKRGFSETV+LKLNL S    + D  EKMK  S   + DP KPP+KAQVVG
Sbjct  32   NDGETTKNNGKRGFSETVNLKLNLSSKETVAED-SEKMKEKS---STDPAKPPAKAQVVG  87

Query  425  WPPVRNYRKNIMA  463
            WPPVR++RKNIMA
Sbjct  88   WPPVRSFRKNIMA  100



>gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides]
Length=249

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 10/82 (12%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNL---QSAADSS----LDLKEKMKSPSKEPNKDPIKPP  403
            N+SE+ K  GKRGFSETVDLKLNL   ++  D S    + +KEK  +P   PN DP KPP
Sbjct  35   NDSEAAKSNGKRGFSETVDLKLNLSTKETGKDGSDQEKVVMKEKTVAP--RPN-DPAKPP  91

Query  404  SKAQVVGWPPVRNYRKNIMAXK  469
            SKAQVVGWPP+R++RKN+MA +
Sbjct  92   SKAQVVGWPPIRSFRKNVMAVQ  113



>ref|XP_010440448.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +2

Query  266  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            V  KRGFSETVDLKLNLQS      DL        K   KDP KPP+KAQVVGWPPVRNY
Sbjct  24   VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDPAKPPAKAQVVGWPPVRNY  83

Query  446  RKNIMAXKGSPE  481
            RKN+MA + + E
Sbjct  84   RKNVMANQKNGE  95



>gb|EYU46510.1| hypothetical protein MIMGU_mgv1a013084mg [Erythranthe guttata]
Length=231

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 54/73 (74%), Gaps = 10/73 (14%)
 Frame = +2

Query  272  GKRGFSETVDLKLNLQSA---ADSSLDLKE------KMKSPSKEPNKDPIKPPSKAQVVG  424
            GKRGFSETVDLKLNL SA    DS++DLKE      K   PS  P  D +KPP+KAQVVG
Sbjct  25   GKRGFSETVDLKLNLSSAEIGLDSAIDLKENNFNKEKNLLPSSSPT-DSVKPPAKAQVVG  83

Query  425  WPPVRNYRKNIMA  463
            WPPVR++RKN+MA
Sbjct  84   WPPVRSFRKNVMA  96



>ref|XP_010435110.1| PREDICTED: auxin-responsive protein IAA14 [Camelina sativa]
Length=228

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  266  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            V  KRGFSETVDLKLNLQS      DL        K   KDP KPP+KAQVVGWPPVRNY
Sbjct  27   VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDPAKPPAKAQVVGWPPVRNY  86

Query  446  RKNIMA  463
            RKN+MA
Sbjct  87   RKNVMA  92



>gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa]
Length=231

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 58/78 (74%), Gaps = 8/78 (10%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN----KDPIKPPSKAQVVGW  427
            K TGKRGFSETVDLKLNL   A+  L + E +K+  S+E N    KDP KPP+KAQVVGW
Sbjct  30   KATGKRGFSETVDLKLNLH--ANEGL-MNESVKNVSSREKNLPCIKDPAKPPAKAQVVGW  86

Query  428  PPVRNYRKNIMAXKGSPE  481
            PPVR+YRKN+MA K + E
Sbjct  87   PPVRSYRKNVMAQKSTGE  104



>ref|XP_010450026.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +2

Query  266  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            V  KRGFSETVDLKLNLQS      DL        K   KDP KPP+KAQVVGWPPVRNY
Sbjct  24   VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDPSKPPAKAQVVGWPPVRNY  83

Query  446  RKNIMAXKGSPE  481
            RKN+MA + + E
Sbjct  84   RKNVMANQKNGE  95



>ref|XP_002868277.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44536.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLK TELCLGLPGG    E  S    G KRGFSETV LKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGAETVECPSKSGVGNKRGFSETVGLKLNLQSNKQGPVDLNVNGAPK  60

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXKGSPE  481
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGE  98



>emb|CAN72026.1| hypothetical protein VITISV_014421 [Vitis vinifera]
Length=285

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 52/68 (76%), Gaps = 2/68 (3%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSK-EPNKDPIKPPSKAQVVGWPPVR  439
            K +GKRGFSETVDLKLNL S  DS  D  EKMK  S   P+ DP KPP+KAQVVGWPPVR
Sbjct  39   KSSGKRGFSETVDLKLNLLSK-DSVADQAEKMKEKSALPPSNDPAKPPAKAQVVGWPPVR  97

Query  440  NYRKNIMA  463
            ++RKNI+ 
Sbjct  98   SFRKNILT  105



>ref|XP_006406100.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
 dbj|BAJ33997.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47553.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
Length=239

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLKAT+LCLGLPGG    ES +    G KRGFSETVDL LNLQS  + ++DL     +P
Sbjct  6    MNLKATDLCLGLPGGAEAVESPAKSAVGNKRGFSETVDLMLNLQSNKEGTVDLNNVSAAP  65

Query  368  -SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
              K   KD  KPP+KAQVVGWPPVRNYRKNIM  +
Sbjct  66   KEKTLLKDHSKPPAKAQVVGWPPVRNYRKNIMTQQ  100



>gb|EYU33008.1| hypothetical protein MIMGU_mgv1a012321mg [Erythranthe guttata]
Length=254

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 76/119 (64%), Gaps = 16/119 (13%)
 Frame = +2

Query  143  MEVGRKIGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  322
            MEV RK   M+AE  GLN K TELCLGLPGGGGG E +++K+ GKRGFSETVDLKLNLQS
Sbjct  1    MEVCRK---MVAEERGLNFKETELCLGLPGGGGGGEPDAVKINGKRGFSETVDLKLNLQS  57

Query  323  AADSSLDLKEKMKSPSKEPNKDPIKPP-------------SKAQVVGWPPVRNYRKNIM  460
               +S DL       + + N    K               +KAQVVGWPPVR++RKNI+
Sbjct  58   NDSASTDLNNGGGGGAMKNNNSAEKTAANMVPPKDPVKPPAKAQVVGWPPVRSFRKNIV  116



>gb|KJB82525.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=246

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  424
            N+ E+ K  GKRGFSETV+LKLNL S    + D  EKMK  S   + DP KPP+KAQVVG
Sbjct  32   NDGETTKNNGKRGFSETVNLKLNLSSKETVAED-SEKMKEKS---STDPAKPPAKAQVVG  87

Query  425  WPPVRNYRKNIMA  463
            WPPVR++RKNIMA
Sbjct  88   WPPVRSFRKNIMA  100



>ref|XP_002281771.1| PREDICTED: auxin-responsive protein IAA16-like [Vitis vinifera]
Length=244

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 82/124 (66%), Gaps = 18/124 (15%)
 Frame = +2

Query  143  MEVGRKIGSMLAEHG---GLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLN  313
            MEV RK+ +M  E      LNL+ATEL LGLPGG     SE  +V  KRGFSETVDLKLN
Sbjct  1    MEVARKMATMHGEEREKPDLNLEATELRLGLPGG-----SEGSEVVRKRGFSETVDLKLN  55

Query  314  LQSAADSSLDLKEKMKSPSKEPNK-------DPIKPPSKAQVVGWPPVRNYRKNIMA-XK  469
            L S  ++ +D   K+KS  KE +K       DP +PP+KAQVVGWPPVR++RKN++A  K
Sbjct  56   L-SGKEAGVD-DNKVKSLQKEKSKSLLPCGNDPARPPAKAQVVGWPPVRSFRKNMLAGQK  113

Query  470  GSPE  481
            G  E
Sbjct  114  GGSE  117



>ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
 gb|ABK94241.1| unknown [Populus trichocarpa]
 gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
Length=250

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 10/80 (13%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNL---QSAADSS----LDLKEKMKSPSKEPNKDPIKPP  403
            N+ E+ K  GKRGFSETVDLKLNL   ++  D S    + +KEK  +P   PN DP KPP
Sbjct  35   NDGEAAKGNGKRGFSETVDLKLNLSTKETGKDGSDQEKVVMKEKTVAP--RPN-DPAKPP  91

Query  404  SKAQVVGWPPVRNYRKNIMA  463
            SKAQVVGWPP+R++RKN+MA
Sbjct  92   SKAQVVGWPPIRSFRKNVMA  111



>ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=249

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 8/79 (10%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKE------PNKDPIKPPS  406
            N++E+ K  GKRGFSETVDLKLNL S  ++  D  ++ K  +KE      PN DP KPPS
Sbjct  35   NDAEAAKSNGKRGFSETVDLKLNL-STKETGKDGSDQEKVATKEKTVAPRPN-DPAKPPS  92

Query  407  KAQVVGWPPVRNYRKNIMA  463
            KAQVVGWPP+R++RKN+MA
Sbjct  93   KAQVVGWPPIRSFRKNVMA  111



>ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 58/78 (74%), Gaps = 8/78 (10%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN----KDPIKPPSKAQVVGW  427
            K TGKRGFSETVDLKLNL   A+  L + E +K+  S+E N    KDP KPP+KAQVVGW
Sbjct  37   KATGKRGFSETVDLKLNLH--ANEGL-MNESVKNVSSREKNLPCIKDPAKPPAKAQVVGW  93

Query  428  PPVRNYRKNIMAXKGSPE  481
            PPVR++RKN+MA K + E
Sbjct  94   PPVRSFRKNVMAQKSTGE  111



>ref|XP_006284476.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
 gb|EOA17374.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
Length=228

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  367
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS      DL       
Sbjct  1    MNLKETELCLGLPGGAETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHGDLNVSGSIK  60

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
             K   +DP KPP+KAQVVGWPPVRNYRK +MA +
Sbjct  61   EKTLLQDPTKPPTKAQVVGWPPVRNYRKTVMATQ  94



>gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum]
Length=246

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  424
            N+ E+ K  GKRGFSETV+LKLNL S    + D  +KMK  S   + DP KPP+KAQVVG
Sbjct  32   NDGETTKNNGKRGFSETVNLKLNLSSKETVAED-SDKMKEKS---STDPAKPPAKAQVVG  87

Query  425  WPPVRNYRKNIMA  463
            WPPVR++RKNIMA
Sbjct  88   WPPVRSFRKNIMA  100



>gb|KJB44872.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=210

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 6/75 (8%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  424
            N++E+ K  GKRG+S+ VDLKLNL +  ++S+D  EKMK       K+  KPP+KAQVVG
Sbjct  32   NDNETAKNNGKRGYSDMVDLKLNLSTTKEASVDEAEKMKE------KNTAKPPAKAQVVG  85

Query  425  WPPVRNYRKNIMAXK  469
            WPPVR++RKNIM  +
Sbjct  86   WPPVRSFRKNIMTVQ  100



>gb|KJB44873.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=254

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 6/75 (8%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  424
            N++E+ K  GKRG+S+ VDLKLNL +  ++S+D  EKMK       K+  KPP+KAQVVG
Sbjct  32   NDNETAKNNGKRGYSDMVDLKLNLSTTKEASVDEAEKMKE------KNTAKPPAKAQVVG  85

Query  425  WPPVRNYRKNIMAXK  469
            WPPVR++RKNIM  +
Sbjct  86   WPPVRSFRKNIMTVQ  100



>ref|XP_010087762.1| Auxin-responsive protein IAA7 [Morus notabilis]
 gb|EXB29843.1| Auxin-responsive protein IAA7 [Morus notabilis]
Length=304

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 55/78 (71%), Gaps = 8/78 (10%)
 Frame = +2

