BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF020O02

Length=427
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP13270.1|  unnamed protein product                                145   4e-38   Coffea canephora [robusta coffee]
ref|XP_011071172.1|  PREDICTED: ultraviolet-B receptor UVR8             142   5e-37   Sesamum indicum [beniseed]
ref|XP_003601869.1|  RCC1 domain-containing protein                     141   2e-36   Medicago truncatula
ref|XP_011044684.1|  PREDICTED: ultraviolet-B receptor UVR8-like        140   3e-36   Populus euphratica
ref|XP_004502353.1|  PREDICTED: probable E3 ubiquitin-protein lig...    140   4e-36   
ref|XP_002321983.2|  hypothetical protein POPTR_0015s01170g             139   5e-36   
gb|KDO82112.1|  hypothetical protein CISIN_1g009463mg                   139   7e-36   Citrus sinensis [apfelsine]
ref|XP_006438172.1|  hypothetical protein CICLE_v10031198mg             139   7e-36   Citrus clementina [clementine]
ref|XP_002317792.2|  hypothetical protein POPTR_0012s02560g             139   8e-36   
ref|XP_008389759.1|  PREDICTED: ultraviolet-B receptor UVR8             138   2e-35   
ref|XP_011024876.1|  PREDICTED: ultraviolet-B receptor UVR8-like        138   2e-35   Populus euphratica
gb|EYU22552.1|  hypothetical protein MIMGU_mgv1a004258mg                138   2e-35   Erythranthe guttata [common monkey flower]
ref|XP_009586986.1|  PREDICTED: ultraviolet-B receptor UVR8             137   5e-35   Nicotiana tomentosiformis
gb|KDP26718.1|  hypothetical protein JCGZ_17876                         137   5e-35   Jatropha curcas
gb|KHG17032.1|  putative E3 ubiquitin-protein ligase HERC4              136   8e-35   Gossypium arboreum [tree cotton]
ref|XP_008361816.1|  PREDICTED: ultraviolet-B receptor UVR8-like        135   1e-34   
ref|XP_009359259.1|  PREDICTED: ultraviolet-B receptor UVR8             135   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_004239161.1|  PREDICTED: ultraviolet-B receptor UVR8             135   2e-34   Solanum lycopersicum
ref|XP_007044919.1|  Regulator of chromosome condensation (RCC1) ...    134   3e-34   
gb|KJB31063.1|  hypothetical protein B456_005G174500                    134   3e-34   Gossypium raimondii
ref|XP_008221955.1|  PREDICTED: ultraviolet-B receptor UVR8             134   3e-34   Prunus mume [ume]
ref|XP_007222374.1|  hypothetical protein PRUPE_ppa004014mg             134   4e-34   Prunus persica
ref|XP_002285332.1|  PREDICTED: ultraviolet-B receptor UVR8             134   5e-34   Vitis vinifera
ref|XP_009769667.1|  PREDICTED: ultraviolet-B receptor UVR8             134   5e-34   Nicotiana sylvestris
ref|XP_006591478.1|  PREDICTED: probable E3 ubiquitin-protein lig...    134   6e-34   Glycine max [soybeans]
ref|XP_003551939.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    134   6e-34   Glycine max [soybeans]
ref|XP_007159624.1|  hypothetical protein PHAVU_002G253100g             132   2e-33   Phaseolus vulgaris [French bean]
ref|XP_010682363.1|  PREDICTED: probable E3 ubiquitin-protein lig...    132   2e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004310005.1|  PREDICTED: ultraviolet-B receptor UVR8             132   3e-33   Fragaria vesca subsp. vesca
ref|XP_006341781.1|  PREDICTED: probable E3 ubiquitin-protein lig...    131   4e-33   Solanum tuberosum [potatoes]
ref|XP_004962592.1|  PREDICTED: ultraviolet-B receptor UVR8-like        131   4e-33   Setaria italica
ref|NP_001066582.1|  Os12g0284000                                       131   4e-33   
gb|EEC69101.1|  hypothetical protein OsI_38005                          131   4e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_006663947.1|  PREDICTED: probable E3 ubiquitin-protein lig...    130   7e-33   Oryza brachyantha
ref|XP_010929984.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    130   9e-33   Elaeis guineensis
ref|XP_007222373.1|  hypothetical protein PRUPE_ppa004014mg             129   1e-32   
gb|KJB31066.1|  hypothetical protein B456_005G174500                    129   2e-32   Gossypium raimondii
gb|KJB31065.1|  hypothetical protein B456_005G174500                    129   2e-32   Gossypium raimondii
gb|KHN44387.1|  Putative E3 ubiquitin-protein ligase HERC4              129   2e-32   Glycine soja [wild soybean]
emb|CAN77314.1|  hypothetical protein VITISV_008041                     129   3e-32   Vitis vinifera
ref|XP_009387758.1|  PREDICTED: ultraviolet-B receptor UVR8-like        129   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN24115.1|  E3 ubiquitin-protein ligase HERC2                       128   5e-32   Glycine soja [wild soybean]
ref|XP_010514248.1|  PREDICTED: ultraviolet-B receptor UVR8-like        128   8e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010044521.1|  PREDICTED: ultraviolet-B receptor UVR8             127   9e-32   Eucalyptus grandis [rose gum]
ref|XP_010425280.1|  PREDICTED: ultraviolet-B receptor UVR8-like        127   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_007159625.1|  hypothetical protein PHAVU_002G253200g             127   2e-31   Phaseolus vulgaris [French bean]
ref|XP_006290883.1|  hypothetical protein CARUB_v10016992mg             127   2e-31   Capsella rubella
gb|KHN06528.1|  E3 ubiquitin-protein ligase HERC2                       126   2e-31   Glycine soja [wild soybean]
ref|XP_003524245.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    126   2e-31   Glycine max [soybeans]
emb|CDY04192.1|  BnaA09g19700D                                          125   3e-31   
ref|NP_974362.1|  regulator of chromosome condensation repeat-con...    125   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875307.1|  regulator of chromosome condensation family ...    125   5e-31   
ref|XP_010929983.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    125   5e-31   
ref|XP_008446114.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    125   5e-31   Cucumis melo [Oriental melon]
gb|KHN29007.1|  E3 ubiquitin-protein ligase HERC2                       125   5e-31   Glycine soja [wild soybean]
ref|XP_008446119.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    125   5e-31   
ref|XP_003531318.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    125   6e-31   
ref|XP_003578713.1|  PREDICTED: ultraviolet-B receptor UVR8             125   8e-31   Brachypodium distachyon [annual false brome]
gb|KJB60982.1|  hypothetical protein B456_009G334300                    122   1e-30   Gossypium raimondii
ref|XP_008796028.1|  PREDICTED: ultraviolet-B receptor UVR8             124   1e-30   
gb|KJB60981.1|  hypothetical protein B456_009G334300                    123   1e-30   Gossypium raimondii
gb|KHG25634.1|  E3 ubiquitin-protein ligase HERC2                       124   2e-30   Gossypium arboreum [tree cotton]
emb|CDX99731.1|  BnaC02g35890D                                          124   2e-30   
ref|XP_009415993.1|  PREDICTED: ultraviolet-B receptor UVR8-like        124   2e-30   
ref|XP_010248751.1|  PREDICTED: ultraviolet-B receptor UVR8-like        124   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010502511.1|  PREDICTED: ultraviolet-B receptor UVR8-like        124   2e-30   Camelina sativa [gold-of-pleasure]
gb|KJB60983.1|  hypothetical protein B456_009G334300                    123   3e-30   Gossypium raimondii
ref|XP_004135288.1|  PREDICTED: probable E3 ubiquitin-protein lig...    124   3e-30   Cucumis sativus [cucumbers]
gb|KJB60986.1|  hypothetical protein B456_009G334300                    123   3e-30   Gossypium raimondii
gb|KJB60980.1|  hypothetical protein B456_009G334300                    123   3e-30   Gossypium raimondii
ref|XP_010912915.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    123   3e-30   Elaeis guineensis
ref|XP_002515036.1|  RCC1 and BTB domain-containing protein, puta...    123   5e-30   
ref|XP_010528070.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    122   6e-30   Tarenaya hassleriana [spider flower]
ref|XP_006395590.1|  hypothetical protein EUTSA_v10003973mg             120   8e-30   
ref|XP_010528066.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    122   1e-29   
ref|XP_006395591.1|  hypothetical protein EUTSA_v10003973mg             120   1e-29   
dbj|BAK00885.1|  predicted protein                                      121   2e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006395589.1|  hypothetical protein EUTSA_v10003973mg             120   2e-29   
ref|XP_006395588.1|  hypothetical protein EUTSA_v10003973mg             121   3e-29   Eutrema salsugineum [saltwater cress]
ref|XP_009129568.1|  PREDICTED: ultraviolet-B receptor UVR8-like        120   4e-29   
ref|XP_009114097.1|  PREDICTED: ultraviolet-B receptor UVR8-like        120   5e-29   Brassica rapa
emb|CDY40988.1|  BnaA02g27780D                                          120   5e-29   Brassica napus [oilseed rape]
ref|XP_010250918.1|  PREDICTED: ultraviolet-B receptor UVR8             120   6e-29   Nelumbo nucifera [Indian lotus]
gb|EPS68069.1|  hypothetical protein M569_06703                         119   9e-29   Genlisea aurea
emb|CDY28863.1|  BnaC06g26510D                                          119   1e-28   Brassica napus [oilseed rape]
ref|XP_010912917.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    117   2e-28   
emb|CDY56518.1|  BnaA07g38600D                                          117   6e-28   Brassica napus [oilseed rape]
emb|CDY39172.1|  BnaC09g21720D                                          116   8e-28   Brassica napus [oilseed rape]
ref|XP_009105101.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    116   2e-27   Brassica rapa
ref|XP_009105098.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    115   2e-27   Brassica rapa
ref|XP_010556194.1|  PREDICTED: ultraviolet-B receptor UVR8-like        115   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_002887142.1|  predicted protein                                  115   3e-27   
ref|XP_006852257.1|  hypothetical protein AMTR_s00049p00167370          115   5e-27   Amborella trichopoda
ref|XP_010100324.1|  hypothetical protein L484_027632                   114   7e-27   
emb|CDY01845.1|  BnaC06g28850D                                          113   1e-26   
ref|XP_010511732.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    112   3e-26   
ref|XP_010511729.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    112   3e-26   
ref|XP_003579993.1|  PREDICTED: probable E3 ubiquitin-protein lig...    112   3e-26   Brachypodium distachyon [annual false brome]
ref|XP_010927591.1|  PREDICTED: probable E3 ubiquitin-protein lig...    112   4e-26   
ref|XP_009152081.1|  PREDICTED: ultraviolet-B receptor UVR8             112   5e-26   Brassica rapa
ref|XP_002987523.1|  hypothetical protein SELMODRAFT_126315             111   5e-26   
emb|CDY13609.1|  BnaA06g33140D                                          112   6e-26   Brassica napus [oilseed rape]
emb|CDX96062.1|  BnaA07g26690D                                          111   7e-26   
ref|XP_002987735.1|  hypothetical protein SELMODRAFT_426505             111   8e-26   Selaginella moellendorffii
ref|XP_009105326.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    111   8e-26   Brassica rapa
emb|CDX83586.1|  BnaC07g23260D                                          111   1e-25   
ref|XP_006391225.1|  hypothetical protein EUTSA_v10018382mg             110   2e-25   
ref|XP_010415359.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    110   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006391226.1|  hypothetical protein EUTSA_v10018382mg             110   2e-25   
ref|XP_010470700.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    110   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010470697.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    110   2e-25   
ref|XP_008798796.1|  PREDICTED: probable E3 ubiquitin-protein lig...    110   3e-25   
ref|XP_004975996.1|  PREDICTED: probable E3 ubiquitin-protein lig...    109   4e-25   Setaria italica
ref|XP_009105322.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    108   1e-24   Brassica rapa
ref|XP_006653534.1|  PREDICTED: ultraviolet-B receptor UVR8-like        108   1e-24   
gb|ABA97468.1|  regulator of chromosome condensation, putative, e...  98.6    2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454125.1|  hypothetical protein SORBIDRAFT_04g024990        99.0    3e-21   Sorghum bicolor [broomcorn]
ref|XP_006647457.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...  97.1    1e-20   Oryza brachyantha
ref|XP_004952987.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...  96.7    2e-20   
ref|XP_003601870.1|  RCC1 domain-containing protein                   95.5    2e-20   
ref|XP_002448071.1|  hypothetical protein SORBIDRAFT_06g020490        95.5    5e-20   Sorghum bicolor [broomcorn]
gb|EEC73526.1|  hypothetical protein OsI_07916                        96.3    5e-20   Oryza sativa Indica Group [Indian rice]
gb|KFK41183.1|  hypothetical protein AALP_AA2G096500                  92.8    7e-20   Arabis alpina [alpine rockcress]
ref|NP_001047324.1|  Os02g0597000                                     94.4    1e-19   
gb|EEE57302.1|  hypothetical protein OsJ_07379                        94.4    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001145799.1|  uncharacterized protein LOC100279306             93.2    3e-19   Zea mays [maize]
gb|KDO82113.1|  hypothetical protein CISIN_1g009463mg                 92.0    5e-19   Citrus sinensis [apfelsine]
ref|XP_006438171.1|  hypothetical protein CICLE_v10031198mg           92.0    5e-19   
ref|XP_006290882.1|  hypothetical protein CARUB_v10016992mg           89.0    6e-18   
ref|XP_007044920.1|  Regulator of chromosome condensation (RCC1) ...  88.6    9e-18   
gb|KJB31067.1|  hypothetical protein B456_005G174500                  88.2    1e-17   Gossypium raimondii
gb|KDO82118.1|  hypothetical protein CISIN_1g009463mg                 87.0    2e-17   Citrus sinensis [apfelsine]
ref|NP_566789.1|  regulator of chromosome condensation repeat-con...  87.0    3e-17   Arabidopsis thaliana [mouse-ear cress]
gb|EMT06491.1|  hypothetical protein F775_19352                       74.3    1e-12   
ref|XP_009387708.1|  PREDICTED: probable E3 ubiquitin-protein lig...  70.1    4e-11   
gb|KJB60985.1|  hypothetical protein B456_009G334300                  61.2    3e-08   Gossypium raimondii
ref|XP_006827796.1|  hypothetical protein AMTR_s00009p00266800        55.5    3e-06   Amborella trichopoda
ref|XP_008806532.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  53.9    9e-06   
ref|XP_008806527.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  53.9    9e-06   
ref|XP_010905534.1|  PREDICTED: ultraviolet-B receptor UVR8           52.8    2e-05   Elaeis guineensis
ref|XP_002528573.1|  Ran GTPase binding protein, putative             52.4    3e-05   Ricinus communis
gb|KEH38764.1|  chromosome condensation regulator RCC1 repeat pro...  51.6    6e-05   Medicago truncatula
ref|XP_004487688.1|  PREDICTED: probable E3 ubiquitin-protein lig...  51.2    7e-05   Cicer arietinum [garbanzo]
ref|XP_002448070.1|  hypothetical protein SORBIDRAFT_06g020480        48.1    3e-04   
ref|XP_009398507.1|  PREDICTED: ultraviolet-B receptor UVR8           48.9    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010099004.1|  hypothetical protein L484_025664                 48.5    5e-04   Morus notabilis
ref|XP_009389235.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  48.5    6e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010695029.1|  PREDICTED: ultraviolet-B receptor UVR8           48.1    6e-04   Beta vulgaris subsp. vulgaris [field beet]