Query  266  VTGKRGFSETVDLKLNL--QSAADSSLDLKEKMKS-PSKEPN-----KDPIKPPSKAQVV  421
             TGKRG+SETVDLKLNL  QS  +   ++  K  S P KE N     KDP KPP+KAQVV
Sbjct  41   TTGKRGYSETVDLKLNLHRQSVKEDLNEINIKSTSAPPKEKNLLPCTKDPAKPPAKAQVV  100

Query  422  GWPPVRNYRKNIMAXKGS  475
            GWPPVR+YRKNIMA K S
Sbjct  101  GWPPVRSYRKNIMAQKMS  118



>ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis]
 gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis]
Length=257

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 2/74 (3%)
 Frame = +2

Query  254  ESLKVTGKRGFSETVDLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGW  427
            E+ K  GKRGF ETVDLKLNL S    SLD   K+++K+    P+ D +KPP+KAQVVGW
Sbjct  44   EATKNNGKRGFPETVDLKLNLSSKDSGSLDQVDKKEIKTSPVSPSTDSVKPPAKAQVVGW  103

Query  428  PPVRNYRKNIMAXK  469
            PPVR++RKNI++ +
Sbjct  104  PPVRSFRKNIVSAQ  117



>gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=246

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 10/76 (13%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNLQS---AADSSLDLKEKMKSPSKEPNKDPIKPPSKAQ  415
            NE E+ K  GKRGFSETV+LKLNL S    A+ S ++KEK        + D  KPP+KAQ
Sbjct  32   NEGETTKNNGKRGFSETVNLKLNLSSKETVAEDSDEMKEK-------SSTDTAKPPAKAQ  84

Query  416  VVGWPPVRNYRKNIMA  463
            VVGWPPVR++RKNIMA
Sbjct  85   VVGWPPVRSFRKNIMA  100



>ref|XP_010532600.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=229

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 6/64 (9%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQS-AADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRK  451
            KRGFSETVDLKLNLQ+   +  +DL     + + + +KDP KPPSKAQVVGWPPVRNYRK
Sbjct  38   KRGFSETVDLKLNLQTNKQEGVMDL-----TNASKVSKDPAKPPSKAQVVGWPPVRNYRK  92

Query  452  NIMA  463
            N+MA
Sbjct  93   NVMA  96



>ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
 gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
Length=246

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 7/80 (9%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNLQS-----AADSSLDLKEKMKSPSKEPNKDPIKPPSK  409
            N+ E  K  GKRGFSETVDLKLNL +       D    +KEK  +P    + DP KPP+K
Sbjct  34   NDGEVAKSNGKRGFSETVDLKLNLSTKESGKGGDEEKVMKEKTVAPP--ASTDPAKPPAK  91

Query  410  AQVVGWPPVRNYRKNIMAXK  469
            AQVVGWPP+R++RKN+MA +
Sbjct  92   AQVVGWPPIRSFRKNVMAVQ  111



>ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=246

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 3/78 (4%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK-MKSPSKEP--NKDPIKPPSKAQ  415
            N+ E  K  GKRGFSETVDLKLNL +       ++EK MK  +  P  + DP KPP+KAQ
Sbjct  34   NDGEVAKSNGKRGFSETVDLKLNLSTKESGKGVVEEKVMKEKTVAPPASTDPAKPPAKAQ  93

Query  416  VVGWPPVRNYRKNIMAXK  469
            VVGWPP+R++RKN+MA +
Sbjct  94   VVGWPPIRSFRKNVMAVQ  111



>gb|ABH01143.1| auxin-regulated protein [Populus tomentosa]
Length=258

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 57/81 (70%), Gaps = 10/81 (12%)
 Frame = +2

Query  245  NESESLKVTGKRG--FSETVDLKLNLQSAADSSLDLKEKMKSPSKE------PNKDPIKP  400
            N+ E+ K  GKRG  FSETVDLKLNL S  D+  D  ++ K+  KE      PN DP KP
Sbjct  35   NDPEAAKSNGKRGQRFSETVDLKLNL-STKDTGKDGSDQEKAAMKEKAVAPRPN-DPAKP  92

Query  401  PSKAQVVGWPPVRNYRKNIMA  463
            PSKAQVVGWPP+R++RKN+MA
Sbjct  93   PSKAQVVGWPPIRSFRKNVMA  113



>ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
 gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
Length=241

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 66/97 (68%), Gaps = 16/97 (16%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL------DLKE  352
            +N +ATEL LGLPGG  G +  ++K  GKRGFSETVDLKLNL S A  S+      D+KE
Sbjct  2    INFEATELRLGLPGGNHGGDMAAVKNNGKRGFSETVDLKLNLSSTAMDSVSGAQLEDIKE  61

Query  353  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  463
            K          D +KPP+K QVVGWPPVR++RKN+M+
Sbjct  62   K----------DVVKPPAKTQVVGWPPVRSFRKNVMS  88



>emb|CDY47148.1| BnaA08g05350D [Brassica napus]
Length=233

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  454
            KRGFSE V+LKL L S  + S+DL        K  +KDP KPP+KAQVVGWPPVRNYRK+
Sbjct  34   KRGFSEIVELKLGLHSTKEGSVDLNVAGAPKEKTLHKDPSKPPAKAQVVGWPPVRNYRKS  93

Query  455  IMAXKGSPE  481
            +M  +   E
Sbjct  94   VMTHQKCSE  102



>ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=252

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 74/120 (62%), Gaps = 15/120 (13%)
 Frame = +2

Query  143  MEVGRKIGSMLA---EHGGLNLKATE----lclglpgggggNESESLKVTG-KRGFSETV  298
            MEV RK+ S L    +   LN + TE    L  G  GG G     + K+ G KRGF+ETV
Sbjct  1    MEVCRKMASRLGGGPDEYSLNFEETELRLGLPGGGGGGDGDTTPSATKINGAKRGFAETV  60

Query  299  DLKLNLQSAADSSLDLKEKMKSPSKEPN-----KDPIKPPSKAQVVGWPPVRNYRKNIMA  463
            DLKLNL +  +S LD  EK  SP KE N      DP KPP+KAQVVGWPPVR++RKNI++
Sbjct  61   DLKLNLPTK-ESVLDPAEKKNSP-KEKNLLPCSNDPAKPPAKAQVVGWPPVRSFRKNILS  118



>ref|XP_009107777.1| PREDICTED: auxin-responsive protein IAA14 [Brassica rapa]
Length=233

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  454
            KRGFSE V+LKL L S  + S+DL        K  +KDP KPP+KAQVVGWPPVRNYRK+
Sbjct  34   KRGFSEIVELKLGLHSTKEGSVDLNVAGAPKEKTLHKDPSKPPAKAQVVGWPPVRNYRKS  93

Query  455  IMAXKGSPE  481
            +M  +   E
Sbjct  94   VMTHQKCSE  102



>gb|ABR08763.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
Length=134

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 53/87 (61%), Gaps = 20/87 (23%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  412
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  13   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPTKA  67

Query  413  QVVGWPPVRNYRKNIMA----XKGSPE  481
            QVVGWPPVR+YRKN+M       G PE
Sbjct  68   QVVGWPPVRSYRKNVMVSCQKSSGGPE  94



>gb|ADL70687.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70690.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=132

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 53/87 (61%), Gaps = 20/87 (23%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  412
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  9    VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  63

Query  413  QVVGWPPVRNYRKNIMA----XKGSPE  481
            QVVGWPPVR+YRKN+M       G PE
Sbjct  64   QVVGWPPVRSYRKNVMVSCQKSSGGPE  90



>gb|ADL70689.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=138

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 53/87 (61%), Gaps = 20/87 (23%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  412
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  15   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  69

Query  413  QVVGWPPVRNYRKNIMA----XKGSPE  481
            QVVGWPPVR+YRKN+M       G PE
Sbjct  70   QVVGWPPVRSYRKNVMVSCQKSSGGPE  96



>emb|CDY62130.1| BnaC08g47390D [Brassica napus]
Length=233

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  454
            KRGFSE V+LKL L S    S+DL        K  +KDP KPP+KAQVVGWPPVRNYRK+
Sbjct  34   KRGFSEIVELKLGLHSTKQGSVDLNVAGAPKEKTLHKDPSKPPAKAQVVGWPPVRNYRKS  93

Query  455  IMAXKGSPE  481
            +M  +   E
Sbjct  94   VMTHQKCSE  102



>ref|XP_002889499.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65758.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
Length=229

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 54/87 (62%), Gaps = 20/87 (23%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  412
            VTG KRGFSETVDLKLNL +  ++          + D KEK   P     KDP KPPSKA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHDVVTFDSKEKSSCP-----KDPAKPPSKA  81

Query  413  QVVGWPPVRNYRKNIMA----XKGSPE  481
            QVVGWPPVR+YRKN+M       G PE
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSGGPE  108



>ref|XP_006304183.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
 gb|EOA37081.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
Length=224

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 11/72 (15%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSA-----ADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGW  427
            VTG KRGFSETVDLKLNL +        ++LD KEK        +KDP KPP+KAQVVGW
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTLDSKEKSSC-----SKDPAKPPAKAQVVGW  81

Query  428  PPVRNYRKNIMA  463
            PPVR+YRKN+M 
Sbjct  82   PPVRSYRKNVMV  93



>gb|ABR08758.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08759.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08760.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08761.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08762.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08764.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08765.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08766.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08767.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08768.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08769.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08770.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08771.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08772.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08773.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08774.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08775.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08776.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08777.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08778.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08779.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
Length=134

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 53/87 (61%), Gaps = 20/87 (23%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  412
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  13   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  67

Query  413  QVVGWPPVRNYRKNIMA----XKGSPE  481
            QVVGWPPVR+YRKN+M       G PE
Sbjct  68   QVVGWPPVRSYRKNVMVSCQKSSGGPE  94



>gb|ADB93635.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93636.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93637.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93638.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93639.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70683.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70686.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70691.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70693.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70694.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=150

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 53/87 (61%), Gaps = 20/87 (23%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  412
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  81

Query  413  QVVGWPPVRNYRKNIMA----XKGSPE  481
            QVVGWPPVR+YRKN+M       G PE
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSGGPE  108



>gb|ADL70684.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70688.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70692.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=144

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 53/87 (61%), Gaps = 20/87 (23%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  412
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  21   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  75

Query  413  QVVGWPPVRNYRKNIMA----XKGSPE  481
            QVVGWPPVR+YRKN+M       G PE
Sbjct  76   QVVGWPPVRSYRKNVMVSCQKSSGGPE  102



>ref|XP_010278165.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=251

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 82/123 (67%), Gaps = 14/123 (11%)
 Frame = +2

Query  143  MEVGRKIGSMLA---EHGGLNLKATElclglpgggggNESESL----KVTGKRGFSETVD  301
            MEV RK+ +ML    +   LN + TEL LGLPGGGGG+E ES     K  GKRGF ETVD
Sbjct  1    MEVCRKMANMLGAERDEYSLNFEETELRLGLPGGGGGSEGESTPSPTKNGGKRGFCETVD  60

Query  302  LKLNLQSAADSSLDLKEKMKSPSKEPNKDPI-----KPPSKAQVVGWPPVRNYRKNIMAX  466
            LKLNL S  +S +D  EK  SP KE N  P      KPP+KAQVVGWPPVR++RKNI++ 
Sbjct  61   LKLNLPSK-ESVMDPSEKKNSP-KEKNLLPCTNDLAKPPAKAQVVGWPPVRSFRKNILSV  118

Query  467  KGS  475
            + S
Sbjct  119  QKS  121



>gb|ADL70685.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70695.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=149

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 53/87 (61%), Gaps = 20/87 (23%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  412
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  26   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  80