>emb|CDP13270.1| unnamed protein product [Coffea canephora]
Length=547

 Score =   145 bits (367),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +3

Query  201  NATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLR  380
            +ATCSFFRQPAHF PD++LS+ ELAALDMC KRA+FKPMT EE+QDLKQRCGGSWKLVLR
Sbjct  87   SATCSFFRQPAHFAPDYELSMAELAALDMCQKRAIFKPMTDEERQDLKQRCGGSWKLVLR  146

Query  381  YLLAGEACSRRESSQ  425
            YLLAGE CSRRE SQ
Sbjct  147  YLLAGEVCSRREKSQ  161



>ref|XP_011071172.1| PREDICTED: ultraviolet-B receptor UVR8 [Sesamum indicum]
Length=534

 Score =   142 bits (358),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPAHF PD++LSL ELAALDMC KRA+FKPMT E+++DLKQRCGGSWKLVL
Sbjct  73   LEATCSFFRQPAHFAPDYELSLAELAALDMCQKRAIFKPMTIEQREDLKQRCGGSWKLVL  132

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEACSRRE SQ
Sbjct  133  RFLLAGEACSRREKSQ  148



>ref|XP_003601869.1| RCC1 domain-containing protein [Medicago truncatula]
 gb|AES72120.1| chromosome condensation regulator RCC1 repeat protein [Medicago 
truncatula]
Length=535

 Score =   141 bits (355),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PDF LSL ELAA DMC KRA+FKPMT EE+QDLKQRCGGSWKLVL
Sbjct  75   LEATCSFFRQPANFAPDFALSLAELAAFDMCMKRAIFKPMTTEERQDLKQRCGGSWKLVL  134

Query  378  RYLLAGEACSRRESSQ  425
            RYLLAGEAC RRE SQ
Sbjct  135  RYLLAGEACCRREKSQ  150



>ref|XP_011044684.1| PREDICTED: ultraviolet-B receptor UVR8-like [Populus euphratica]
Length=536

 Score =   140 bits (352),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA F PD++LS+ ELAALDMC KRA+FKPMT EE+QDLKQRCGGSWKLVL
Sbjct  76   LEATCSFFRQPASFAPDYELSMSELAALDMCQKRAIFKPMTPEERQDLKQRCGGSWKLVL  135

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  136  RFLLAGEACCRREKSQ  151



>ref|XP_004502353.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004502354.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004502355.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X3 [Cicer arietinum]
 ref|XP_004502356.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X4 [Cicer arietinum]
 ref|XP_004502357.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X5 [Cicer arietinum]
Length=536

 Score =   140 bits (352),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PDF LSL ELAA DMC KRA+FKPMT EE+QDLKQRCGGSWKLVL
Sbjct  76   LEATCSFFRQPANFAPDFTLSLSELAAFDMCLKRAIFKPMTTEEKQDLKQRCGGSWKLVL  135

Query  378  RYLLAGEACSRRESSQ  425
            RYLLAGEAC RRE SQ
Sbjct  136  RYLLAGEACCRREKSQ  151



>ref|XP_002321983.2| hypothetical protein POPTR_0015s01170g [Populus trichocarpa]
 gb|EEF06110.2| hypothetical protein POPTR_0015s01170g [Populus trichocarpa]
Length=540

 Score =   139 bits (351),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFFRQPA F PD++LS+ ELAALDMC KRA+FKPMT EE+QDLKQRCGGSWKLVLR+
Sbjct  82   ATCSFFRQPASFAPDYELSMSELAALDMCQKRAIFKPMTPEERQDLKQRCGGSWKLVLRF  141

Query  384  LLAGEACSRRESSQ  425
            LLAGEAC RRE SQ
Sbjct  142  LLAGEACCRRERSQ  155



>gb|KDO82112.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
Length=534

 Score =   139 bits (350),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PD+QLS+ ELAALDMC KRA+FKPMT+ E+QDLKQ+CGGSWKLVL
Sbjct  74   LEATCSFFRQPANFAPDYQLSISELAALDMCQKRAIFKPMTEAERQDLKQKCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE+SQ
Sbjct  134  RFLLAGEACCRRENSQ  149



>ref|XP_006438172.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
 ref|XP_006484001.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006484002.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X2 [Citrus sinensis]
 gb|ESR51412.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
Length=534

 Score =   139 bits (350),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PD+QLS+ ELAALDMC KRA+FKPMT+ E+QDLKQ+CGGSWKLVL
Sbjct  74   LEATCSFFRQPANFAPDYQLSISELAALDMCQKRAIFKPMTEAERQDLKQKCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE+SQ
Sbjct  134  RFLLAGEACCRRENSQ  149



>ref|XP_002317792.2| hypothetical protein POPTR_0012s02560g [Populus trichocarpa]
 gb|EEE96012.2| hypothetical protein POPTR_0012s02560g [Populus trichocarpa]
Length=538

 Score =   139 bits (350),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+FPPD +LS+ ELAALDMC KRA+FKPM  EE+QDLKQRCGGSWKLVL
Sbjct  78   LEATCSFFRQPANFPPDNELSISELAALDMCQKRAIFKPMAPEERQDLKQRCGGSWKLVL  137

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  138  RFLLAGEACCRRERSQ  153



>ref|XP_008389759.1| PREDICTED: ultraviolet-B receptor UVR8 [Malus domestica]
 ref|XP_008389760.1| PREDICTED: ultraviolet-B receptor UVR8 [Malus domestica]
 ref|XP_008389761.1| PREDICTED: ultraviolet-B receptor UVR8 [Malus domestica]
 ref|XP_008389762.1| PREDICTED: ultraviolet-B receptor UVR8 [Malus domestica]
 ref|XP_008389763.1| PREDICTED: ultraviolet-B receptor UVR8 [Malus domestica]
 ref|XP_008389764.1| PREDICTED: ultraviolet-B receptor UVR8 [Malus domestica]
Length=534

 Score =   138 bits (347),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR PAHF PDF+LS+ ELAALDMC KRA+FKPMT E++Q+LKQRCGGSWKLVL
Sbjct  74   LEATCSFFRHPAHFAPDFELSISELAALDMCRKRAIFKPMTAEQRQELKQRCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  134  RFLLAGEACYRREKSQ  149



>ref|XP_011024876.1| PREDICTED: ultraviolet-B receptor UVR8-like [Populus euphratica]
 ref|XP_011024877.1| PREDICTED: ultraviolet-B receptor UVR8-like [Populus euphratica]
 ref|XP_011024878.1| PREDICTED: ultraviolet-B receptor UVR8-like [Populus euphratica]
 ref|XP_011024879.1| PREDICTED: ultraviolet-B receptor UVR8-like [Populus euphratica]
Length=538

 Score =   138 bits (347),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+FPPD +LS+ ELAALDMC KRA+FKPM  EE++DLKQRCGGSWKLVL
Sbjct  78   LEATCSFFRQPANFPPDNELSISELAALDMCQKRAIFKPMAPEERRDLKQRCGGSWKLVL  137

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  138  RFLLAGEACCRRERSQ  153



>gb|EYU22552.1| hypothetical protein MIMGU_mgv1a004258mg [Erythranthe guttata]
Length=537

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFFRQPA+F PD++LSL ELAALDMC KRA+FKPMT EE+QDLKQRCGGSWKLVLRY
Sbjct  72   ATCSFFRQPANFAPDYELSLAELAALDMCQKRAIFKPMTFEERQDLKQRCGGSWKLVLRY  131

Query  384  LLAGEACSRRESSQ  425
            LLAGEACSRRE +Q
Sbjct  132  LLAGEACSRREKTQ  145



>ref|XP_009586986.1| PREDICTED: ultraviolet-B receptor UVR8 [Nicotiana tomentosiformis]
Length=535

 Score =   137 bits (344),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 61/76 (80%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR PA+F PD +LSL ELAALDMC KRA+FKPMTQE++QDLKQRCGGSWKLVL
Sbjct  74   LEATCSFFRLPANFAPDNELSLAELAALDMCRKRAIFKPMTQEQRQDLKQRCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEACSRRE S 
Sbjct  134  RFLLAGEACSRREKSH  149



>gb|KDP26718.1| hypothetical protein JCGZ_17876 [Jatropha curcas]
Length=538

 Score =   137 bits (344),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PD++LS+ ELAALDMC KRA+FKPMT +E+QDLK+RCGGSWKLVL
Sbjct  74   LEATCSFFRQPANFSPDYELSISELAALDMCQKRAIFKPMTTDERQDLKRRCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  134  RFLLAGEACCRREKSQ  149