Query  413  QVVGWPPVRNYRKNIMA----XKGSPE  481
            QVVGWPPVR+YRKN+M       G PE
Sbjct  81   QVVGWPPVRSYRKNVMVSCQKSSGGPE  107



>emb|CAH59413.1| auxin resistance protein [Plantago major]
Length=227

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 5/64 (8%)
 Frame = +2

Query  272  GKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRK  451
            GKRG+ +TVDLKLNL     SS DL  +      + N  P+KPP+KAQVVGWPPVRN+RK
Sbjct  37   GKRGYEQTVDLKLNL-----SSKDLPNQTDLAENKKNDQPVKPPAKAQVVGWPPVRNFRK  91

Query  452  NIMA  463
            N+MA
Sbjct  92   NVMA  95



>gb|KDP23667.1| hypothetical protein JCGZ_23500 [Jatropha curcas]
Length=248

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 51/69 (74%), Gaps = 4/69 (6%)
 Frame = +2

Query  272  GKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN-KDPIKPPSKAQVVGWPPVRNYR  448
            GKRGFSETVDLKLNL +        +EKMK  +  P+  DP KPP+KAQVVGWPP+R++R
Sbjct  46   GKRGFSETVDLKLNLSTKESGK---EEKMKEKTDVPSSNDPAKPPAKAQVVGWPPIRSFR  102

Query  449  KNIMAXKGS  475
            KN+M+ + S
Sbjct  103  KNVMSVQKS  111



>gb|KJB11146.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=285

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 7/74 (9%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSS-LD-LKEKMKSPSKEPNK-----DPIKPPSKAQVV  421
            +V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVV
Sbjct  47   EVVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVV  106

Query  422  GWPPVRNYRKNIMA  463
            GWPPVR++RKN++A
Sbjct  107  GWPPVRSFRKNMLA  120



>ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum]
 gb|AEX00359.1| IAA16 [Solanum lycopersicum]
Length=251

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 57/86 (66%), Gaps = 11/86 (13%)
 Frame = +2

Query  245  NESESL-KVTGKRGFSETVDLKLNLQSAADSSL----------DLKEKMKSPSKEPNKDP  391
            NE ES  K  GKR FSETVDLKLNL ++ DS+L          ++KEK  +     + DP
Sbjct  32   NELESSNKNNGKRVFSETVDLKLNLSNSKDSTLMDNININQVDNMKEKKNNIVVPSSNDP  91

Query  392  IKPPSKAQVVGWPPVRNYRKNIMAXK  469
             KPP+KAQVVGWPPVR++RKN+M  +
Sbjct  92   AKPPAKAQVVGWPPVRSFRKNVMTVQ  117



>gb|AEE25650.1| auxin-responsive protein [Gossypium hirsutum]
Length=253

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 7/73 (10%)
 Frame = +2

Query  266  VTGKRGFSETVDLKLNLQSAADSS-LD-LKEKMKSPSKEPNK-----DPIKPPSKAQVVG  424
            V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVVG
Sbjct  48   VVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVG  107

Query  425  WPPVRNYRKNIMA  463
            WPPVR++RKN++A
Sbjct  108  WPPVRSFRKNMLA  120



>dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipomoea nil]
Length=225

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 72/99 (73%), Gaps = 14/99 (14%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMK---  361
            LN +ATEL LGLPGGGGGN+ E++K  GKR FS+TVDLKL L S+ +S++D  E +K   
Sbjct  2    LNFEATELRLGLPGGGGGNDGEAVKSNGKRAFSDTVDLKLKL-SSKESNVDQVENLKDNN  60

Query  362  -----SPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  463
                 SPS     D  KPP+KAQVVGWPPVR+YRKNI++
Sbjct  61   NNVVTSPS-----DSTKPPAKAQVVGWPPVRSYRKNILS  94



>gb|KDO53919.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=200

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 54/73 (74%), Gaps = 7/73 (10%)
 Frame = +2

Query  263  KVTGKRGFSET--VDLKLNLQSAADSSLDLKEKMKSP---SKEPNKDPIKPPS-KAQVVG  424
            K + KRGF ET  +DLKLNLQS  +SS+DL E  K+P   +K  +KDP KP + KAQVVG
Sbjct  40   KASNKRGFCETAVIDLKLNLQSK-ESSVDLNENFKNPPSNNKNHDKDPAKPSANKAQVVG  98

Query  425  WPPVRNYRKNIMA  463
            WPPVR+YRKN MA
Sbjct  99   WPPVRSYRKNAMA  111



>gb|KJB11145.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=261

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 7/74 (9%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSS-LD-LKEKMKSPSKEPNK-----DPIKPPSKAQVV  421
            +V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVV
Sbjct  47   EVVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVV  106

Query  422  GWPPVRNYRKNIMA  463
            GWPPVR++RKN++A
Sbjct  107  GWPPVRSFRKNMLA  120



>ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-like [Elaeis guineensis]
Length=251

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 59/86 (69%), Gaps = 13/86 (15%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSS---LDLKEKMK-SPSKEPN-----KDPIKPPS-KA  412
            K +GKRGFSET+DLKL L + ADS    ++  EKMK SP  + N      DP KPP+ KA
Sbjct  37   KNSGKRGFSETIDLKLKLHTVADSKEVVMEASEKMKRSPPSQNNILTCTNDPEKPPAPKA  96

Query  413  QVVGWPPVRNYRKNIMAX---KGSPE  481
            QVVGWPPVR++RKN+MA    KGS E
Sbjct  97   QVVGWPPVRSFRKNMMASHSDKGSKE  122



>ref|XP_006420094.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 ref|XP_006489503.1| PREDICTED: auxin-responsive protein IAA14-like [Citrus sinensis]
 gb|ESR33334.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 gb|KDO53918.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=232

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 54/73 (74%), Gaps = 7/73 (10%)
 Frame = +2

Query  263  KVTGKRGFSET--VDLKLNLQSAADSSLDLKEKMKSP---SKEPNKDPIKPPS-KAQVVG  424
            K + KRGF ET  +DLKLNLQS  +SS+DL E  K+P   +K  +KDP KP + KAQVVG
Sbjct  40   KASNKRGFCETAVIDLKLNLQSK-ESSVDLNENFKNPPSNNKNHDKDPAKPSANKAQVVG  98

Query  425  WPPVRNYRKNIMA  463
            WPPVR+YRKN MA
Sbjct  99   WPPVRSYRKNAMA  111



>gb|KJB11141.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
 gb|KJB11144.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=253

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 7/74 (9%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSS-LD-LKEKMKSPSKEPNK-----DPIKPPSKAQVV  421
            +V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVV
Sbjct  47   EVVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVV  106

Query  422  GWPPVRNYRKNIMA  463
            GWPPVR++RKN++A
Sbjct  107  GWPPVRSFRKNMLA  120



>ref|XP_007050422.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOX94579.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=260

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 51/73 (70%), Gaps = 5/73 (7%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS--PSKEPNKDPIKPPSKAQVVGWPPV  436
            +V  KRGFSETVDLKLNL S   S +D  EK K+  P      DP KPP+KAQVVGWPPV
Sbjct  92   EVARKRGFSETVDLKLNLSSKESSGVDPNEKEKNLLPCA---TDPAKPPAKAQVVGWPPV  148

Query  437  RNYRKNIMAXKGS  475
            R++RKN+ A + S
Sbjct  149  RSFRKNMFATQKS  161



>emb|CAN63268.1| hypothetical protein VITISV_013635 [Vitis vinifera]
 emb|CBI17932.3| unnamed protein product [Vitis vinifera]
Length=235

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 73/105 (70%), Gaps = 15/105 (14%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  370
            LNL+ATEL LGLPGG     SE  +V  KRGFSETVDLKLNL S  ++ +D   K+KS  
Sbjct  11   LNLEATELRLGLPGG-----SEGSEVVRKRGFSETVDLKLNL-SGKEAGVD-DNKVKSLQ  63

Query  371  KEPNK-------DPIKPPSKAQVVGWPPVRNYRKNIMA-XKGSPE  481
            KE +K       DP +PP+KAQVVGWPPVR++RKN++A  KG  E
Sbjct  64   KEKSKSLLPCGNDPARPPAKAQVVGWPPVRSFRKNMLAGQKGGSE  108



>emb|CDY15493.1| BnaA08g27770D [Brassica napus]
Length=229

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 63/97 (65%), Gaps = 9/97 (9%)
 Frame = +2

Query  188  GLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADS-----SLDLKE  352
            GLNL+ TELCLGLPG     ++ S     KRGFSETVDLKLNL +  +S     S D+  
Sbjct  6    GLNLRETELCLGLPG----GDTASPLTGTKRGFSETVDLKLNLNNEPESKEGSKSHDVVS  61

Query  353  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  463
             +        KDP KPP+KAQVVGWPPVR+YRKN+M 
Sbjct  62   AISKEKSSCTKDPTKPPAKAQVVGWPPVRSYRKNVMG  98



>ref|XP_011079949.1| PREDICTED: auxin-induced protein AUX28-like [Sesamum indicum]
Length=244

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 8/71 (11%)
 Frame = +2

Query  272  GKRGFSETVDLKLNLQSAADSSLD---LKEKMKSPSKE----PNKDPIKPPSKAQVVGWP  430
            GKRG+ ETVDLKLNL +    +LD   LKEK  S  K     PN D +KPP+KAQVVGWP
Sbjct  39   GKRGYEETVDLKLNLSTKDVGNLDQSDLKEKTLSKEKNLLPCPN-DSVKPPAKAQVVGWP  97

Query  431  PVRNYRKNIMA  463
            PVR++RKN+MA
Sbjct  98   PVRSFRKNVMA  108



>ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
 gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
Length=305

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 5/72 (7%)
 Frame = +2

Query  266  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS--PSKEPNKDPIKPPSKAQVVGWPPVR  439
            V  KRGFSETVDLKLNL S   S +D  EK K+  P      DP KPP+KAQVVGWPPVR
Sbjct  106  VARKRGFSETVDLKLNLSSKESSGVDPNEKEKNLLPCAT---DPAKPPAKAQVVGWPPVR  162

Query  440  NYRKNIMAXKGS  475
            ++RKN+ A + S
Sbjct  163  SFRKNMFATQKS  174



>gb|EPS64756.1| hypothetical protein M569_10024, partial [Genlisea aurea]
Length=214

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 53/75 (71%), Gaps = 6/75 (8%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKE----PNKDPIKPPSKAQVVGWP  430
            KVTGKRGF +TVDLKL LQS  D S   +E + +PS +    P K   KPPSKAQVVGWP
Sbjct  14   KVTGKRGFFQTVDLKLKLQS--DQSDLEEENLTTPSSDKPHLPPKHLSKPPSKAQVVGWP  71

Query  431  PVRNYRKNIMAXKGS  475
            PVR++RKN++  + S
Sbjct  72   PVRSFRKNVICNRKS  86



>gb|KJB11142.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
 gb|KJB11143.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=227

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 7/74 (9%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSS-LD-LKEKMKSPSKEPNK-----DPIKPPSKAQVV  421
            +V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVV
Sbjct  47   EVVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVV  106

Query  422  GWPPVRNYRKNIMA  463
            GWPPVR++RKN++A
Sbjct  107  GWPPVRSFRKNMLA  120



>ref|XP_009118658.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=228

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 55/77 (71%), Gaps = 6/77 (8%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGW  427
            VTG KRGFSETVDLKLNL +  +S+   K  + + S SKE +   KDP KPP+KAQVVGW
Sbjct  27   VTGTKRGFSETVDLKLNLNNEPESNEGSKTHDVVTSVSKEKSSSPKDPAKPPAKAQVVGW  86