>gb|KHG17032.1| putative E3 ubiquitin-protein ligase HERC4 [Gossypium arboreum]
Length=519

 Score =   136 bits (342),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  195  LFNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLV  374
            + +ATCSFFRQPA+F PD++LS+ ELAALDMC +RA+FKPMT EE+Q LK RCGGSWKLV
Sbjct  57   VLHATCSFFRQPANFAPDYELSISELAALDMCQRRAIFKPMTDEERQSLKHRCGGSWKLV  116

Query  375  LRYLLAGEACSRRESSQ  425
            LR+LLAGEAC RRE SQ
Sbjct  117  LRFLLAGEACCRREKSQ  133



>ref|XP_008361816.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361817.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361818.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361819.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361820.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361822.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361823.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361824.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361825.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361826.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
Length=534

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  192  SLFNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKL  371
            S   ATCSFFRQPAHF PDF+LS+ ELAALDMC KRA+FKPMT E++Q+LKQRCGGSWKL
Sbjct  72   SKLEATCSFFRQPAHFAPDFELSISELAALDMCQKRAIFKPMTAEQRQELKQRCGGSWKL  131

Query  372  VLRYLLAGEACSRRESSQ  425
            VLR+LLAGEAC RRE SQ
Sbjct  132  VLRFLLAGEACFRREKSQ  149



>ref|XP_009359259.1| PREDICTED: ultraviolet-B receptor UVR8 [Pyrus x bretschneideri]
Length=534

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  192  SLFNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKL  371
            S   ATCSFFRQPAHF PDF+LS+ ELAALDMC KRA+FKPMT E++Q+LKQRCGGSWKL
Sbjct  72   SKLEATCSFFRQPAHFAPDFELSISELAALDMCQKRAIFKPMTVEQRQELKQRCGGSWKL  131

Query  372  VLRYLLAGEACSRRESSQ  425
            VLR+LLAGEAC RRE SQ
Sbjct  132  VLRFLLAGEACFRREKSQ  149



>ref|XP_004239161.1| PREDICTED: ultraviolet-B receptor UVR8 [Solanum lycopersicum]
Length=533

 Score =   135 bits (339),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PD +LSL ELAALDMC KRA+FKPMTQE+  DLKQ+CGGSWKLVL
Sbjct  72   LEATCSFFRQPANFAPDNELSLAELAALDMCRKRAIFKPMTQEQCHDLKQKCGGSWKLVL  131

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEACSRRE S 
Sbjct  132  RFLLAGEACSRREKSH  147



>ref|XP_007044919.1| Regulator of chromosome condensation (RCC1) family protein isoform 
1 [Theobroma cacao]
 gb|EOY00751.1| Regulator of chromosome condensation (RCC1) family protein isoform 
1 [Theobroma cacao]
Length=534

 Score =   134 bits (338),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PD++LS+ ELAALDMC KRA+FKPMT EE+Q+LKQRCG SWKLVL
Sbjct  74   LEATCSFFRQPANFAPDYELSISELAALDMCQKRAIFKPMTDEERQNLKQRCGESWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  134  RFLLAGEACCRREKSQ  149



>gb|KJB31063.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
 gb|KJB31064.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
 gb|KJB31068.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
 gb|KJB31070.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
Length=534

 Score =   134 bits (338),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PD++LS+ ELAALDMC +RA+FKPMT EE+Q LK RCGGSWKLVL
Sbjct  74   LEATCSFFRQPANFAPDYELSISELAALDMCQRRAIFKPMTDEERQSLKHRCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  134  RFLLAGEACCRREKSQ  149



>ref|XP_008221955.1| PREDICTED: ultraviolet-B receptor UVR8 [Prunus mume]
 ref|XP_008221956.1| PREDICTED: ultraviolet-B receptor UVR8 [Prunus mume]
 ref|XP_008221958.1| PREDICTED: ultraviolet-B receptor UVR8 [Prunus mume]
Length=535

 Score =   134 bits (338),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PDF+LS+ ELAALDMC KR +FKPMT E++Q+LKQRCGGSWKLVL
Sbjct  75   LEATCSFFRQPANFAPDFELSISELAALDMCQKRGIFKPMTAEQRQELKQRCGGSWKLVL  134

Query  378  RYLLAGEACSRRESSQ  425
            ++LLAGEAC RRE SQ
Sbjct  135  KFLLAGEACFRREKSQ  150



>ref|XP_007222374.1| hypothetical protein PRUPE_ppa004014mg [Prunus persica]
 gb|EMJ23573.1| hypothetical protein PRUPE_ppa004014mg [Prunus persica]
Length=535

 Score =   134 bits (337),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PDF+LS+ ELAALDMC KR +FKPMT E++Q+LKQRCGGSWKLVL
Sbjct  75   LEATCSFFRQPANFAPDFELSISELAALDMCQKRGIFKPMTAEQRQELKQRCGGSWKLVL  134

Query  378  RYLLAGEACSRRESSQ  425
            ++LLAGEAC RRE SQ
Sbjct  135  KFLLAGEACFRREKSQ  150



>ref|XP_002285332.1| PREDICTED: ultraviolet-B receptor UVR8 [Vitis vinifera]
 ref|XP_010650906.1| PREDICTED: ultraviolet-B receptor UVR8 [Vitis vinifera]
 ref|XP_010650911.1| PREDICTED: ultraviolet-B receptor UVR8 [Vitis vinifera]
 ref|XP_010650917.1| PREDICTED: ultraviolet-B receptor UVR8 [Vitis vinifera]
 emb|CBI16837.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   134 bits (336),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPAHF PDF+LS+ ELAALDMC KRA+F+PM  EE++ LKQRCGGSWKLVL
Sbjct  74   LEATCSFFRQPAHFAPDFELSISELAALDMCLKRAIFRPMMLEEREVLKQRCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  134  RFLLAGEACCRREKSQ  149



>ref|XP_009769667.1| PREDICTED: ultraviolet-B receptor UVR8 [Nicotiana sylvestris]
Length=535

 Score =   134 bits (336),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFF  PA+F PD +LSL ELAALDMC KRA+FKPMTQE++QDLKQRCGGSWKLVL
Sbjct  74   LEATCSFFWLPANFAPDNELSLAELAALDMCRKRAIFKPMTQEQRQDLKQRCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEACSRRE S 
Sbjct  134  RFLLAGEACSRREKSH  149



>ref|XP_006591478.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X2 [Glycine max]
 ref|XP_003538581.2| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X1 [Glycine max]
Length=531

 Score =   134 bits (336),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PD  LSL ELAALDMC KRA+FKPMT E++QDLK RCGGSWKLVL
Sbjct  75   LEATCSFFRQPANFAPDSDLSLSELAALDMCQKRAIFKPMTTEQRQDLKLRCGGSWKLVL  134

Query  378  RYLLAGEACSRRESSQ  425
            RYL+AGEAC RRE SQ
Sbjct  135  RYLMAGEACCRREKSQ  150



>ref|XP_003551939.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Glycine 
max]
 ref|XP_006601920.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Glycine 
max]
 ref|XP_006601921.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X3 [Glycine 
max]
Length=535

 Score =   134 bits (336),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PD  LSL ELAALDMC KRA+FKPMT E++QDLK RCGGSWKL L
Sbjct  74   LEATCSFFRQPANFAPDLDLSLSELAALDMCQKRAIFKPMTTEQRQDLKLRCGGSWKLAL  133

Query  378  RYLLAGEACSRRESSQ  425
            RYL+AGEAC RRE SQ
Sbjct  134  RYLMAGEACCRREKSQ  149



>ref|XP_007159624.1| hypothetical protein PHAVU_002G253100g [Phaseolus vulgaris]
 gb|ESW31618.1| hypothetical protein PHAVU_002G253100g [Phaseolus vulgaris]
Length=534

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFF++PA+F PDF LSL ELAALDMC KRA+FKPMT E+QQDLKQRCGGSWKLVLR+
Sbjct  76   ATCSFFKKPANFAPDFDLSLSELAALDMCQKRAIFKPMTTEQQQDLKQRCGGSWKLVLRF  135

Query  384  LLAGEACSRRESSQ  425
            L+AGEAC RRE SQ
Sbjct  136  LMAGEACCRREKSQ  149



>ref|XP_010682363.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682364.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682365.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4 [Beta vulgaris 
subsp. vulgaris]
Length=541

 Score =   132 bits (332),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +3

Query  207  TCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYL  386
            TCSFF+ PA+F PD+ LS+ ELAALDMC KRA+FKPMT EE+ DLKQRCGGSWKLVLRYL
Sbjct  78   TCSFFKHPANFSPDYDLSIAELAALDMCQKRAIFKPMTDEEKDDLKQRCGGSWKLVLRYL  137

Query  387  LAGEACSRRESSQ  425
            LAGEAC RRE  Q
Sbjct  138  LAGEACCRREKFQ  150



>ref|XP_004310005.1| PREDICTED: ultraviolet-B receptor UVR8 [Fragaria vesca subsp. 
vesca]
 ref|XP_011457427.1| PREDICTED: ultraviolet-B receptor UVR8 [Fragaria vesca subsp. 
vesca]
 ref|XP_011457428.1| PREDICTED: ultraviolet-B receptor UVR8 [Fragaria vesca subsp. 
vesca]
Length=535

 Score =   132 bits (331),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
               TCSFFRQPA+F PDF L + ELAALDMC KRA+FKPMT E++Q+LKQ+CGGSWKLVL
Sbjct  75   LEGTCSFFRQPANFAPDFDLCISELAALDMCQKRAIFKPMTTEQRQELKQKCGGSWKLVL  134

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  135  RFLLAGEACFRREKSQ  150



>ref|XP_006341781.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341782.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X2 [Solanum tuberosum]
Length=533

 Score =   131 bits (330),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PD +LSL ELAALDMC KRA+FKPMTQE+  DLK +CGGSWKLVL
Sbjct  72   LEATCSFFRQPANFAPDNELSLAELAALDMCRKRAIFKPMTQEQCHDLKLKCGGSWKLVL  131

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEACSRRE S 
Sbjct  132  RFLLAGEACSRREKSH  147



>ref|XP_004962592.1| PREDICTED: ultraviolet-B receptor UVR8-like [Setaria italica]
Length=534

 Score =   131 bits (330),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATC+FFR+PA+FPPDF LS+ ELAALDMC KRA+FKPMT  E++  KQRCGGSWKLVL
Sbjct  75   LEATCTFFRKPANFPPDFDLSMSELAALDMCQKRAIFKPMTAHERELFKQRCGGSWKLVL  134

Query  378  RYLLAGEACSRRESSQ  425
            R+++AGEAC RRE SQ
Sbjct  135  RFIMAGEACCRREKSQ  150



>ref|NP_001066582.1| Os12g0284000 [Oryza sativa Japonica Group]
 gb|ABA97465.1| regulator of chromosome condensation, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABA97466.1| regulator of chromosome condensation, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABA97467.2| regulator of chromosome condensation, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29601.1| Os12g0284000 [Oryza sativa Japonica Group]
 dbj|BAG89336.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89767.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93803.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53047.1| hypothetical protein OsJ_35777 [Oryza sativa Japonica Group]
Length=534

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+FPPDFQLS+ ELAALDMC KRA+FKPMTQ+E++  KQRCGGSWKLVL
Sbjct  75   LEATCSFFRKPANFPPDFQLSMSELAALDMCQKRAIFKPMTQQEREMFKQRCGGSWKLVL  134

Query  378  RYLLAGEACSRRESSQ  425
            R+++AGEAC RRE SQ
Sbjct  135  RFIMAGEACCRREKSQ  150



>gb|EEC69101.1| hypothetical protein OsI_38005 [Oryza sativa Indica Group]
Length=534