Query  428  PPVRNYRKNIMAXKGSP  478
            PPVR+YRKN+M     P
Sbjct  87   PPVRSYRKNVMGSCQKP  103



>ref|XP_010551700.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=234

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +2

Query  266  VTGKRGFSETVDLKLNLQSAADSSL-DLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRN  442
            V  KRGFSETVDLKLNLQ+  +  + DL            KD  KPP+KAQVVGWPPVRN
Sbjct  38   VGNKRGFSETVDLKLNLQTNEEGRVVDLNAGDPKNFAGATKDKNKPPAKAQVVGWPPVRN  97

Query  443  YRKNIMAXKGS  475
            YRKN+MA + S
Sbjct  98   YRKNMMAQQKS  108



>ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
 gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
Length=249

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 9/84 (11%)
 Frame = +2

Query  245  NESESL-KVTGKRGFSETVDLKLNLQSAADSSL--------DLKEKMKSPSKEPNKDPIK  397
            NE ES  K  GKR FSETVDLKLNL ++ DS+L        ++KEK  +     + DP K
Sbjct  32   NEVESTNKNNGKRVFSETVDLKLNLSNSKDSTLMDNINQVDNMKEKKNNIVVPSSNDPAK  91

Query  398  PPSKAQVVGWPPVRNYRKNIMAXK  469
             P+KAQVVGWPPVR++RKN+M  +
Sbjct  92   SPAKAQVVGWPPVRSFRKNVMTVQ  115



>emb|CDY32537.1| BnaA09g50590D [Brassica napus]
Length=228

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 55/77 (71%), Gaps = 6/77 (8%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGW  427
            VTG KRGFSETVDLKLNL +  +S+   K  + + S SKE +   KDP KPP+KAQVVGW
Sbjct  27   VTGTKRGFSETVDLKLNLNNEPESNEGSKTHDVVTSVSKEKSSSPKDPAKPPAKAQVVGW  86

Query  428  PPVRNYRKNIMAXKGSP  478
            PPVR+YRKN+M     P
Sbjct  87   PPVRSYRKNVMGSCQKP  103



>ref|XP_009111119.1| PREDICTED: auxin-responsive protein IAA17 [Brassica rapa]
Length=229

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 65/98 (66%), Gaps = 11/98 (11%)
 Frame = +2

Query  188  GLNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADS-----SLDLK  349
            GLNL+ TELCLGLPGG   +      VTG KRGFSETVDLKLNL +  +S     S D+ 
Sbjct  6    GLNLRETELCLGLPGGDTASP-----VTGTKRGFSETVDLKLNLNNEPESKEGSKSHDVV  60

Query  350  EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  463
              +        KDP KPP+KAQVVGWPPVR+YRKN+M 
Sbjct  61   SAISKEKSSCPKDPTKPPAKAQVVGWPPVRSYRKNVMG  98



>ref|NP_171921.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 sp|P93830.2|IAA17_ARATH RecName: Full=Auxin-responsive protein IAA17; AltName: Full=Auxin 
response 3; AltName: Full=Indoleacetic acid-induced protein 
17 [Arabidopsis thaliana]
 gb|AAG53997.1|AF336916_1 auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAB84354.1| IAA17 [Arabidopsis thaliana]
 gb|AAC39439.1| IAA17/AXR3 protein [Arabidopsis thaliana]
 gb|AAB70451.2| Identical to Arabidopsis gb|AF040632 and gb|U49073 IAA17/AXR3 
gene. ESTs gb|H36782 and gb|F14074 come from this gene [Arabidopsis 
thaliana]
 gb|AAL49831.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAM51258.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AEE27674.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 gb|AGZ13682.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17]
 gb|AGZ59820.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17-spo5DSR]
Length=229

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 53/87 (61%), Gaps = 20/87 (23%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  412
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  81

Query  413  QVVGWPPVRNYRKNIMA----XKGSPE  481
            QVVGWPPVR+YRKN+M       G PE
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSGGPE  108



>gb|AAM64837.1| putative auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
Length=228

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 53/87 (61%), Gaps = 20/87 (23%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  412
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  26   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  80

Query  413  QVVGWPPVRNYRKNIMA----XKGSPE  481
            QVVGWPPVR+YRKN+M       G PE
Sbjct  81   QVVGWPPVRSYRKNVMVSCQKSSGGPE  107



>ref|XP_010457463.1| PREDICTED: auxin-responsive protein IAA17 [Camelina sativa]
Length=229

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 16/77 (21%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  412
            VTG KRGFSETVDLKLNL +  ++          + D K+K   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHGVVTFDSKDKSSCP-----KDPAKPPAKA  81

Query  413  QVVGWPPVRNYRKNIMA  463
            QVVGWPPVR+YRKN+M 
Sbjct  82   QVVGWPPVRSYRKNVMV  98



>ref|XP_009119323.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=224

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGWPPVR  439
            KRGFSETVDLKLNL +  +S    K  + + S SKE N   KDP KPP+KAQVVGWPPVR
Sbjct  26   KRGFSETVDLKLNLNNEPESKEVSKTHDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVR  85

Query  440  NYRKNIMA  463
            +YRKN+M 
Sbjct  86   SYRKNVMG  93



>ref|XP_010483317.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=229

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 16/77 (21%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  412
            VTG KRGFSETVDLKLNL +  ++          + D K+K   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHGVVTFDSKDKSSCP-----KDPAKPPAKA  81

Query  413  QVVGWPPVRNYRKNIMA  463
            QVVGWPPVR+YRKN+M 
Sbjct  82   QVVGWPPVRSYRKNVMV  98



>emb|CDX89832.1| BnaA10g02500D [Brassica napus]
Length=224

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGWPPVR  439
            KRGFSETVDLKLNL +  +S    K  + + S SKE N   KDP KPP+KAQVVGWPPVR
Sbjct  26   KRGFSETVDLKLNLNNEPESKEVSKTHDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVR  85

Query  440  NYRKNIMA  463
            +YRKN+M 
Sbjct  86   SYRKNVMG  93



>ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis]
Length=240

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  245  NESE-SLKVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPNKDPIKPPSKAQV  418
            NE E + K  GKR FSETVDLKLNL S+ DS++D + +KMK        DP KPP+KAQV
Sbjct  33   NEGEMTSKNNGKRVFSETVDLKLNL-SSKDSTVDNQVDKMKEKKNIAPTDPSKPPAKAQV  91

Query  419  VGWPPVRNYRKNIM  460
            VGWPPVR++RKN++
Sbjct  92   VGWPPVRSFRKNVL  105



>ref|XP_010475075.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=230

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 53/82 (65%), Gaps = 15/82 (18%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  412
            VTG KRGFSETVDLKLNL +  ++          + D K+K+ S  K    DP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHGVVTFDSKDKISSCPK----DPAKPPAKA  82

Query  413  QVVGWPPVRNYRKNIMAXKGSP  478
            QVVGWPPVR+YRKN+M     P
Sbjct  83   QVVGWPPVRSYRKNVMVSCQKP  104



>gb|KDP21369.1| hypothetical protein JCGZ_21840 [Jatropha curcas]
Length=251

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSS-LDLKEKMKSPSKEPN---KDPIKPPSKAQVVGWPPVRN  442
            KRGFS+TVDL+LN+ S  +S+  D  +K K+  +E N    DP KPP+KAQVVGWPPVR+
Sbjct  39   KRGFSQTVDLELNISSKEESAAFDPNQKTKNLPREKNLLAADPAKPPAKAQVVGWPPVRS  98

Query  443  YRKNIMA  463
            YRKN++A
Sbjct  99   YRKNMLA  105



>ref|XP_011026048.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQVVGWPPVRNY  445
            KRGFSETVDLKL L S    +    EK +S  +E N    DP KPP+KAQVVGWPPVR++
Sbjct  34   KRGFSETVDLKLKLSSKERGAGPNHEKTRSLQREKNILATDPAKPPAKAQVVGWPPVRSF  93

Query  446  RKNIMAXKGS  475
            RKN++A + S
Sbjct  94   RKNMLAVQKS  103



>ref|NP_001288939.1| auxin-responsive protein IAA16 [Brassica rapa]
 gb|ABV89663.1| indoleacetic acid-induced protein 16 [Brassica rapa]
Length=231

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 17/75 (23%)
 Frame = +2

Query  257  SLKVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQV  418
            ++K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQV
Sbjct  23   AMKNNGKRGFSETVDLKLNLSSTALDSVSGVDLENMKEKV-----------VKPPAKAQV  71

Query  419  VGWPPVRNYRKNIMA  463
            VGWPPVR++RKN+M+
Sbjct  72   VGWPPVRSFRKNVMS  86



>ref|XP_006838867.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
 gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
Length=238

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 69/112 (62%), Gaps = 17/112 (15%)
 Frame = +2

Query  173  LAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAA--------  328
            +A    LN +ATEL LG PG    N   + K  GKRGFSETVDLKLNL   A        
Sbjct  1    MATDLSLNFEATELRLGPPG----NGDSAGKGIGKRGFSETVDLKLNLMEPAPLDVPAST  56

Query  329  --DSSLDLKEKMKSPSKEPNKDPIKPPS-KAQVVGWPPVRNYRKNIMAXKGS  475
              D+ +DL EK++  +     DP KPP+ KAQVVGWPPVR++R+N++A + S
Sbjct  57   VKDTGVDLTEKLRGSNAV--ADPAKPPAHKAQVVGWPPVRSFRRNMLATQSS  106



>emb|CDY50750.1| BnaAnng10570D [Brassica napus]
Length=291

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 17/75 (23%)
 Frame = +2

Query  257  SLKVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQV  418
            ++K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQV
Sbjct  83   AMKNNGKRGFSETVDLKLNLSSTALDSVSGVDLENMKEKV-----------VKPPAKAQV  131

Query  419  VGWPPVRNYRKNIMA  463
            VGWPPVR++RKN+M+
Sbjct  132  VGWPPVRSFRKNVMS  146



>emb|CDY10068.1| BnaC08g43830D [Brassica napus]
Length=228

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 54/77 (70%), Gaps = 6/77 (8%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGW  427
            VTG KRGFSETVDLKLNL +  + +   K  + + S SKE +   KDP KPP+KAQVVGW
Sbjct  27   VTGTKRGFSETVDLKLNLNNEPEINEGSKPHDVVTSVSKEKSSSPKDPAKPPAKAQVVGW  86

Query  428  PPVRNYRKNIMAXKGSP  478
            PPVR+YRKN+M     P
Sbjct  87   PPVRSYRKNVMGSYQKP  103



>ref|XP_002884465.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60724.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 17/73 (23%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  424
            K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQVVG
Sbjct  25   KYNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMKEKV-----------VKPPAKAQVVG  73

Query  425  WPPVRNYRKNIMA  463
            WPPVR++RKN+M+
Sbjct  74   WPPVRSFRKNVMS  86



>emb|CDY18214.1| BnaC05g02370D [Brassica napus]
Length=224

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPNK---DPIKPPSKAQVVGWPPVR  439
            KRGFSETVDLKLNL +  +S    K  + + S SK+ NK   DP KPP+KAQVVGWPPVR
Sbjct  26   KRGFSETVDLKLNLNNEPESKEVSKTHDVVISVSKQKNKCPKDPTKPPAKAQVVGWPPVR  85

Query  440  NYRKNIMA  463
            +YRKN+M 
Sbjct  86   SYRKNVMG  93



>emb|CDY41894.1| BnaC05g47100D [Brassica napus]
Length=231

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 17/75 (23%)
 Frame = +2

Query  257  SLKVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQV  418
            ++K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQV
Sbjct  23   AMKNNGKRGFSETVDLKLNLSSTAMDSVSGVDLENMKEKV-----------VKPPAKAQV  71