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFFR+PA+FPPDFQLS+ ELAALDMC KRA+FKPMTQ+E++  KQRCGGSWKLVLR+
Sbjct  77   ATCSFFRKPANFPPDFQLSMSELAALDMCQKRAIFKPMTQQEREMFKQRCGGSWKLVLRF  136

Query  384  LLAGEACSRRESSQ  425
            ++AGEAC RRE SQ
Sbjct  137  IMAGEACCRREKSQ  150



>ref|XP_006663947.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006663948.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X2 [Oryza brachyantha]
 ref|XP_006663949.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X3 [Oryza brachyantha]
Length=534

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATC+FFR+PA+FPPDFQLS+ ELAALDMC KRAVFKPM QEE++  KQRCGGSWKLVLR+
Sbjct  77   ATCTFFRKPANFPPDFQLSMSELAALDMCQKRAVFKPMNQEEREMFKQRCGGSWKLVLRF  136

Query  384  LLAGEACSRRESSQ  425
            ++AGEAC RRE SQ
Sbjct  137  IMAGEACCRREKSQ  150



>ref|XP_010929984.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X2 [Elaeis guineensis]
Length=534

 Score =   130 bits (327),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATC+FFR+PA+F PDF+LS+ ELAALDMC KRA+FKPM  EE++ LKQRCG SWKLVL
Sbjct  74   LEATCTFFRKPANFAPDFELSISELAALDMCQKRAIFKPMKNEEREYLKQRCGSSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            RYLLAGEAC RRE SQ
Sbjct  134  RYLLAGEACCRREKSQ  149



>ref|XP_007222373.1| hypothetical protein PRUPE_ppa004014mg [Prunus persica]
 gb|EMJ23572.1| hypothetical protein PRUPE_ppa004014mg [Prunus persica]
Length=469

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PDF+LS+ ELAALDMC KR +FKPMT E++Q+LKQRCGGSWKLVL
Sbjct  75   LEATCSFFRQPANFAPDFELSISELAALDMCQKRGIFKPMTAEQRQELKQRCGGSWKLVL  134

Query  378  RYLLAGEACSRRESSQ  425
            ++LLAGEAC RRE SQ
Sbjct  135  KFLLAGEACFRREKSQ  150



>gb|KJB31066.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
Length=455

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PD++LS+ ELAALDMC +RA+FKPMT EE+Q LK RCGGSWKLVL
Sbjct  74   LEATCSFFRQPANFAPDYELSISELAALDMCQRRAIFKPMTDEERQSLKHRCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  134  RFLLAGEACCRREKSQ  149



>gb|KJB31065.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
Length=535

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFFRQPA+F PD++LS+ ELAALDMC +RA+FKPMT EE+Q LK RCGGSWKLVLR+
Sbjct  76   ATCSFFRQPANFAPDYELSISELAALDMCQRRAIFKPMTDEERQSLKHRCGGSWKLVLRF  135

Query  384  LLAGEACSRRESSQ  425
            LLAGEAC RRE SQ
Sbjct  136  LLAGEACCRREKSQ  149



>gb|KHN44387.1| Putative E3 ubiquitin-protein ligase HERC4 [Glycine soja]
Length=475

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +3

Query  201  NATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLR  380
            +ATCSFFRQPA+F PD  LSL ELAALDMC KRA+FKPMT E++QDLK RCGGSWKLVLR
Sbjct  78   SATCSFFRQPANFAPDSDLSLSELAALDMCQKRAIFKPMTTEQRQDLKLRCGGSWKLVLR  137

Query  381  YLLAGEACSRRESSQ  425
            YL+AGEAC RRE SQ
Sbjct  138  YLMAGEACCRREKSQ  152



>emb|CAN77314.1| hypothetical protein VITISV_008041 [Vitis vinifera]
Length=541

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +3

Query  201  NATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLR  380
            +ATCSFFRQPAHF PDF+LS+ ELAALDMC KRA+F+PM  EE++ LKQRCGGSWKLVLR
Sbjct  77   SATCSFFRQPAHFAPDFELSISELAALDMCLKRAIFRPMXLEEREVLKQRCGGSWKLVLR  136

Query  381  YLLAGEACSRRESSQ  425
            +LLAGEAC RRE SQ
Sbjct  137  FLLAGEACCRREKSQ  151



>ref|XP_009387758.1| PREDICTED: ultraviolet-B receptor UVR8-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009387759.1| PREDICTED: ultraviolet-B receptor UVR8-like [Musa acuminata subsp. 
malaccensis]
Length=534

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
               TC+FFR+PA+F PDFQLS+ ELAALDMC KRA+FKPMT EE+  LKQRCGGSWKLVL
Sbjct  74   LEVTCTFFRKPANFTPDFQLSITELAALDMCQKRAIFKPMTSEERGFLKQRCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            RY+LAGEAC RRE+SQ
Sbjct  134  RYILAGEACCRRENSQ  149



>gb|KHN24115.1| E3 ubiquitin-protein ligase HERC2 [Glycine soja]
Length=546

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFFRQPA+F PD  LSL ELAALDMC KRA+FKPMT E++QDLK RCGGSWKL LRY
Sbjct  87   ATCSFFRQPANFAPDLDLSLSELAALDMCQKRAIFKPMTTEQRQDLKLRCGGSWKLALRY  146

Query  384  LLAGEACSRRESSQ  425
            L+AGEAC RRE SQ
Sbjct  147  LMAGEACCRREKSQ  160



>ref|XP_010514248.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010514249.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010514250.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
Length=534

 Score =   128 bits (321),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM +EE+Q++K+RCGGS
Sbjct  69   RDLANLEATCSFFSQPANFAPDCNLSLPELAALDMCNKRVIFKPMNEEERQEMKRRCGGS  128

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RRE SQ
Sbjct  129  WKLVLRFLLAGEACCRREKSQ  149



>ref|XP_010044521.1| PREDICTED: ultraviolet-B receptor UVR8 [Eucalyptus grandis]
 ref|XP_010044522.1| PREDICTED: ultraviolet-B receptor UVR8 [Eucalyptus grandis]
 gb|KCW86609.1| hypothetical protein EUGRSUZ_B03238 [Eucalyptus grandis]
Length=531

 Score =   127 bits (320),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PD +LS+ E+AALDMC KRA+FKPMT EE+QDLK++CGGSWKLVL
Sbjct  71   LEATCSFFRQPANFDPDQELSVTEIAALDMCQKRAIFKPMTPEERQDLKRKCGGSWKLVL  130

Query  378  RYLLAGEACSRRESSQ  425
             +LLAGE C RRE SQ
Sbjct  131  YFLLAGEICCRREKSQ  146



>ref|XP_010425280.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010425281.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010425282.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
Length=534

 Score =   127 bits (320),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM +EE+Q++K+RCGGS
Sbjct  69   RDLANLEATCSFFSQPANFAPDCNLSLPELAALDMCNKRVIFKPMNEEERQEMKRRCGGS  128

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RRE SQ
Sbjct  129  WKLVLRFLLAGEACCRREKSQ  149



>ref|XP_007159625.1| hypothetical protein PHAVU_002G253200g [Phaseolus vulgaris]
 gb|ESW31619.1| hypothetical protein PHAVU_002G253200g [Phaseolus vulgaris]
Length=534

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFF+QPA+F PDF LSL ELAALDMC KR +FKPMT E+QQ LKQ CGGSWKLVL
Sbjct  74   LEATCSFFKQPANFEPDFDLSLSELAALDMCQKRVIFKPMTTEQQQHLKQICGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  134  RFLLAGEACCRREKSQ  149



>ref|XP_006290883.1| hypothetical protein CARUB_v10016992mg [Capsella rubella]
 gb|EOA23781.1| hypothetical protein CARUB_v10016992mg [Capsella rubella]
Length=533

 Score =   127 bits (318),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATC+FF QPA+F PD  LSL ELA+LDMC+KRA+FKPM +EE+Q++K+RCGGS
Sbjct  68   RDLANLEATCTFFSQPANFAPDCTLSLPELASLDMCNKRAIFKPMNEEERQEMKRRCGGS  127

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RRE SQ
Sbjct  128  WKLVLRFLLAGEACCRREKSQ  148



>gb|KHN06528.1| E3 ubiquitin-protein ligase HERC2 [Glycine soja]
Length=537

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFF++PA+F PDF LSL ELAALDMC KRA+F PMT E++Q LKQRCGGSWKLVLR+
Sbjct  79   ATCSFFKRPANFDPDFDLSLSELAALDMCQKRAIFNPMTTEQRQHLKQRCGGSWKLVLRF  138

Query  384  LLAGEACSRRESSQ  425
            LLAGEAC RRE SQ
Sbjct  139  LLAGEACYRREKSQ  152



>ref|XP_003524245.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Glycine 
max]
 ref|XP_006580239.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Glycine 
max]
Length=534

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFF++PA+F PDF LSL ELAALDMC KRA+F PMT E++Q LKQRCGGSWKLVL
Sbjct  74   LEATCSFFKRPANFDPDFDLSLSELAALDMCQKRAIFNPMTTEQRQHLKQRCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  134  RFLLAGEACYRREKSQ  149



>emb|CDY04192.1| BnaA09g19700D [Brassica napus]
Length=492

 Score =   125 bits (315),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM +EE++ +K+RCGGS
Sbjct  27   RDLANLEATCSFFSQPANFAPDCSLSLPELAALDMCNKRMIFKPMKEEEREGMKRRCGGS  86

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RRE SQ
Sbjct  87   WKLVLRFLLAGEACCRREKSQ  107



>ref|NP_974362.1| regulator of chromosome condensation repeat-containing protein 
[Arabidopsis thaliana]
 dbj|BAB01075.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAF02074.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77117.1| regulator of chromosome condensation repeat-containing protein 
[Arabidopsis thaliana]
Length=532

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM +EE+Q++K+RCGGS
Sbjct  67   RDLANLEATCSFFSQPANFAPDINLSLSELAALDMCNKRVIFKPMNEEERQEMKRRCGGS  126

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RRE SQ
Sbjct  127  WKLVLRFLLAGEACCRREKSQ  147



>ref|XP_002875307.1| regulator of chromosome condensation family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH51566.1| regulator of chromosome condensation family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=533

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM +EE+Q++K+RCGGS
Sbjct  68   RDLANLEATCSFFSQPANFAPDINLSLSELAALDMCNKRVIFKPMNEEERQEMKRRCGGS  127

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RRE SQ
Sbjct  128  WKLVLRFLLAGEACCRREKSQ  148



>ref|XP_010929983.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Elaeis guineensis]
Length=556

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATC+FFR+PA+F PDF+LS+ ELAALDMC KRA+FKPM  EE++ LKQRCG SWKLVL
Sbjct  96   LEATCTFFRKPANFAPDFELSISELAALDMCQKRAIFKPMKNEEREYLKQRCGSSWKLVL  155

Query  378  RYLLAGEACSRRESSQ  425
            RYLLAGEAC RRE SQ
Sbjct  156  RYLLAGEACCRREKSQ  171



>ref|XP_008446114.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Cucumis melo]
 ref|XP_008446116.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Cucumis melo]
 ref|XP_008446117.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Cucumis melo]
 ref|XP_008446118.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Cucumis melo]
Length=534

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PD++LS+ ELAALDMC KRA+FKPMT E+ Q LKQRCGGSWKLVL
Sbjct  74   LEATCSFFRQPANFAPDYELSISELAALDMCRKRAIFKPMTPEQHQALKQRCGGSWKLVL  133

Query  378  RYLLAGEACSRRESS  422
            R+L+AGE+C RRE S
Sbjct  134  RFLVAGESCCRREKS  148



>gb|KHN29007.1| E3 ubiquitin-protein ligase HERC2 [Glycine soja]
Length=542

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFF+QPA+F PDF LSL ELAALDMC KRA+FKPMT E++Q LKQRCGGSWKLVLR+
Sbjct  82   ATCSFFKQPANFAPDFDLSLSELAALDMCQKRAIFKPMTTEQRQHLKQRCGGSWKLVLRF  141