Query  419  VGWPPVRNYRKNIMA  463
            VGWPPVR++RKN+M+
Sbjct  72   VGWPPVRSFRKNVMS  86



>ref|XP_002520980.1| Auxin-induced protein AUX28, putative [Ricinus communis]
 gb|EEF41397.1| Auxin-induced protein AUX28, putative [Ricinus communis]
Length=244

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 5/75 (7%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN----KDPIKPPSKAQVVGWP  430
            +V  KRGFSETVDLKLNL S+ +  +D  +  K+ S+E N     DP KPP+KAQVVGWP
Sbjct  41   EVARKRGFSETVDLKLNL-SSKEPGIDPNDNTKTISRENNLLSADDPAKPPAKAQVVGWP  99

Query  431  PVRNYRKNIMAXKGS  475
            PVR++RK+++  + S
Sbjct  100  PVRSFRKHMLTVQKS  114



>ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|EEE81348.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|AFZ78622.1| hypothetical protein [Populus tomentosa]
Length=237

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQVVGWPPVRNY  445
            KRGFSETVDLKL L S    +    EK  S  +E N    DP KPP+KAQVVGWPPVR++
Sbjct  34   KRGFSETVDLKLKLSSKESGADPNHEKTSSLQREKNLLATDPAKPPAKAQVVGWPPVRSF  93

Query  446  RKNIMAXKGS  475
            RKN++A + S
Sbjct  94   RKNMLAVQKS  103



>ref|XP_007147174.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
 gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
Length=272

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 52/87 (60%), Gaps = 17/87 (20%)
 Frame = +2

Query  251  SESLKVTGKRGFSET----VDLKLNLQS-------------AADSSLDLKEKMKSPSKEP  379
            + S   TGKRGFS+T    VDLKLNL S             A D++        +PS  P
Sbjct  41   TSSASFTGKRGFSDTTTASVDLKLNLSSTSNNVSATPSSDMAKDNTASAAANTTTPSSPP  100

Query  380  NKDPIKPPSKAQVVGWPPVRNYRKNIM  460
             KDP KPP+KAQVVGWPPVR++RKNI+
Sbjct  101  VKDPAKPPAKAQVVGWPPVRSFRKNIV  127



>ref|XP_009124981.1| PREDICTED: auxin-responsive protein IAA16-like [Brassica rapa]
 emb|CDY21111.1| BnaA01g33420D [Brassica napus]
Length=236

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 17/70 (24%)
 Frame = +2

Query  272  GKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVGWPP  433
            GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQVVGWPP
Sbjct  28   GKRGFSETVDLKLNLSSTAMGSVSEVDLVNMKEKV-----------VKPPAKAQVVGWPP  76

Query  434  VRNYRKNIMA  463
            VR++RKN+M+
Sbjct  77   VRSFRKNVMS  86



>emb|CDY30017.1| BnaC01g39910D [Brassica napus]
Length=237

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 17/73 (23%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  424
            K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTAMDSVSELDLVNMKEKV-----------VKPPAKAQVVG  73

Query  425  WPPVRNYRKNIMA  463
            WPPVR++RKN+M+
Sbjct  74   WPPVRSFRKNVMS  86



>ref|XP_004156465.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA16-like 
[Cucumis sativus]
Length=239

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 6/69 (9%)
 Frame = +2

Query  266  VTGKRGFSETVDLKLNLQSAADSS-----LDLKEKMKSPSKEPNKDPIKPPSKAQVVGWP  430
            + GKRGF ETVDLKLNL S   S+      +  +++K+ S++PN D  KPPSKAQVVGWP
Sbjct  37   LAGKRGFMETVDLKLNLASKWASAKGRGPTEFGKRLKTSSQQPN-DXAKPPSKAQVVGWP  95

Query  431  PVRNYRKNI  457
            PVR+ RKN+
Sbjct  96   PVRSSRKNL  104



>ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
 sp|O24407.1|IAA16_ARATH RecName: Full=Auxin-responsive protein IAA16; AltName: Full=Indoleacetic 
acid-induced protein 16 [Arabidopsis thaliana]
 gb|AAF04899.1|AC011437_14 auxin-induced protein [Arabidopsis thaliana]
 gb|AAG48764.1|AF332400_1 auxin-induced protein IAA16 [Arabidopsis thaliana]
 gb|AAK53004.1|AF375420_1 AT3g04730/F7O18_22 [Arabidopsis thaliana]
 gb|AAB84353.1| IAA16 [Arabidopsis thaliana]
 gb|AAM64751.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AAN38694.1| At3g04730/F7O18_22 [Arabidopsis thaliana]
 dbj|BAF01307.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AEE74127.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
Length=236

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 17/73 (23%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  424
            K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMKEKV-----------VKPPAKAQVVG  73

Query  425  WPPVRNYRKNIMA  463
            WPPVR++RKN+M+
Sbjct  74   WPPVRSFRKNVMS  86



>emb|CDY63072.1| BnaCnng41350D [Brassica napus]
Length=398

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 65/103 (63%), Gaps = 21/103 (20%)
 Frame = +2

Query  188  GLNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADS----------  334
            GLNL+ TELCLGLPGG   +      VTG KRGFSETVDLKLNL S  +S          
Sbjct  170  GLNLRETELCLGLPGGDTAS-----PVTGTKRGFSETVDLKLNLNSEPESKEGSKSHDVV  224

Query  335  SLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  463
            S   KEK   P     KDP KP +KAQVVGWPPVR+YRKN+M 
Sbjct  225  SAVFKEKSSCP-----KDPTKPLAKAQVVGWPPVRSYRKNVMG  262



>gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum]
Length=240

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 55/77 (71%), Gaps = 3/77 (4%)
 Frame = +2

Query  245  NESE-SLKVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPNKDPIKPPSKAQV  418
            NE E + K  GKR FSETVDLKLNL S+ DS++D + + +K        DP KPP+KAQV
Sbjct  33   NEGEMTSKNNGKRVFSETVDLKLNL-SSKDSTVDNQVDNIKEKKNIAPTDPAKPPAKAQV  91

Query  419  VGWPPVRNYRKNIMAXK  469
            VGWPPVR++RKN++  +
Sbjct  92   VGWPPVRSFRKNVLTVQ  108



>ref|XP_008218270.1| PREDICTED: auxin-responsive protein IAA16 [Prunus mume]
Length=256

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 54/86 (63%), Gaps = 12/86 (14%)
 Frame = +2

Query  248  ESESLKVTGKRGFSETVDLKLNLQS---AADSSLDL--------KEKMKSPSKEPNKDPI  394
            + E+ K  GKRGFSETVDLKLN+ S   +AD S D         +EK  +       DP 
Sbjct  37   DGEAAKNNGKRGFSETVDLKLNISSQDQSADRSADQDQQLMELKREKNAAAPAPSANDPS  96

Query  395  KPP-SKAQVVGWPPVRNYRKNIMAXK  469
            KPP SKAQVVGWPPVR++RKNI+  +
Sbjct  97   KPPASKAQVVGWPPVRSFRKNIVTVQ  122



>ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris]
Length=240

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 55/77 (71%), Gaps = 3/77 (4%)
 Frame = +2

Query  245  NESE-SLKVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPNKDPIKPPSKAQV  418
            NE E + K  GKR FSETVDLKLNL S+ DS++D + + +K        DP KPP+KAQV
Sbjct  33   NEGEMTSKNNGKRVFSETVDLKLNL-SSKDSTVDNQVDNIKEKKNIAPTDPAKPPAKAQV  91

Query  419  VGWPPVRNYRKNIMAXK  469
            VGWPPVR++RKN++  +
Sbjct  92   VGWPPVRSFRKNVLTVQ  108



>ref|XP_006408158.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49611.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=223

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 17/70 (24%)
 Frame = +2

Query  272  GKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVGWPP  433
            GKRGFSETVDLKLNL S A  S+      +LKEK+           +KPP+K QVVGWPP
Sbjct  28   GKRGFSETVDLKLNLSSTALDSVSEVDIQNLKEKV-----------VKPPAKTQVVGWPP  76

Query  434  VRNYRKNIMA  463
            VR++RKN+M+
Sbjct  77   VRSFRKNVMS  86



>ref|XP_006408159.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49612.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=234

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 17/70 (24%)
 Frame = +2

Query  272  GKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVGWPP  433
            GKRGFSETVDLKLNL S A  S+      +LKEK+           +KPP+K QVVGWPP
Sbjct  28   GKRGFSETVDLKLNLSSTALDSVSEVDIQNLKEKV-----------VKPPAKTQVVGWPP  76

Query  434  VRNYRKNIMA  463
            VR++RKN+M+
Sbjct  77   VRSFRKNVMS  86



>emb|CAC84711.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=229

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  454
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTRREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  455  IMAXKGS  475
            ++A + S
Sbjct  96   MLAVQKS  102



>ref|XP_010917602.1| PREDICTED: auxin-responsive protein IAA30 isoform X2 [Elaeis 
guineensis]
Length=238

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 7/74 (9%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPN-----KDPIKPPS-KAQVV  421
            + T KRGFSET+DLKL LQ+     ++ + EKMK  + + N      DP KPP+ KAQVV
Sbjct  30   EATKKRGFSETIDLKLKLQTVDSKDIEAEAEKMKRSASQKNLLACSNDPEKPPAPKAQVV  89

Query  422  GWPPVRNYRKNIMA  463
            GWPPVR++RKNIM+
Sbjct  90   GWPPVRSFRKNIMS  103



>ref|XP_010463960.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 64/91 (70%), Gaps = 10/91 (11%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  370
            +N +ATEL LGLPGG  G E  S+K  GKRGFSETVDLKLNL S   S  DL E MK   
Sbjct  2    INFEATELRLGLPGGSHGGEM-SVKNNGKRGFSETVDLKLNLSSTV-SEADL-ENMK---  55

Query  371  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  463
                +  +KPP+K QVVGWPPVR++RKN+M+
Sbjct  56   ----EKVVKPPAKTQVVGWPPVRSFRKNVMS  82



>ref|XP_010917600.1| PREDICTED: auxin-responsive protein IAA30 isoform X1 [Elaeis 
guineensis]
Length=246

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 51/72 (71%), Gaps = 7/72 (10%)
 Frame = +2

Query  269  TGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPN-----KDPIKPPS-KAQVVGW  427
            T KRGFSET+DLKL LQ+     ++ + EKMK  + + N      DP KPP+ KAQVVGW
Sbjct  32   TKKRGFSETIDLKLKLQTVDSKDIEAEAEKMKRSASQKNLLACSNDPEKPPAPKAQVVGW  91

Query  428  PPVRNYRKNIMA  463
            PPVR++RKNIM+
Sbjct  92   PPVRSFRKNIMS  103



>ref|XP_006418149.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 dbj|BAJ33922.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36502.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=226

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 52/78 (67%), Gaps = 17/78 (22%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSA-----ADSSLDL------KEKMKSPSKEPNKDPIKPPSK  409
            VTG KRGFSETVDLKLNL +        ++ D+      KEK  SP     KDP KPP+K
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGCTTHDVVTNSVSKEKSSSP-----KDPAKPPAK  81

Query  410  AQVVGWPPVRNYRKNIMA  463
            AQVVGWPPVR+YRKN++ 
Sbjct  82   AQVVGWPPVRSYRKNVLV  99



>gb|AAC39440.1| IAA17/AXR3-1 protein [Arabidopsis thaliana]
Length=229

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 52/87 (60%), Gaps = 20/87 (23%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  412
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  81