Query  384  LLAGEA-CSRRESSQ  425
            LLAGEA C RRE SQ
Sbjct  142  LLAGEACCRRREKSQ  156



>ref|XP_008446119.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X2 [Cucumis melo]
Length=467

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PD++LS+ ELAALDMC KRA+FKPMT E+ Q LKQRCGGSWKLVL
Sbjct  74   LEATCSFFRQPANFAPDYELSISELAALDMCRKRAIFKPMTPEQHQALKQRCGGSWKLVL  133

Query  378  RYLLAGEACSRRESS  422
            R+L+AGE+C RRE S
Sbjct  134  RFLVAGESCCRREKS  148



>ref|XP_003531318.1| PREDICTED: ultraviolet-B receptor UVR8-like isoformX1 [Glycine 
max]
 ref|XP_006585244.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Glycine 
max]
 ref|XP_006585245.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X3 [Glycine 
max]
 ref|XP_006585246.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X4 [Glycine 
max]
Length=539

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFF+QPA+F PDF LSL ELAALDMC KRA+FKPMT E++Q LKQRCGGSWKLVL
Sbjct  77   LEATCSFFKQPANFAPDFDLSLSELAALDMCQKRAIFKPMTTEQRQHLKQRCGGSWKLVL  136

Query  378  RYLLAGEA-CSRRESSQ  425
            R+LLAGEA C RRE SQ
Sbjct  137  RFLLAGEACCRRREKSQ  153



>ref|XP_003578713.1| PREDICTED: ultraviolet-B receptor UVR8 [Brachypodium distachyon]
Length=534

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATC FFR+PA+FPPDFQL + ELAALDMCHKRA+FK MT +E++  KQRCGGSWKLVL
Sbjct  75   LEATCKFFRKPANFPPDFQLPMSELAALDMCHKRAIFKHMTTQEREMFKQRCGGSWKLVL  134

Query  378  RYLLAGEACSRRESSQ  425
            R+++AGEAC RRE SQ
Sbjct  135  RFIMAGEACCRREKSQ  150



>gb|KJB60982.1| hypothetical protein B456_009G334300 [Gossypium raimondii]
Length=329

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PD++LS+ ELAALD+C KRA+FKPMT EE Q+LK++CGGSWKL L
Sbjct  74   LEATCSFFRRPANFTPDYELSISELAALDICQKRAIFKPMTDEECQNLKRKCGGSWKLAL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  134  RFLLAGEACCRREKSQ  149



>ref|XP_008796028.1| PREDICTED: ultraviolet-B receptor UVR8 [Phoenix dactylifera]
 ref|XP_008796029.1| PREDICTED: ultraviolet-B receptor UVR8 [Phoenix dactylifera]
Length=534

 Score =   124 bits (312),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATC+FFR+PA+F PDF+L + ELAALD+C KRA+FKP+  EE++ LKQ CGGSWKLVL
Sbjct  74   LEATCTFFRKPANFAPDFELPISELAALDLCQKRAIFKPLKNEEREYLKQCCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            RYLLAGEAC RRE SQ
Sbjct  134  RYLLAGEACCRRERSQ  149



>gb|KJB60981.1| hypothetical protein B456_009G334300 [Gossypium raimondii]
Length=342

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFFR+PA+F PD++LS+ ELAALD+C KRA+FKPMT EE Q+LK++CGGSWKL LR+
Sbjct  76   ATCSFFRRPANFTPDYELSISELAALDICQKRAIFKPMTDEECQNLKRKCGGSWKLALRF  135

Query  384  LLAGEACSRRESSQ  425
            LLAGEAC RRE SQ
Sbjct  136  LLAGEACCRREKSQ  149



>gb|KHG25634.1| E3 ubiquitin-protein ligase HERC2 [Gossypium arboreum]
Length=515

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFFR+PA+F PD++LS+ ELAALD+C KRA+FKPMT EE Q+LK++CGGSWKL LR+
Sbjct  57   ATCSFFRRPANFTPDYELSISELAALDICKKRAIFKPMTDEECQNLKRKCGGSWKLALRF  116

Query  384  LLAGEACSRRESSQ  425
            LLAGEAC RRE SQ
Sbjct  117  LLAGEACCRREKSQ  130



>emb|CDX99731.1| BnaC02g35890D [Brassica napus]
Length=535

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPAHF PD  LSL ELAALDMC+KR +FKPM+++E++++K+RCGGS
Sbjct  69   RDLANLEATCSFFSQPAHFAPDCSLSLPELAALDMCNKRMIFKPMSEQEREEMKRRCGGS  128

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLRYLLAGEAC RRE SQ
Sbjct  129  WKLVLRYLLAGEACCRREQSQ  149



>ref|XP_009415993.1| PREDICTED: ultraviolet-B receptor UVR8-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009415994.1| PREDICTED: ultraviolet-B receptor UVR8-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009415995.1| PREDICTED: ultraviolet-B receptor UVR8-like [Musa acuminata subsp. 
malaccensis]
Length=534

 Score =   124 bits (311),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATC+FFR+P++F P+ QLS+ ELAALDMC +RA+FKPM  EE++ LKQRCGGS
Sbjct  69   RDLANLEATCTFFRKPSNFAPEVQLSITELAALDMCQERAIFKPMNSEEKELLKQRCGGS  128

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLRY+LAGE C RRE SQ
Sbjct  129  WKLVLRYILAGEICCRREKSQ  149



>ref|XP_010248751.1| PREDICTED: ultraviolet-B receptor UVR8-like [Nelumbo nucifera]
 ref|XP_010248752.1| PREDICTED: ultraviolet-B receptor UVR8-like [Nelumbo nucifera]
 ref|XP_010248754.1| PREDICTED: ultraviolet-B receptor UVR8-like [Nelumbo nucifera]
 ref|XP_010248755.1| PREDICTED: ultraviolet-B receptor UVR8-like [Nelumbo nucifera]
Length=534

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATC FFRQPA+F PD++LS+ ELAALDMC KRA+FKPMT EE++ LKQRCGGSWKLVL
Sbjct  74   LEATCFFFRQPANFAPDYELSISELAALDMCQKRAIFKPMTVEEREVLKQRCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+L AGEAC RRE SQ
Sbjct  134  RFLQAGEACCRREKSQ  149



>ref|XP_010502511.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010502512.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010502513.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010502514.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010502515.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
Length=534

 Score =   124 bits (310),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FK M +EE+Q++K+RCGGS
Sbjct  69   RDLANLEATCSFFSQPANFAPDCNLSLPELAALDMCNKRVIFKRMNEEERQEMKRRCGGS  128

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RRE SQ
Sbjct  129  WKLVLRFLLAGEACCRREKSQ  149



>gb|KJB60983.1| hypothetical protein B456_009G334300 [Gossypium raimondii]
Length=455

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PD++LS+ ELAALD+C KRA+FKPMT EE Q+LK++CGGSWKL L
Sbjct  74   LEATCSFFRRPANFTPDYELSISELAALDICQKRAIFKPMTDEECQNLKRKCGGSWKLAL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  134  RFLLAGEACCRREKSQ  149



>ref|XP_004135288.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2-like [Cucumis 
sativus]
 ref|XP_004159669.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2-like [Cucumis 
sativus]
 gb|KGN51719.1| hypothetical protein Csa_5G593320 [Cucumis sativus]
Length=534

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQPA+F PD++LS+ ELAALDMC KRA+FKPMT E+ + +KQRCGGSWKLVL
Sbjct  74   LEATCSFFRQPANFAPDYELSISELAALDMCRKRAIFKPMTPEQHEAMKQRCGGSWKLVL  133

Query  378  RYLLAGEACSRRESS  422
            R+L+AGE+C RRE S
Sbjct  134  RFLVAGESCCRREKS  148



>gb|KJB60986.1| hypothetical protein B456_009G334300 [Gossypium raimondii]
Length=534

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PD++LS+ ELAALD+C KRA+FKPMT EE Q+LK++CGGSWKL L
Sbjct  74   LEATCSFFRRPANFTPDYELSISELAALDICQKRAIFKPMTDEECQNLKRKCGGSWKLAL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  134  RFLLAGEACCRREKSQ  149



>gb|KJB60980.1| hypothetical protein B456_009G334300 [Gossypium raimondii]
 gb|KJB60984.1| hypothetical protein B456_009G334300 [Gossypium raimondii]
Length=533

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PD++LS+ ELAALD+C KRA+FKPMT EE Q+LK++CGGSWKL L
Sbjct  74   LEATCSFFRRPANFTPDYELSISELAALDICQKRAIFKPMTDEECQNLKRKCGGSWKLAL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEAC RRE SQ
Sbjct  134  RFLLAGEACCRREKSQ  149



>ref|XP_010912915.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010912916.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Elaeis 
guineensis]
Length=534

 Score =   123 bits (309),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  192  SLFNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKL  371
            +   ATC+FFR+PA+F PDF+LS+ ELAALDMC KRA+FK MT EE++ LK+ CG SWKL
Sbjct  72   AYLEATCTFFRKPANFAPDFELSISELAALDMCEKRAIFKHMTMEEKEYLKECCGRSWKL  131

Query  372  VLRYLLAGEACSRRESSQ  425
            VLRYLLAGEAC RRE SQ
Sbjct  132  VLRYLLAGEACCRREKSQ  149



>ref|XP_002515036.1| RCC1 and BTB domain-containing protein, putative [Ricinus communis]
 gb|EEF47590.1| RCC1 and BTB domain-containing protein, putative [Ricinus communis]
Length=537

 Score =   123 bits (308),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 53/67 (79%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +3

Query  225  QPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEAC  404
            QPA+F PD++LS+ ELAALDMC KRA+FKPMT EE++DLKQRCGGSWKLVLR+LLAGEAC
Sbjct  83   QPANFAPDYELSISELAALDMCQKRAIFKPMTSEERRDLKQRCGGSWKLVLRFLLAGEAC  142

Query  405  SRRESSQ  425
             RRE+SQ
Sbjct  143  CRRENSQ  149



>ref|XP_010528070.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X2 [Tarenaya hassleriana]
Length=526

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFF QPA+F PD  LSL ELAALDMC KRA+FKPM +E+ Q++K++CGGSWKLVL
Sbjct  74   LEATCSFFSQPANFAPDSDLSLPELAALDMCRKRAIFKPMNEEQLQEMKRKCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEACSRRE SQ
Sbjct  134  RFLLAGEACSRREKSQ  149



>ref|XP_006395590.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
 gb|ESQ32876.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
Length=329

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM +EE+Q++K+RCGGS
Sbjct  68   RDLANLEATCSFFSQPANFAPDCSLSLPELAALDMCNKRVIFKPMNEEERQEMKRRCGGS  127

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RR  SQ
Sbjct  128  WKLVLRFLLAGEACCRRGKSQ  148



>ref|XP_010528066.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Tarenaya hassleriana]
 ref|XP_010528067.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Tarenaya hassleriana]
 ref|XP_010528068.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Tarenaya hassleriana]
 ref|XP_010528069.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Tarenaya hassleriana]
Length=549

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFF QPA+F PD  LSL ELAALDMC KRA+FKPM +E+ Q++K++CGGSWKLVL
Sbjct  74   LEATCSFFSQPANFAPDSDLSLPELAALDMCRKRAIFKPMNEEQLQEMKRKCGGSWKLVL  133

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEACSRRE SQ
Sbjct  134  RFLLAGEACSRREKSQ  149



>ref|XP_006395591.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
 gb|ESQ32877.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
Length=356

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM +EE+Q++K+RCGGS
Sbjct  68   RDLANLEATCSFFSQPANFAPDCSLSLPELAALDMCNKRVIFKPMNEEERQEMKRRCGGS  127

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RR  SQ
Sbjct  128  WKLVLRFLLAGEACCRRGKSQ  148