Query  413  QVVGWPPVRNYRKNIMA----XKGSPE  481
            QVVGWP VR+YRKN+M       G PE
Sbjct  82   QVVGWPLVRSYRKNVMVSCQKSSGGPE  108



>ref|XP_010485858.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 64/91 (70%), Gaps = 10/91 (11%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  370
            +N +ATEL LGLPGG  G E  S+K  GKRGFSETVDLKLNL S   S  DL E MK   
Sbjct  2    INFEATELRLGLPGGSHGGEM-SVKNNGKRGFSETVDLKLNLSSTV-SEADL-ENMK---  55

Query  371  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  463
                +  +KPP+K QVVGWPPVR++RKN+M+
Sbjct  56   ----EKVVKPPAKTQVVGWPPVRSFRKNVMS  82



>ref|XP_010418365.1| PREDICTED: auxin-responsive protein IAA16 [Camelina sativa]
Length=232

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 64/91 (70%), Gaps = 10/91 (11%)
 Frame = +2

Query  191  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  370
            +N +ATEL LGLPGG  G E  S+K  GKRGFSETVDLKLNL S   S  DL E MK   
Sbjct  2    INFEATELRLGLPGGSHGGEM-SVKNNGKRGFSETVDLKLNLSSTV-SEADL-ENMK---  55

Query  371  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA  463
                +  +KPP+K QVVGWPPVR++RKN+M+
Sbjct  56   ----EKVVKPPAKTQVVGWPPVRSFRKNVMS  82



>ref|XP_002306817.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
 gb|EEE93813.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
Length=229

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  454
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  455  IMAXKGS  475
            ++A + S
Sbjct  96   MLAVQKS  102



>ref|XP_011042427.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  454
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  455  IMAXKGS  475
            ++A + S
Sbjct  96   MLAVQKS  102



>gb|KDO68557.1| hypothetical protein CISIN_1g026823mg [Citrus sinensis]
Length=232

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 47/69 (68%), Gaps = 11/69 (16%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPV  436
            KRGFSETVDLKLNL     SS D  EK+KS  KE N        P KPP+K QVVGWPPV
Sbjct  33   KRGFSETVDLKLNL-----SSKDTSEKVKSFQKEKNPLPRATDPPAKPPAKTQVVGWPPV  87

Query  437  RNYRKNIMA  463
            R++RKN++ 
Sbjct  88   RSFRKNMLG  96



>ref|NP_001280973.1| auxin-responsive protein IAA16 [Malus domestica]
 gb|ABI36494.1| AUX/IAA16 B [Malus domestica]
Length=251

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 57/82 (70%), Gaps = 9/82 (11%)
 Frame = +2

Query  248  ESESLKVTGKRGFSETVDLKLNL----QSAADSS--LDLK-EKMKSPSKEPNKDPIKP-P  403
            + E+ K TGKRGF+ETVDLKLN+    QSA D    +D+K EK  +P    N DP KP  
Sbjct  38   DGEASKNTGKRGFAETVDLKLNISSEDQSAGDEDQVVDMKKEKDVAPVPRSN-DPTKPHA  96

Query  404  SKAQVVGWPPVRNYRKNIMAXK  469
            +KAQVVGWPPVR++R NI+A +
Sbjct  97   AKAQVVGWPPVRSFRXNILAVQ  118



>ref|XP_009364490.1| PREDICTED: auxin-responsive protein IAA16 [Pyrus x bretschneideri]
Length=252

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 9/82 (11%)
 Frame = +2

Query  248  ESESLKVTGKRGFSETVDLKLNLQSAADSSLD-------LKEKMKSPSKEPNKDPIKPPS  406
            + E+ K TGKRGF+ETVDLKLN+ S   S+ D        KEK  +P    N +P KPP+
Sbjct  38   DGEASKNTGKRGFAETVDLKLNISSEDQSAGDEDQVEEMKKEKNVAPVPRSN-NPTKPPA  96

Query  407  -KAQVVGWPPVRNYRKNIMAXK  469
             KAQ VGWPPVR++RKNI+A +
Sbjct  97   AKAQAVGWPPVRSFRKNILAVQ  118



>ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|ERP61483.1| auxin-induced protein aux28 [Populus trichocarpa]
Length=237

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  454
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  455  IMAXKGS  475
            ++A + S
Sbjct  96   MLAVQKS  102



>gb|EPS60474.1| hypothetical protein M569_14329, partial [Genlisea aurea]
Length=212

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = +2

Query  269  TGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYR  448
             GKRGF+ETVDLKLNL +A + +LD KEK K  + + + D  KPP KAQVVGWPPVR +R
Sbjct  28   CGKRGFAETVDLKLNL-AAKEMNLD-KEKEKKKNLQISADSSKPPMKAQVVGWPPVRAFR  85

Query  449  KN-IMAXKGSPE  481
            +N I + K S E
Sbjct  86   RNAICSQKKSTE  97



>ref|XP_008788131.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 55/78 (71%), Gaps = 12/78 (15%)
 Frame = +2

Query  284  FSETVDLKLNLQSAADSS---LDLKEKMK-SPSKE----PNKDPIKPPS-KAQVVGWPPV  436
            FSET+DLKL LQ+ ADS    +++ EKMK SPS +       DP KPP+ KAQVVGWPPV
Sbjct  35   FSETIDLKLKLQTVADSKEVVMEVSEKMKRSPSHKNILPCTNDPEKPPAPKAQVVGWPPV  94

Query  437  RNYRKNIMAX---KGSPE  481
            R++RKN+MA    KGS E
Sbjct  95   RSFRKNMMATHSDKGSKE  112



>gb|KDO48908.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=171

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +2

Query  275  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  446  RKNIMAXK  469
            RKNIMA +
Sbjct  102  RKNIMAVQ  109



>gb|KFK37887.1| hypothetical protein AALP_AA3G042100 [Arabis alpina]
Length=232

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 49/67 (73%), Gaps = 9/67 (13%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRN  442
            K  GKRGFSETVDLKLNL S   S ++L E MK       +  +KPP+KAQVVGWPPVR+
Sbjct  25   KNNGKRGFSETVDLKLNLSSTV-SEVEL-ENMK-------EKVVKPPAKAQVVGWPPVRS  75

Query  443  YRKNIMA  463
            +RKN+M+
Sbjct  76   FRKNVMS  82



>ref|XP_006471686.1| PREDICTED: auxin-responsive protein IAA16-like isoform X3 [Citrus 
sinensis]
Length=217

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +2

Query  275  KRGFSETV-DLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            KRGF++TV DLKLNL +     +D+  K K KS S     D  KPP+KAQVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSF  101

Query  446  RKNIMAXK  469
            RKNIMA +
Sbjct  102  RKNIMAVQ  109



>ref|XP_007205640.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
 gb|EMJ06839.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
Length=299

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 53/81 (65%), Gaps = 11/81 (14%)
 Frame = +2

Query  248  ESESLKVTGKRGFSETVDLKLNLQSAADSS---------LDLK-EKMKSPSKEPNKDPIK  397
            + E+ K  GKRGFSETVDLKLN+ S  +++         L+LK EK  +       DP K
Sbjct  81   DGEAAKNNGKRGFSETVDLKLNISSQDETADEDDQDQQLLELKKEKNAAAPAPGANDPSK  140

Query  398  PP-SKAQVVGWPPVRNYRKNI  457
            PP SKAQVVGWPPVR++RKNI
Sbjct  141  PPASKAQVVGWPPVRSFRKNI  161



>ref|XP_006432921.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 gb|ESR46161.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=213

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +2

Query  275  KRGFSETV-DLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            KRGF++TV DLKLNL +     +D+  K K KS S     D  KPP+KAQVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSF  101

Query  446  RKNIMAXK  469
            RKNIMA +
Sbjct  102  RKNIMAVQ  109



>gb|KGN60808.1| hypothetical protein Csa_2G010920 [Cucumis sativus]
Length=237

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 49/64 (77%), Gaps = 4/64 (6%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            KRGF ETVDLKLNL S+  S+ +     E++K+ S++PN D  KPPSKAQVVGWPPVR+ 
Sbjct  40   KRGFMETVDLKLNLASSMASTKEEATNLEEIKTSSQQPN-DFAKPPSKAQVVGWPPVRSS  98

Query  446  RKNI  457
            RKN+
Sbjct  99   RKNL  102



>ref|XP_010923479.1| PREDICTED: auxin-responsive protein IAA30-like isoform X2 [Elaeis 
guineensis]
Length=232

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 9/76 (12%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADS---SLDLKEKMKSPSKEPN-----KDPIKPPS-KAQ  415
            K +GKRGFSET+DLKL L +  DS    +++ +KMK    + N      DP KP + KAQ
Sbjct  37   KNSGKRGFSETIDLKLKLHTVVDSKEVEMEVWDKMKRLPSQKNLLPCTNDPEKPSAPKAQ  96

Query  416  VVGWPPVRNYRKNIMA  463
            VVGWPPVR++RKNI+A
Sbjct  97   VVGWPPVRSFRKNILA  112



>ref|XP_006432923.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471684.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Citrus 
sinensis]
 gb|ESR46163.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=245

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +2

Query  275  KRGFSETV-DLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            KRGF++TV DLKLNL +     +D+  K K KS S     D  KPP+KAQVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSF  101

Query  446  RKNIMAXK  469
            RKNIMA +
Sbjct  102  RKNIMAVQ  109



>ref|XP_009398568.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 52/78 (67%), Gaps = 6/78 (8%)
 Frame = +2

Query  254  ESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMK-SPSKE----PNKDPIKPPS-KAQ  415
            ++ K +GKR F ETVDLKL LQ+  D      EKMK SPS +       DP +P + KAQ
Sbjct  35   DATKNSGKRAFEETVDLKLKLQTTVDVEEVAAEKMKRSPSHKNVAASATDPERPRAPKAQ  94

Query  416  VVGWPPVRNYRKNIMAXK  469
            VVGWPPVR+YRKNI+A +
Sbjct  95   VVGWPPVRSYRKNILAVQ  112



>ref|XP_010923478.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Elaeis 
guineensis]
Length=250

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 9/76 (12%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADS---SLDLKEKMKSPSKEPN-----KDPIKPPS-KAQ  415
            K +GKRGFSET+DLKL L +  DS    +++ +KMK    + N      DP KP + KAQ
Sbjct  37   KNSGKRGFSETIDLKLKLHTVVDSKEVEMEVWDKMKRLPSQKNLLPCTNDPEKPSAPKAQ  96

Query  416  VVGWPPVRNYRKNIMA  463
            VVGWPPVR++RKNI+A
Sbjct  97   VVGWPPVRSFRKNILA  112



>ref|XP_006432922.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471685.1| PREDICTED: auxin-responsive protein IAA16-like isoform X2 [Citrus 
sinensis]
 gb|ESR46162.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=221

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +2

Query  275  KRGFSETV-DLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            KRGF++TV DLKLNL +     +D+  K K KS S     D  KPP+KAQVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSF  101

Query  446  RKNIMAXK  469
            RKNIMA +
Sbjct  102  RKNIMAVQ  109



>ref|XP_006443921.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 ref|XP_006479598.1| PREDICTED: auxin-induced protein AUX28-like [Citrus sinensis]
 gb|ESR57161.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=232

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 47/69 (68%), Gaps = 11/69 (16%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPV  436
            KRGFSETVDLKLNL     SS D  EK+KS  KE +        P KPP+K QVVGWPPV
Sbjct  33   KRGFSETVDLKLNL-----SSKDTSEKVKSFQKEKHPLPRATDPPAKPPAKTQVVGWPPV  87

Query  437  RNYRKNIMA  463
            R++RKN++ 
Sbjct  88   RSFRKNMLG  96



>gb|KDO48906.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=217

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +2

Query  275  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  446  RKNIMAXK  469
            RKNIMA +
Sbjct  102  RKNIMAVQ  109



>ref|XP_006443920.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 gb|ESR57160.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=226

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 47/69 (68%), Gaps = 11/69 (16%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPV  436
            KRGFSETVDLKLNL     SS D  EK+KS  KE +        P KPP+K QVVGWPPV
Sbjct  33   KRGFSETVDLKLNL-----SSKDTSEKVKSFQKEKHPLPRATDPPAKPPAKTQVVGWPPV  87

Query  437  RNYRKNIMA  463
            R++RKN++ 
Sbjct  88   RSFRKNMLG  96



>gb|KDO48907.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=213

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +2

Query  275  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  446  RKNIMAXK  469
            RKNIMA +
Sbjct  102  RKNIMAVQ  109



>dbj|BAJ34138.1| unnamed protein product [Thellungiella halophila]
Length=234

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 17/70 (24%)
 Frame = +2

Query  272  GKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVGWPP  433
            GKRGFSETVDLKLNL S A  S+      +LK K+           +KPP+K QVVGWPP
Sbjct  28   GKRGFSETVDLKLNLSSTALDSVSEVDIQNLKGKV-----------VKPPAKTQVVGWPP  76

Query  434  VRNYRKNIMA  463
            VR++RKN+M+
Sbjct  77   VRSFRKNVMS  86



>gb|KDO48905.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=245

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +2

Query  275  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  446  RKNIMAXK  469
            RKNIMA +
Sbjct  102  RKNIMAVQ  109



>gb|KDO48904.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=221

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +2

Query  275  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  446  RKNIMAXK  469
            RKNIMA +
Sbjct  102  RKNIMAVQ  109



>ref|XP_008455992.1| PREDICTED: auxin-responsive protein IAA16 isoform X2 [Cucumis 
melo]
Length=231

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            KRGF ETVDLKLNL S+  S+ +     E++KS S++PN D  KPPSK QVVGWPPVR+ 
Sbjct  41   KRGFMETVDLKLNLASSMASAKEEGTNLEEIKSCSQQPN-DFAKPPSKTQVVGWPPVRSS  99

Query  446  RKNI  457
            RKN+
Sbjct  100  RKNL  103



>ref|XP_010679165.1| PREDICTED: auxin-responsive protein IAA14-like [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 52/94 (55%), Gaps = 26/94 (28%)
 Frame = +2

Query  266  VTGKRGFSETVDLKLNL------------------QSAADSSLDLKEKM--------KSP  367
            V  KRGFSETVDLKLN                   Q+A  + LDL +          K  
Sbjct  49   VGNKRGFSETVDLKLNFSTNNNKNDHNNNINSGKEQTATSAPLDLMKNDNKADVSADKEI  108

Query  368  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAXK  469
            S + N D +KPP+KAQVVGWPPVR+YRKN++A +
Sbjct  109  SSKVNADSVKPPAKAQVVGWPPVRSYRKNMLAVQ  142



>ref|XP_008455985.1| PREDICTED: auxin-responsive protein IAA16 isoform X1 [Cucumis 
melo]
Length=236

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  445
            KRGF ETVDLKLNL S+  S+ +     E++KS S++PN D  KPPSK QVVGWPPVR+ 
Sbjct  41   KRGFMETVDLKLNLASSMASAKEEGTNLEEIKSCSQQPN-DFAKPPSKTQVVGWPPVRSS  99

Query  446  RKNI  457
            RKN+
Sbjct  100  RKNL  103



>ref|XP_009413916.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 21/95 (22%)
 Frame = +2

Query  248  ESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNK-------------D  388
            ++E++K +GKRGF+ETVDLKL LQ+     +D+KE +   + E  K             D
Sbjct  25   DAEAVKNSGKRGFAETVDLKLQLQTP----VDVKEAVAEAASEKVKRSVSQKSLVSCGSD  80

Query  389  PIKPPS-KAQVVGWPPVRNYRKNIMAX---KGSPE  481
            P KP + KAQVVGWPPVR++RKNI++    KGS E
Sbjct  81   PEKPSAPKAQVVGWPPVRSFRKNILSVNSEKGSKE  115



>ref|XP_010550916.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA16 
[Tarenaya hassleriana]
Length=212

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 48/67 (72%), Gaps = 8/67 (12%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNLQS-AADS-SLDLKEKMKSPSKEPNKDPIKPPSKAQV  418
            +E ++ K  GKRGFSETVDLKLNL S A DS S+D  EKMK       K  +KPP+K+QV
Sbjct  18   HEEKAAKNNGKRGFSETVDLKLNLSSMATDSGSMDGSEKMKE------KTTVKPPAKSQV  71

Query  419  VGWPPVR  439
            VGWPPVR
Sbjct  72   VGWPPVR  78



>gb|ABD98055.1| auxin-regulated protein [Striga asiatica]
Length=248

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 6/70 (9%)
 Frame = +2

Query  272  GKRGFSETVDLKLNLQSAADSSLDLKE-KMKSPSKEPNKDP-----IKPPSKAQVVGWPP  433
            GKRGF+ETVDLKL L S     LD    + K   KE N  P      +PP+KAQVVGWPP
Sbjct  40   GKRGFAETVDLKLKLSSKEIGDLDRGGLERKDLCKEKNLMPSPTESARPPAKAQVVGWPP  99

Query  434  VRNYRKNIMA  463
            VR++RKN+MA
Sbjct  100  VRSFRKNVMA  109



>ref|XP_006575865.1| PREDICTED: auxin-induced protein AUX28-like [Glycine max]
Length=170

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 13/80 (16%)
 Frame = +2

Query  275  KRGFSET-------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQ  415
            KRGFSET       VDL LNL   ++AA    D +EK K+  KE      DP KPP+KAQ
Sbjct  36   KRGFSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQ  95

Query  416  VVGWPPVRNYRKNIMAXKGS  475
            VVGWPPVR++RKN+ A + S
Sbjct  96   VVGWPPVRSFRKNMFAAQKS  115



>ref|XP_009418923.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=243

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 55/84 (65%), Gaps = 11/84 (13%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS--PSKE-----PNKDPIKPPS-KAQV  418
            K + KRGF+ET+DLKL LQ+  D+   + EK +   PS+         DP KPP+ KAQV
Sbjct  30   KNSCKRGFAETIDLKLKLQTPVDAEEQIIEKARGSLPSQRNLGVFCGSDPEKPPAPKAQV  89

Query  419  VGWPPVRNYRKNIMAX---KGSPE  481
            VGWPPVR++RKNI++    KGS E
Sbjct  90   VGWPPVRSFRKNILSAHSEKGSKE  113



>gb|KFK31703.1| hypothetical protein AALP_AA6G148100 [Arabis alpina]
Length=208

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 6/76 (8%)
 Frame = +2

Query  248  ESESLKVTGKRGFSETVDLKLNL----QSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQ  415
            E+ +     KRG+SETVDLKLNL    ++  + SL  KE   S   + +  P  PP+KAQ
Sbjct  14   ETTATVAGNKRGYSETVDLKLNLNNEPETNKEGSLVSKENTSSICPKDSTKP--PPAKAQ  71

Query  416  VVGWPPVRNYRKNIMA  463
            VVGWPPVR+YRKN+M+
Sbjct  72   VVGWPPVRSYRKNVMS  87



>gb|ACU18407.1| unknown [Glycine max]
Length=246

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 13/80 (16%)
 Frame = +2

Query  275  KRGFSET-------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQ  415
            KRGFSET       VDL LNL   ++AA    D +EK K+  KE      DP KPP+KAQ
Sbjct  36   KRGFSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQ  95

Query  416  VVGWPPVRNYRKNIMAXKGS  475
            VVGWPPVR++RKN+ A + S
Sbjct  96   VVGWPPVRSFRKNMFAAQKS  115



>gb|KHN18836.1| Auxin-induced protein AUX28 [Glycine soja]
Length=246

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 51/80 (64%), Gaps = 13/80 (16%)
 Frame = +2

Query  275  KRGFSET-------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQ  415
            KRGFSET       VDL LNL   ++AA    D +EK K+  KE      DP KPP+KAQ
Sbjct  36   KRGFSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQ  95

Query  416  VVGWPPVRNYRKNIMAXKGS  475
            VVGWPPVR++RKN+ A + S
Sbjct  96   VVGWPPVRSFRKNMFAAQKS  115



>ref|XP_008810170.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 11/74 (15%)
 Frame = +2

Query  269  TGKRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPN-----KDPIKPPS-KAQVV  421
            T KRGFS+T+DLKL L++    S D K   EKMK  + + N      DP KPP+ KAQVV
Sbjct  32   TKKRGFSKTIDLKLKLRTV--DSKDAKPEAEKMKRSASQKNLLACSSDPEKPPAPKAQVV  89

Query  422  GWPPVRNYRKNIMA  463
            GWPPVR++RKNIM+
Sbjct  90   GWPPVRSFRKNIMS  103



>ref|XP_011082603.1| PREDICTED: auxin-responsive protein IAA14-like [Sesamum indicum]
Length=215

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 15/67 (22%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  454
            KRGF ET+D KLN  S               + E   D +KPP+KAQVVGWPPVR++RKN
Sbjct  32   KRGFEETLDFKLNFAS---------------NGENINDSVKPPAKAQVVGWPPVRSFRKN  76

Query  455  IMAXKGS  475
            IMA K S
Sbjct  77   IMAVKKS  83



>ref|XP_006418150.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 gb|ESQ36503.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=229

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 52/81 (64%), Gaps = 20/81 (25%)
 Frame = +2

Query  266  VTG-KRGFSETVDLKLNLQSA-----ADSSLDL------KEKMKSPSKEPNKDPIKPP--  403
            VTG KRGFSETVDLKLNL +        ++ D+      KEK  SP     KDP KPP  
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGCTTHDVVTNSVSKEKSSSP-----KDPAKPPAK  81

Query  404  -SKAQVVGWPPVRNYRKNIMA  463
             S+AQVVGWPPVR+YRKN++ 
Sbjct  82   ISRAQVVGWPPVRSYRKNVLV  102



>gb|KJB42200.1| hypothetical protein B456_007G141900 [Gossypium raimondii]
Length=235

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 6/72 (8%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPP-SKAQVVGWPPVR  439
            +V  KR FS TVDLKLNL S   S  D K+K   PS   + DP KPP +KAQVVGWPPVR
Sbjct  40   EVVRKRDFSHTVDLKLNLIST--SPTDDKDKNIVPS---HLDPAKPPPAKAQVVGWPPVR  94

Query  440  NYRKNIMAXKGS  475
            ++RKN++A + S
Sbjct  95   SFRKNMLATQKS  106



>gb|KHG04941.1| Auxin-induced AUX28 [Gossypium arboreum]
Length=235

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 6/72 (8%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPP-SKAQVVGWPPVR  439
            +V  KR FS TVDLKLNL S   S  D K+K   PS   + DP KPP +KAQVVGWPPVR
Sbjct  40   EVVRKRDFSHTVDLKLNLIST--SPTDDKDKNIVPS---HLDPAKPPPAKAQVVGWPPVR  94

Query  440  NYRKNIMAXKGS  475
            ++RKN++A + S
Sbjct  95   SFRKNMLATQKS  106