>dbj|BAK00885.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATC FFR+PA+FPPDF L + ELAALDMC KRA+FKPM+ +E++  KQRCGGSWKLVL
Sbjct  75   LEATCKFFRKPANFPPDFLLPMSELAALDMCQKRAIFKPMSTQEREMFKQRCGGSWKLVL  134

Query  378  RYLLAGEACSRRESSQ  425
            R+++AGEAC RRE SQ
Sbjct  135  RFIMAGEACCRREKSQ  150



>ref|XP_006395589.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
 ref|XP_006395592.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
 ref|XP_006395593.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
 gb|ESQ32875.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
 gb|ESQ32878.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
 gb|ESQ32879.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
Length=454

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM +EE+Q++K+RCGGS
Sbjct  68   RDLANLEATCSFFSQPANFAPDCSLSLPELAALDMCNKRVIFKPMNEEERQEMKRRCGGS  127

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RR  SQ
Sbjct  128  WKLVLRFLLAGEACCRRGKSQ  148



>ref|XP_006395588.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
 gb|ESQ32874.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
Length=533

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM +EE+Q++K+RCGGS
Sbjct  68   RDLANLEATCSFFSQPANFAPDCSLSLPELAALDMCNKRVIFKPMNEEERQEMKRRCGGS  127

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RR  SQ
Sbjct  128  WKLVLRFLLAGEACCRRGKSQ  148



>ref|XP_009129568.1| PREDICTED: ultraviolet-B receptor UVR8-like [Brassica rapa]
Length=536

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM+++E++++K+RCGGS
Sbjct  70   RDLANLEATCSFFSQPANFAPDCSLSLPELAALDMCNKRMIFKPMSEQEREEMKRRCGGS  129

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RRE SQ
Sbjct  130  WKLVLRFLLAGEACCRREKSQ  150



>ref|XP_009114097.1| PREDICTED: ultraviolet-B receptor UVR8-like [Brassica rapa]
Length=531

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM +EE++ +K+RCGGS
Sbjct  66   RDLANLEATCSFFSQPANFAPDCSLSLPELAALDMCNKRMIFKPMKEEEREGMKRRCGGS  125

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RRE SQ
Sbjct  126  WKLVLRFLLAGEACCRREKSQ  146



>emb|CDY40988.1| BnaA02g27780D [Brassica napus]
Length=549

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM+++E++++K+RCGGS
Sbjct  70   RDLANLEATCSFFSQPANFAPDCSLSLPELAALDMCNKRMIFKPMSEQEREEMKRRCGGS  129

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RRE SQ
Sbjct  130  WKLVLRFLLAGEACCRREKSQ  150



>ref|XP_010250918.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
 ref|XP_010250919.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
 ref|XP_010250920.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
 ref|XP_010250921.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
 ref|XP_010250922.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
 ref|XP_010250923.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
 ref|XP_010250924.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
Length=533

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFFRQPA+F PDF+LS+ ELAALDMC KRA+FKPMT EE++ LKQRCGGSWKLVL +
Sbjct  76   ATCSFFRQPANFSPDFELSITELAALDMCQKRAIFKPMTGEEREGLKQRCGGSWKLVLEF  135

Query  384  LLAGE-ACSRRESS  422
            L AGE AC RRE S
Sbjct  136  LQAGEAACCRREQS  149



>gb|EPS68069.1| hypothetical protein M569_06703, partial [Genlisea aurea]
Length=467

 Score =   119 bits (297),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATC  FR+PA + PD +LSL ELAALD+C KRA+FK MT ++++ LKQRCGGSWKLVLR+
Sbjct  1    ATCLLFREPADYAPDPKLSLAELAALDVCGKRAIFKRMTAQQREALKQRCGGSWKLVLRF  60

Query  384  LLAGEACSRRESSQ  425
            LLAGE+CSRRE SQ
Sbjct  61   LLAGESCSRREKSQ  74



>emb|CDY28863.1| BnaC06g26510D [Brassica napus]
Length=520

 Score =   119 bits (297),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
             +ATCSFFR+PA+F PD +LS+ E+AALD+C KRA+FKPM +EE+Q++K++CGGSWKLVL
Sbjct  64   LHATCSFFRKPANFSPDLELSISEVAALDICQKRAIFKPMGEEERQEIKRKCGGSWKLVL  123

Query  378  RYLLAGEACSRRESSQ  425
             +LLAGE   RRE SQ
Sbjct  124  SFLLAGEFGYRREKSQ  139



>ref|XP_010912917.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Elaeis 
guineensis]
Length=455

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  192  SLFNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKL  371
            +   ATC+FFR+PA+F PDF+LS+ ELAALDMC KRA+FK MT EE++ LK+ CG SWKL
Sbjct  72   AYLEATCTFFRKPANFAPDFELSISELAALDMCEKRAIFKHMTMEEKEYLKECCGRSWKL  131

Query  372  VLRYLLAGEACSRRESSQ  425
            VLRYLLAGEAC RRE SQ
Sbjct  132  VLRYLLAGEACCRREKSQ  149



>emb|CDY56518.1| BnaA07g38600D [Brassica napus]
Length=520

 Score =   117 bits (292),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
             +ATCSFFR+PA+F PD +LS+ E+AALD+C KRA+FK M +EE+Q++K++CGGSWKLVL
Sbjct  64   LHATCSFFRKPANFSPDLELSISEVAALDICQKRAIFKRMGEEERQEIKRKCGGSWKLVL  123

Query  378  RYLLAGEACSRRESSQ  425
            ++LLAGE   RRE SQ
Sbjct  124  KFLLAGEFGYRREKSQ  139



>emb|CDY39172.1| BnaC09g21720D [Brassica napus]
Length=492

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM +EE++ +K+RCGGSWKLVL
Sbjct  32   LEATCSFFSQPANFAPDCSLSLPELAALDMCNKRMIFKPMKEEEREGMKRRCGGSWKLVL  91

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEA  RRE SQ
Sbjct  92   RFLLAGEASCRREKSQ  107



>ref|XP_009105101.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X3 [Brassica 
rapa]
Length=535

 Score =   116 bits (290),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PD +LS+ E+AALD+C KRA+FK M +EE+Q++K++CGGSWKLVL
Sbjct  80   LEATCSFFRKPANFSPDLELSISEVAALDICQKRAIFKRMGEEERQEIKRKCGGSWKLVL  139

Query  378  RYLLAGEACSRRESSQ  425
            ++LLAGE   RRE SQ
Sbjct  140  KFLLAGEFGYRREKSQ  155



>ref|XP_009105098.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Brassica 
rapa]
 ref|XP_009105099.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Brassica 
rapa]
 ref|XP_009105100.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Brassica 
rapa]
Length=536

 Score =   115 bits (289),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PD +LS+ E+AALD+C KRA+FK M +EE+Q++K++CGGSWKLVL
Sbjct  80   LEATCSFFRKPANFSPDLELSISEVAALDICQKRAIFKRMGEEERQEIKRKCGGSWKLVL  139

Query  378  RYLLAGEACSRRESSQ  425
            ++LLAGE   RRE SQ
Sbjct  140  KFLLAGEFGYRREKSQ  155



>ref|XP_010556194.1| PREDICTED: ultraviolet-B receptor UVR8-like [Tarenaya hassleriana]
 ref|XP_010556195.1| PREDICTED: ultraviolet-B receptor UVR8-like [Tarenaya hassleriana]
 ref|XP_010556196.1| PREDICTED: ultraviolet-B receptor UVR8-like [Tarenaya hassleriana]
 ref|XP_010556197.1| PREDICTED: ultraviolet-B receptor UVR8-like [Tarenaya hassleriana]
Length=526

 Score =   115 bits (289),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PD +LS+ E+AALDMC KR VF+ M++E ++++K RCGGSWKLVL
Sbjct  73   LEATCSFFRRPANFAPDAELSISEIAALDMCQKRVVFRSMSEEGRREIKTRCGGSWKLVL  132

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGEA  RRE SQ
Sbjct  133  RFLLAGEAGCRREKSQ  148



>ref|XP_002887142.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63401.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=542

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
            F ATCSFFR+PA+F PDF LS+ E+AALD+C KRA+FK M +EE+Q++K+RCGGSWKLVL
Sbjct  86   FMATCSFFRKPANFSPDFDLSISEVAALDICQKRAIFKCMGEEERQEIKRRCGGSWKLVL  145

Query  378  RYLLAGEACSRRESSQ  425
            ++LLAGE   RRE SQ
Sbjct  146  KFLLAGEFGCRREKSQ  161



>ref|XP_006852257.1| hypothetical protein AMTR_s00049p00167370 [Amborella trichopoda]
 gb|ERN13724.1| hypothetical protein AMTR_s00049p00167370 [Amborella trichopoda]
Length=536

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFFRQPA+F PD +LS+ ELAA  MC +RA+FKPMT+EE+  LK+RCGGSWKLVLR+
Sbjct  78   ATCSFFRQPANFAPDNELSISELAAFLMCRERAIFKPMTEEERGALKKRCGGSWKLVLRF  137

Query  384  LLAGEACSRRESSQ  425
            L  GEAC RRE SQ
Sbjct  138  LKIGEACYRREKSQ  151



>ref|XP_010100324.1| hypothetical protein L484_027632 [Morus notabilis]
 gb|EXB82458.1| hypothetical protein L484_027632 [Morus notabilis]
Length=524

 Score =   114 bits (285),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  222  RQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEA  401
            +QPA F PD +LSL ELAALDMC KRA+F+PMT EE+ +LK+ CGGSWKLVLR+LLAGEA
Sbjct  71   KQPADFTPDTELSLPELAALDMCQKRAIFRPMTNEERLELKRICGGSWKLVLRFLLAGEA  130

Query  402  CSRRESSQ  425
            CSRRE SQ
Sbjct  131  CSRREKSQ  138



>emb|CDY01845.1| BnaC06g28850D [Brassica napus]
Length=517

 Score =   113 bits (283),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/74 (65%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFFR+PA+F PD QLS+ E+AALD+C K++VF+ M +E++Q++K++CGGSWKLVLR+
Sbjct  64   ATCSFFRKPANFSPDLQLSISEVAALDICQKKSVFERMGEEDRQEIKRKCGGSWKLVLRF  123

Query  384  LLAGEACSRRESSQ  425
            LLAGE   RRE SQ
Sbjct  124  LLAGELGCRREKSQ  137



>ref|XP_010511732.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Camelina 
sativa]
Length=531

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PDF LS+ ELAALD+C KRA+FK M +EE+Q++K++CGGSWKLVL
Sbjct  77   LEATCSFFRKPANFSPDFDLSISELAALDICQKRAIFKCMGEEERQEMKRKCGGSWKLVL  136

Query  378  RYLLAGEACSRRESSQ  425
             +LLAGE   RRE SQ
Sbjct  137  NFLLAGEFGCRREKSQ  152



>ref|XP_010511729.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Camelina 
sativa]
 ref|XP_010511730.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Camelina 
sativa]
 ref|XP_010511731.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Camelina 
sativa]
Length=532

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PDF LS+ ELAALD+C KRA+FK M +EE+Q++K++CGGSWKLVL
Sbjct  77   LEATCSFFRKPANFSPDFDLSISELAALDICQKRAIFKCMGEEERQEMKRKCGGSWKLVL  136

Query  378  RYLLAGEACSRRESSQ  425
             +LLAGE   RRE SQ
Sbjct  137  NFLLAGEFGCRREKSQ  152



>ref|XP_003579993.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 [Brachypodium 
distachyon]
Length=548

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATC FFR PA+FPPD  LSL ELAA DMC +RA+FKPM  +E++ LKQRCGGSWKLVLRY
Sbjct  80   ATCKFFRDPANFPPDLALSLPELAAFDMCQERAMFKPMKPKEKEWLKQRCGGSWKLVLRY  139

Query  384  LLAGEACSRRESSQ  425
            +L GE   RRE SQ
Sbjct  140  ILVGEKNYRREKSQ  153



>ref|XP_010927591.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 [Elaeis 
guineensis]
Length=532

 Score =   112 bits (280),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFF+QPA+FPPDF LSL ELAA DMC KR  FK M +EE++ LK+RCGGSWKLVL
Sbjct  80   LEATCSFFKQPANFPPDFSLSLPELAAFDMCLKRVSFKAMMEEEREVLKRRCGGSWKLVL  139

Query  378  RYLLAGEACSRRESSQ  425
            ++LLA E  +RR   Q
Sbjct  140  KFLLAVETSTRRGKPQ  155



>ref|XP_009152081.1| PREDICTED: ultraviolet-B receptor UVR8 [Brassica rapa]
 ref|XP_009152082.1| PREDICTED: ultraviolet-B receptor UVR8 [Brassica rapa]
 ref|XP_009152083.1| PREDICTED: ultraviolet-B receptor UVR8 [Brassica rapa]
 ref|XP_009152084.1| PREDICTED: ultraviolet-B receptor UVR8 [Brassica rapa]
 ref|XP_009152085.1| PREDICTED: ultraviolet-B receptor UVR8 [Brassica rapa]
Length=529

 Score =   112 bits (279),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM +EE++++K+RCGGS
Sbjct  63   RDLANLEATCSFFSQPANFAPDCSLSLSELAALDMCNKRVIFKPMNEEEREEMKRRCGGS  122

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RRE SQ
Sbjct  123  WKLVLRFLLAGEACCRREKSQ  143



>ref|XP_002987523.1| hypothetical protein SELMODRAFT_126315 [Selaginella moellendorffii]
 gb|EFJ11359.1| hypothetical protein SELMODRAFT_126315 [Selaginella moellendorffii]
Length=508

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR  A+F PD  LSL ELAALDMC +RA+F+PMT EE++ LK+ CGGSWKLVL
Sbjct  47   LEATCSFFRHAANFTPDVTLSLSELAALDMCKRRAIFRPMTSEERESLKESCGGSWKLVL  106

Query  378  RYLLAGEACSRRESSQ  425
            R+L AGE C RRE  Q
Sbjct  107  RFLKAGELCYRREKIQ  122



>emb|CDY13609.1| BnaA06g33140D [Brassica napus]
Length=529

 Score =   112 bits (279),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LSL ELAALDMC+KR +FKPM +EE++++K+RCGGS
Sbjct  63   RDLANLEATCSFFSQPANFAPDCSLSLSELAALDMCNKRVIFKPMNEEEREEMKRRCGGS  122

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RRE SQ
Sbjct  123  WKLVLRFLLAGEACCRREKSQ  143



>emb|CDX96062.1| BnaA07g26690D [Brassica napus]
Length=518

 Score =   111 bits (278),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 47/74 (64%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFFR+PA+F PD QLS+ E+AALD+C K+++F+ M +E++Q++K++CGGSWKLVLR+
Sbjct  65   ATCSFFRKPANFSPDLQLSISEVAALDICLKKSIFERMGEEDRQEIKRKCGGSWKLVLRF  124

Query  384  LLAGEACSRRESSQ  425
            LLAGE   RRE SQ
Sbjct  125  LLAGELGCRREKSQ  138



>ref|XP_002987735.1| hypothetical protein SELMODRAFT_426505 [Selaginella moellendorffii]
 gb|EFJ11310.1| hypothetical protein SELMODRAFT_426505 [Selaginella moellendorffii]
Length=539

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR  A+F PD  LSL ELAALDMC +RA+F+PMT EE++ LK+ CGGSWKLVL
Sbjct  78   LEATCSFFRHAANFTPDVTLSLSELAALDMCKRRAIFRPMTSEERESLKESCGGSWKLVL  137

Query  378  RYLLAGEACSRRESSQ  425
            R+L AGE C RRE  Q
Sbjct  138  RFLKAGELCYRREKIQ  153



>ref|XP_009105326.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Brassica 
rapa]
Length=536

 Score =   111 bits (278),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PD QLS+ E+AALD+C K+++F+ M +E++Q++K++CGGSWKLVL
Sbjct  82   LEATCSFFRKPANFSPDLQLSISEVAALDICLKKSIFEHMGEEDRQEIKRKCGGSWKLVL  141

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGE   RRE SQ
Sbjct  142  RFLLAGELGCRREKSQ  157



>emb|CDX83586.1| BnaC07g23260D [Brassica napus]
Length=529

 Score =   111 bits (277),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 2/81 (2%)
 Frame = +3

Query  189  RSLFN--ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGS  362
            R L N  ATCSFF QPA+F PD  LS+ ELAALDMC+KR +FKPM +EE++++K+RCGGS
Sbjct  63   RDLANLEATCSFFSQPANFAPDCSLSIAELAALDMCNKRVIFKPMNEEEREEMKRRCGGS  122

Query  363  WKLVLRYLLAGEACSRRESSQ  425
            WKLVLR+LLAGEAC RRE SQ
Sbjct  123  WKLVLRFLLAGEACCRREKSQ  143



>ref|XP_006391225.1| hypothetical protein EUTSA_v10018382mg [Eutrema salsugineum]
 gb|ESQ28511.1| hypothetical protein EUTSA_v10018382mg [Eutrema salsugineum]
Length=534

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFFR PA+F PD +LS+ E+AALD C KRA+FK M +EE+Q++K++CGGSWKLVLR+
Sbjct  83   ATCSFFRMPANFSPDLELSISEVAALDRCQKRAIFKRMGEEERQEIKRKCGGSWKLVLRF  142

Query  384  LLAGEACSRRESSQ  425
            LLAGE   RRE SQ
Sbjct  143  LLAGEFGCRREKSQ  156



>ref|XP_010415359.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X1 
[Camelina sativa]
 ref|XP_010415360.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X1 
[Camelina sativa]
 ref|XP_010415361.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X2 
[Camelina sativa]
Length=532

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PDF LS+ ELAALD+C KR +FK M  EE+Q++K++CGGSWKLVL
Sbjct  77   LEATCSFFRKPANFSPDFDLSISELAALDICQKRVIFKCMGDEERQEMKRKCGGSWKLVL  136

Query  378  RYLLAGEACSRRESSQ  425
             +LLAGE   RRE SQ
Sbjct  137  NFLLAGEFGCRREKSQ  152



>ref|XP_006391226.1| hypothetical protein EUTSA_v10018382mg [Eutrema salsugineum]
 gb|ESQ28512.1| hypothetical protein EUTSA_v10018382mg [Eutrema salsugineum]
Length=535

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATCSFFR PA+F PD +LS+ E+AALD C KRA+FK M +EE+Q++K++CGGSWKLVLR+
Sbjct  83   ATCSFFRMPANFSPDLELSISEVAALDRCQKRAIFKRMGEEERQEIKRKCGGSWKLVLRF  142

Query  384  LLAGEACSRRESSQ  425
            LLAGE   RRE SQ
Sbjct  143  LLAGEFGCRREKSQ  156



>ref|XP_010470700.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Camelina 
sativa]
Length=531

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PDF LS+ ELAALD+C KR +FK M +EE+Q++K++CGGSWKLVL
Sbjct  77   LEATCSFFRKPANFSPDFDLSISELAALDICQKRVIFKCMGEEERQEMKRKCGGSWKLVL  136

Query  378  RYLLAGEACSRRESSQ  425
             +L+AGE   RRE SQ
Sbjct  137  NFLIAGEFGCRREKSQ  152



>ref|XP_010470697.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Camelina 
sativa]
 ref|XP_010470698.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Camelina 
sativa]
 ref|XP_010470699.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Camelina 
sativa]
Length=532

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PDF LS+ ELAALD+C KR +FK M +EE+Q++K++CGGSWKLVL
Sbjct  77   LEATCSFFRKPANFSPDFDLSISELAALDICQKRVIFKCMGEEERQEMKRKCGGSWKLVL  136

Query  378  RYLLAGEACSRRESSQ  425
             +L+AGE   RRE SQ
Sbjct  137  NFLIAGEFGCRREKSQ  152



>ref|XP_008798796.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1 [Phoenix 
dactylifera]
Length=538

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFF+QPA+F PDF LSL E+AALDMC KR +FK M +EE++ LKQRCGGSWKLVL
Sbjct  75   LEATCSFFKQPANFAPDFSLSLPEVAALDMCLKRTIFKAMVEEEREVLKQRCGGSWKLVL  134

Query  378  RYLLAGEACSRRESSQ  425
            ++L A E+ +RR  SQ
Sbjct  135  KFLQAAESSTRRGKSQ  150



>ref|XP_004975996.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2-like [Setaria 
italica]
Length=544

 Score =   109 bits (273),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +3

Query  195  LFNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLV  374
            LF+ TC FFR PA+F PD  LSL ELAALD C ++A+FK M  EE++ LKQ+CGGSWKLV
Sbjct  84   LFHGTCKFFRSPANFEPDAALSLPELAALDTCCQKAMFKSMKHEEKEKLKQQCGGSWKLV  143

Query  375  LRYLLAGEACSRRESSQ  425
            L YLL GE   RRE SQ
Sbjct  144  LGYLLVGEKNYRREKSQ  160



>ref|XP_009105322.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Brassica 
rapa]
 ref|XP_009105323.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Brassica 
rapa]
 ref|XP_009105324.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Brassica 
rapa]
 ref|XP_009105325.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Brassica 
rapa]
Length=537

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PD QLS+ E+AALD+C K+++F+ M +E++Q++K++CGGSWKLVL
Sbjct  82   LEATCSFFRKPANFSPDLQLSISEVAALDICLKKSIFEHMGEEDRQEIKRKCGGSWKLVL  141

Query  378  RYLLAGEACSRRESSQ  425
            R+LLAGE   RRE SQ
Sbjct  142  RFLLAGELGCRREKSQ  157



>ref|XP_006653534.1| PREDICTED: ultraviolet-B receptor UVR8-like [Oryza brachyantha]
Length=541

 Score =   108 bits (269),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATC FFR+PA F PD  L L E+AA DMC KRA+FK M QEE++ LKQRCGGSWK VL
Sbjct  75   LEATCKFFRKPASFSPDLSLPLPEIAAYDMCQKRAMFK-MKQEEKELLKQRCGGSWKNVL  133

Query  378  RYLLAGEACSRRESSQ  425
            RY+L GE   RRE SQ
Sbjct  134  RYILVGEKNYRREKSQ  149



>gb|ABA97468.1| regulator of chromosome condensation, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABA97469.1| regulator of chromosome condensation, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABG21962.1| regulator of chromosome condensation, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABG21963.1| regulator of chromosome condensation, putative, expressed [Oryza 
sativa Japonica Group]
Length=439

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  261  LXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEACSRRESSQ  425
            + ELAALDMC KRA+FKPMTQ+E++  KQRCGGSWKLVLR+++AGEAC RRE SQ
Sbjct  1    MSELAALDMCQKRAIFKPMTQQEREMFKQRCGGSWKLVLRFIMAGEACCRREKSQ  55



>ref|XP_002454125.1| hypothetical protein SORBIDRAFT_04g024990 [Sorghum bicolor]
 gb|EES07101.1| hypothetical protein SORBIDRAFT_04g024990 [Sorghum bicolor]
Length=535

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATC+FF +PA+F P+F LSL ELAA DMC KR +FK M QE+Q+ LKQRCGGSWK VL
Sbjct  78   LEATCTFFSKPANFAPNFALSLPELAAFDMCQKRTMFKLMKQEDQECLKQRCGGSWKHVL  137

Query  378  RYLLAGEACSRR  413
            +Y+L  E    R
Sbjct  138  KYILVREKNGSR  149



>ref|XP_006647457.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like [Oryza brachyantha]
Length=537

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATC+FF +PA+F P+  LSL E+AA DMCHKR + K MTQEE++ LKQRCGGSWKLV RY
Sbjct  80   ATCTFFSKPANFAPNLALSLPEVAAFDMCHKRPMIKTMTQEEKEHLKQRCGGSWKLVFRY  139