>ref|XP_009398379.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=253

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 9/75 (12%)
 Frame = +2

Query  263  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMK---SPSK----EPNKDPIKPPS-KAQV  418
            K +GKR F+ET+DLKL LQ+A D+  D+   +K   SPS+        DP KPP+ KAQV
Sbjct  39   KNSGKRAFAETIDLKLKLQAAGDTK-DMAAALKMKRSPSQMSIAASATDPEKPPAPKAQV  97

Query  419  VGWPPVRNYRKNIMA  463
            VGWPPVR++R++++A
Sbjct  98   VGWPPVRSHRRSMLA  112



>ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum tuberosum]
 gb|ABK41009.1| auxin/indole-3-acetic acid [Solanum tuberosum]
Length=213

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 9/67 (13%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  454
            KRGFS+TVDLKLNL + + +           +   N D +KPP+KAQVVGWPPVR++RKN
Sbjct  25   KRGFSQTVDLKLNLDNPSINI---------NNTSSNNDSLKPPTKAQVVGWPPVRSFRKN  75

Query  455  IMAXKGS  475
            IM+ KG+
Sbjct  76   IMSQKGN  82



>ref|NP_001239753.1| uncharacterized protein LOC100781847 [Glycine max]
 gb|ACU21611.1| unknown [Glycine max]
Length=231

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 57/83 (69%), Gaps = 11/83 (13%)
 Frame = +2

Query  245  NESESLKVTG-KRGFSET--VDLKLNLQSAADSSLDLK-----EKMKSPSKEP---NKDP  391
            NES ++K +G KRGFSET  VDLKLNL S+ DS+ D       EK  + +  P     DP
Sbjct  22   NESTTVKGSGGKRGFSETASVDLKLNLSSSDDSASDSPSSASTEKTTTAAPPPPSRANDP  81

Query  392  IKPPSKAQVVGWPPVRNYRKNIM  460
             KPP+KAQVVGWPPVR++RKNI+
Sbjct  82   AKPPAKAQVVGWPPVRSFRKNIV  104



>ref|XP_004302055.1| PREDICTED: auxin-responsive protein IAA16 [Fragaria vesca subsp. 
vesca]
Length=254

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 48/75 (64%), Gaps = 14/75 (19%)
 Frame = +2

Query  269  TGKRGFSETVDLKLNL--------QSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  424
            +GKRGFSETVDLKLN         +S  D  +++K K K  S  P      P +KAQVVG
Sbjct  48   SGKRGFSETVDLKLNFSSENDDVSRSGRDGQVEIK-KEKDASAAP-----APRAKAQVVG  101

Query  425  WPPVRNYRKNIMAXK  469
            WPPVR++RKNI+A +
Sbjct  102  WPPVRSFRKNIVAVQ  116



>ref|XP_009417112.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=247

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 48/81 (59%), Gaps = 9/81 (11%)
 Frame = +2

Query  248  ESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPI--------KP-  400
            E ES K +GKRGF E VDLKL LQ+         E  +   + PN D I        KP 
Sbjct  29   EVESGKNSGKRGFVEIVDLKLQLQTPVGVQEAAAEAAEKVKRSPNDDSIVSCGSDPEKPS  88

Query  401  PSKAQVVGWPPVRNYRKNIMA  463
            P KAQVVGWPPVR++RKNI++
Sbjct  89   PPKAQVVGWPPVRSFRKNILS  109



>ref|NP_001237212.1| uncharacterized protein LOC100499872 [Glycine max]
 gb|ACU13989.1| unknown [Glycine max]
Length=228

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 45/76 (59%), Gaps = 13/76 (17%)
 Frame = +2

Query  272  GKRGFSET--VDLKLNLQSAADSSLDL-----------KEKMKSPSKEPNKDPIKPPSKA  412
             KRGFSET  VDLKLNL S  + S              + K  +    P  DP KPP+KA
Sbjct  25   AKRGFSETASVDLKLNLSSCINDSASDSPSSVSTEKPKENKTTTAEPPPANDPAKPPAKA  84

Query  413  QVVGWPPVRNYRKNIM  460
            QVVGWPPVR++RKNI+
Sbjct  85   QVVGWPPVRSFRKNIV  100



>ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum]
 gb|AEX00351.1| IAA7 [Solanum lycopersicum]
Length=218

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 50/67 (75%), Gaps = 7/67 (10%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADS-SLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRK  451
            KRGFS+TVDLKLNL    +  S+++     +P K+ + +  KPP+KAQVVGWPPVR++RK
Sbjct  22   KRGFSQTVDLKLNLHHNDNIPSMNIN----NPPKDNSSN--KPPTKAQVVGWPPVRSFRK  75

Query  452  NIMAXKG  472
            N+++ KG
Sbjct  76   NMLSQKG  82



>ref|XP_006605305.1| PREDICTED: uncharacterized protein LOC100499872 isoform X1 [Glycine 
max]
 gb|KHN04928.1| Auxin-induced protein AUX28 [Glycine soja]
Length=227

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 45/76 (59%), Gaps = 13/76 (17%)
 Frame = +2

Query  272  GKRGFSET--VDLKLNLQSAADSSLDL-----------KEKMKSPSKEPNKDPIKPPSKA  412
             KRGFSET  VDLKLNL S  + S              + K  +    P  DP KPP+KA
Sbjct  25   AKRGFSETASVDLKLNLSSCINDSASDSPSSVSTEKPKENKTTTAEPPPANDPAKPPAKA  84

Query  413  QVVGWPPVRNYRKNIM  460
            QVVGWPPVR++RKNI+
Sbjct  85   QVVGWPPVRSFRKNIV  100



>ref|XP_010522504.1| PREDICTED: auxin-responsive protein IAA17-like [Tarenaya hassleriana]
Length=235

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 43/72 (60%), Gaps = 5/72 (7%)
 Frame = +2

Query  275  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSK---EPNKDPI--KPPSKAQVVGWPPVR  439
            KRGFSETVDLKLNL +     +      + PS     PN      KPP+KAQVVGWPPVR
Sbjct  32   KRGFSETVDLKLNLNNEPHKDVGSALSEQDPSSLVSVPNDSSSCPKPPAKAQVVGWPPVR  91

Query  440  NYRKNIMAXKGS  475
             YRKN+M    S
Sbjct  92   TYRKNMMGRTSS  103



>ref|NP_001241599.1| uncharacterized protein LOC100803065 [Glycine max]
 gb|ACU20028.1| unknown [Glycine max]
 gb|KHN03840.1| Auxin-induced protein AUX28 [Glycine soja]
Length=248

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 49/83 (59%), Gaps = 16/83 (19%)
 Frame = +2

Query  275  KRGFSET-------VDLKLNLQ------SAADSSLDLKEKMKSPSKEPNK---DPIKPPS  406
            KRGFSET       VDL LNL       +A     D +E  K+  KE N    DP KPP+
Sbjct  35   KRGFSETETDETTSVDLMLNLSPKEASAAATTDGADPRENPKTSPKEKNLPLLDPAKPPA  94

Query  407  KAQVVGWPPVRNYRKNIMAXKGS  475
            KAQVVGWPPVR++RKN+ A + S
Sbjct  95   KAQVVGWPPVRSFRKNMFAAQKS  117



>gb|AFK36086.1| unknown [Lotus japonicus]
Length=257

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 49/83 (59%), Gaps = 12/83 (14%)
 Frame = +2

Query  263  KVTGKRGFSET------VDLKLNLQS------AADSSLDLKEKMKSPSKEPNKDPIKPPS  406
            +V  KRGFSET      VDL LNL S       AD S   K  ++        DP KPP+
Sbjct  38   EVVRKRGFSETESETDTVDLMLNLSSKEPTSAGADPSQKPKTNLQKEKTLLPADPAKPPA  97

Query  407  KAQVVGWPPVRNYRKNIMAXKGS  475
            KAQVVGWPPVR++RKN++A + S
Sbjct  98   KAQVVGWPPVRSFRKNMLAVQKS  120



>ref|XP_004493739.1| PREDICTED: auxin-induced protein AUX28-like [Cicer arietinum]
Length=246

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 50/81 (62%), Gaps = 11/81 (14%)
 Frame = +2

Query  266  VTGKRGFSET------VDLKLNLQSAAD--SSLDLKEKMKSPSKEPN---KDPIKPPSKA  412
            V  KRGFSET      +DL LNL +  +  S +D  +  K   KE      DP KPP+KA
Sbjct  35   VVRKRGFSETETQDHTMDLMLNLSTNKEPTSEVDPIDNTKILQKENTLLPADPAKPPAKA  94

Query  413  QVVGWPPVRNYRKNIMAXKGS  475
            QVVGWPPVR+YRKN++A + S
Sbjct  95   QVVGWPPVRSYRKNMLAMQKS  115



>dbj|BAI94494.1| Aux/IAA protein [Dianthus caryophyllus]
Length=238

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 41/62 (66%), Gaps = 8/62 (13%)
 Frame = +2

Query  278  RGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNI  457
            RGFS+TVDL  N     D   D+K+     SK    D +KPP+KAQVVGWPPVR+YRKN+
Sbjct  48   RGFSDTVDLMKN-----DKKADVKD---VCSKVVVTDSVKPPAKAQVVGWPPVRSYRKNV  99

Query  458  MA  463
            M 
Sbjct  100  MT  101



>gb|AFK36684.1| unknown [Lotus japonicus]
Length=190

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 49/83 (59%), Gaps = 12/83 (14%)
 Frame = +2

Query  263  KVTGKRGFSET------VDLKLNLQS------AADSSLDLKEKMKSPSKEPNKDPIKPPS  406
            +V  KRGFSET      VDL LNL S       AD S   K  ++        DP KPP+
Sbjct  38   EVVRKRGFSETESETDTVDLMLNLSSKEPTSAGADPSQKPKTNLQKEKTLLPADPAKPPA  97

Query  407  KAQVVGWPPVRNYRKNIMAXKGS  475
            KA+VVGWPPVR++RKN++A + S
Sbjct  98   KARVVGWPPVRSFRKNMLAVQKS  120



>ref|XP_010556884.1| PREDICTED: auxin-responsive protein IAA17 [Tarenaya hassleriana]
Length=238

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 47/78 (60%), Gaps = 17/78 (22%)
 Frame = +2

Query  275  KRGFSETV-DLKLNLQSAADSSLDLKEKMKSPSKEPN--------------KDPIKPPSK  409
            KRGFSETV DLKLNL +      DL     +  K+P+              KDP KPP+K
Sbjct  33   KRGFSETVVDLKLNLNNEPRDHKDLGSV--TTEKDPSSLAAVPADNSSSCPKDPSKPPAK  90

Query  410  AQVVGWPPVRNYRKNIMA  463
            AQVVGWPPVR+YRKN+ A
Sbjct  91   AQVVGWPPVRSYRKNMTA  108



>ref|XP_004289900.1| PREDICTED: auxin-induced protein AUX28-like [Fragaria vesca subsp. 
vesca]
Length=250

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 54/83 (65%), Gaps = 7/83 (8%)
 Frame = +2

Query  245  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK--MKSPSKEPN----KDPIKPPS  406
            +E+ES ++T     S  VDLKLNL S   SS   K K  M + +KE N     DP KPP+
Sbjct  39   SETES-QITTDDESSACVDLKLNLSSKDGSSTAEKSKSLMMNKNKEKNVDLPADPAKPPA  97

Query  407  KAQVVGWPPVRNYRKNIMAXKGS  475
            KAQVVGWPPVR++RKN+++ + S
Sbjct  98   KAQVVGWPPVRSFRKNMLSAQKS  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564765596140