Query  384  LLAGE  398
            ++  E
Sbjct  140  IVVRE  144



>ref|XP_004952987.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X1 
[Setaria italica]
Length=539

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATC+FF +PA+F P+F LSL ELAA DMC KR +FK M +EE++ LKQRCG SWK VL
Sbjct  78   LEATCTFFSKPANFAPNFALSLPELAAFDMCQKRTMFKLMNEEEKECLKQRCGASWKHVL  137

Query  378  RYLLAGEACSRR  413
            RY+L  E    R
Sbjct  138  RYILVREKNGSR  149



>ref|XP_003601870.1| RCC1 domain-containing protein [Medicago truncatula]
Length=432

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  285  MCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEACSRRESSQ  425
            MC KRA+FKPMT EE+QDLKQRCGGSWKLVLRYLLAGEAC RRE SQ
Sbjct  1    MCMKRAIFKPMTTEERQDLKQRCGGSWKLVLRYLLAGEACCRREKSQ  47



>ref|XP_002448071.1| hypothetical protein SORBIDRAFT_06g020490 [Sorghum bicolor]
 gb|EES12399.1| hypothetical protein SORBIDRAFT_06g020490 [Sorghum bicolor]
Length=529

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  210  CSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLL  389
            C FFR+PA F PD  LSL ELAA D C ++A+FK M Q+E+  LKQRCGGSWKLVL YLL
Sbjct  69   CQFFRRPAKFEPDATLSLPELAAYDTCCQKAIFKSMEQKEKDSLKQRCGGSWKLVLTYLL  128

Query  390  AGEACSRRESSQ  425
             GE    R  S+
Sbjct  129  VGEKNYHRGKSR  140



>gb|EEC73526.1| hypothetical protein OsI_07916 [Oryza sativa Indica Group]
Length=634

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATC+FF +PA+F P+F LSL E+AA DMCHKR + K M Q+E++ LKQRCGGSWKLVL
Sbjct  175  LEATCTFFSKPANFEPNFALSLPEVAAFDMCHKRPMVKLMAQQEREQLKQRCGGSWKLVL  234

Query  378  RYLLAGE  398
            +Y++A E
Sbjct  235  KYIVARE  241



>gb|KFK41183.1| hypothetical protein AALP_AA2G096500 [Arabis alpina]
Length=259

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFR+PA+F PDF+LS+ E+AALD+C KRA+FK M +EE+Q++K++ GGSWKL+L
Sbjct  25   LEATCSFFRKPANFSPDFELSISEVAALDICQKRAIFKRMGEEERQEIKRKWGGSWKLIL  84

Query  378  R  380
            +
Sbjct  85   K  85



>ref|NP_001047324.1| Os02g0597000 [Oryza sativa Japonica Group]
 dbj|BAD21626.1| rjs-like protein [Oryza sativa Japonica Group]
 dbj|BAF09238.1| Os02g0597000 [Oryza sativa Japonica Group]
 dbj|BAG95450.1| unnamed protein product [Oryza sativa Japonica Group]
Length=537

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATC+FF +PA+F P+F LSL E+AA DMCHKR + K M Q+E++ LKQRCGGSWKLV +Y
Sbjct  80   ATCTFFSKPANFEPNFALSLPEVAAFDMCHKRPMVKLMAQQEREQLKQRCGGSWKLVFKY  139

Query  384  LLAGE  398
            ++A E
Sbjct  140  IVARE  144



>gb|EEE57302.1| hypothetical protein OsJ_07379 [Oryza sativa Japonica Group]
Length=609

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +3

Query  204  ATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRY  383
            ATC+FF +PA+F P+F LSL E+AA DMCHKR + K M Q+E++ LKQRCGGSWKLV +Y
Sbjct  152  ATCTFFSKPANFEPNFALSLPEVAAFDMCHKRPMVKLMAQQEREQLKQRCGGSWKLVFKY  211

Query  384  LLAGE  398
            ++A E
Sbjct  212  IVARE  216



>ref|NP_001145799.1| uncharacterized protein LOC100279306 [Zea mays]
 ref|XP_008677080.1| PREDICTED: uncharacterized protein LOC100279306 isoform X1 [Zea 
mays]
 ref|XP_008677081.1| PREDICTED: uncharacterized protein LOC100279306 isoform X1 [Zea 
mays]
 gb|ACF85135.1| unknown [Zea mays]
 gb|ACF86478.1| unknown [Zea mays]
 gb|ACG32569.1| HECT domain and RCC1-like domain-containing protein 2 [Zea mays]
 gb|ACL52612.1| unknown [Zea mays]
 gb|ACN29033.1| unknown [Zea mays]
 gb|ACN34463.1| unknown [Zea mays]
 gb|AFW62848.1| putative regulator of chromosome condensation (RCC1) family protein 
isoform 1 [Zea mays]
 gb|AFW62849.1| putative regulator of chromosome condensation (RCC1) family protein 
isoform 2 [Zea mays]
 gb|AFW62850.1| putative regulator of chromosome condensation (RCC1) family protein 
isoform 3 [Zea mays]
Length=535

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATC FF +PA F PDF LSL ELAA DMC KR +FK M QE+Q+ LKQRCGGSWK VL
Sbjct  78   LEATCVFFGKPASFAPDFALSLPELAAFDMCQKRTMFKQMKQEDQECLKQRCGGSWKHVL  137

Query  378  RYLLAGEACSRR  413
             Y+L  E    R
Sbjct  138  GYILVREKNGSR  149



>gb|KDO82113.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
 gb|KDO82114.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
 gb|KDO82115.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
 gb|KDO82116.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
 gb|KDO82117.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
Length=432

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  285  MCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEACSRRESSQ  425
            MC KRA+FKPMT+ E+QDLKQ+CGGSWKLVLR+LLAGEAC RRE+SQ
Sbjct  1    MCQKRAIFKPMTEAERQDLKQKCGGSWKLVLRFLLAGEACCRRENSQ  47



>ref|XP_006438171.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
 ref|XP_006438173.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
 ref|XP_006438174.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
 gb|ESR51411.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
 gb|ESR51413.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
 gb|ESR51414.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
Length=432

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  285  MCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEACSRRESSQ  425
            MC KRA+FKPMT+ E+QDLKQ+CGGSWKLVLR+LLAGEAC RRE+SQ
Sbjct  1    MCQKRAIFKPMTEAERQDLKQKCGGSWKLVLRFLLAGEACCRRENSQ  47



>ref|XP_006290882.1| hypothetical protein CARUB_v10016992mg [Capsella rubella]
 gb|EOA23780.1| hypothetical protein CARUB_v10016992mg [Capsella rubella]
Length=432

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  285  MCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEACSRRESSQ  425
            MC+KRA+FKPM +EE+Q++K+RCGGSWKLVLR+LLAGEAC RRE SQ
Sbjct  1    MCNKRAIFKPMNEEERQEMKRRCGGSWKLVLRFLLAGEACCRREKSQ  47



>ref|XP_007044920.1| Regulator of chromosome condensation (RCC1) family protein isoform 
2 [Theobroma cacao]
 gb|EOY00752.1| Regulator of chromosome condensation (RCC1) family protein isoform 
2 [Theobroma cacao]
Length=432

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  285  MCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEACSRRESSQ  425
            MC KRA+FKPMT EE+Q+LKQRCG SWKLVLR+LLAGEAC RRE SQ
Sbjct  1    MCQKRAIFKPMTDEERQNLKQRCGESWKLVLRFLLAGEACCRREKSQ  47



>gb|KJB31067.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
 gb|KJB31069.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
Length=432

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  285  MCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEACSRRESSQ  425
            MC +RA+FKPMT EE+Q LK RCGGSWKLVLR+LLAGEAC RRE SQ
Sbjct  1    MCQRRAIFKPMTDEERQSLKHRCGGSWKLVLRFLLAGEACCRREKSQ  47



>gb|KDO82118.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
Length=380

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  285  MCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEACSRRESSQ  425
            MC KRA+FKPMT+ E+QDLKQ+CGGSWKLVLR+LLAGEAC RRE+SQ
Sbjct  1    MCQKRAIFKPMTEAERQDLKQKCGGSWKLVLRFLLAGEACCRRENSQ  47



>ref|NP_566789.1| regulator of chromosome condensation repeat-containing protein 
[Arabidopsis thaliana]
 gb|AAK59536.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15211.1| unknown protein [Arabidopsis thaliana]
 gb|AEE77118.1| regulator of chromosome condensation repeat-containing protein 
[Arabidopsis thaliana]
Length=432

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  285  MCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEACSRRESSQ  425
            MC+KR +FKPM +EE+Q++K+RCGGSWKLVLR+LLAGEAC RRE SQ
Sbjct  1    MCNKRVIFKPMNEEERQEMKRRCGGSWKLVLRFLLAGEACCRREKSQ  47



>gb|EMT06491.1| hypothetical protein F775_19352 [Aegilops tauschii]
Length=485

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +3

Query  249  FQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEACSRRESSQ  425
             +LSL ELAALDMC +R +F  M  EE++ LKQRCGGSWKLVL Y+L GE   RR  SQ
Sbjct  84   LELSLPELAALDMCQQRPMFNLMKPEEKEWLKQRCGGSWKLVLGYILVGEKNCRRGKSQ  142



>ref|XP_009387708.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC3 [Musa acuminata 
subsp. malaccensis]
Length=480

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 46/77 (60%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATCSFFRQ    PPD +L L ELAA DMC +R     M   E++ LKQRCGGS+KL+L
Sbjct  23   LEATCSFFRQHGGLPPDERLPLTELAAFDMCRRRVALASMAAAEEEALKQRCGGSYKLLL  82

Query  378  RYLLAGE-ACSRRESSQ  425
            +YLLAGE AC RRE  Q
Sbjct  83   KYLLAGERACDRREKFQ  99



>gb|KJB60985.1| hypothetical protein B456_009G334300 [Gossypium raimondii]
 gb|KJB60987.1| hypothetical protein B456_009G334300 [Gossypium raimondii]
Length=421

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  315  MTQEEQQDLKQRCGGSWKLVLRYLLAGEACSRRESSQ  425
            MT EE Q+LK++CGGSWKL LR+LLAGEAC RRE SQ
Sbjct  1    MTDEECQNLKRKCGGSWKLALRFLLAGEACCRREKSQ  37



>ref|XP_006827796.1| hypothetical protein AMTR_s00009p00266800 [Amborella trichopoda]
 gb|ERM95212.1| hypothetical protein AMTR_s00009p00266800 [Amborella trichopoda]
Length=486

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = +3

Query  198  FNATCSFFR-QPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLV  374
              A+C  FR   + FP  F+ S+ E AA  +C   A+F+ M+   +  L  RCGG+WKLV
Sbjct  33   LEASCRIFRGHQSLFPFKFR-SMAEFAAFHLCSSGAIFRGMSVAARTSLVDRCGGNWKLV  91

Query  375  LRYLLAGEACS  407
            LR++ + E  S
Sbjct  92   LRFIQSVEQAS  102



>ref|XP_008806532.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X2 [Phoenix dactylifera]
Length=490

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 36/70 (51%), Gaps = 0/70 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
               TC  FR      P+   S+ E AA  +C   ++F  +    ++DL  RCGG+WK VL
Sbjct  35   LETTCRMFRGSHEILPNKFRSMVEFAAFHICRAHSIFTSLHPNARKDLLDRCGGNWKKVL  94

Query  378  RYLLAGEACS  407
            R+L + E  S
Sbjct  95   RFLQSVEQSS  104



>ref|XP_008806527.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Phoenix dactylifera]
 ref|XP_008806528.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Phoenix dactylifera]
 ref|XP_008806529.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Phoenix dactylifera]
 ref|XP_008806531.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Phoenix dactylifera]
Length=492

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 36/70 (51%), Gaps = 0/70 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
               TC  FR      P+   S+ E AA  +C   ++F  +    ++DL  RCGG+WK VL
Sbjct  35   LETTCRMFRGSHEILPNKFRSMVEFAAFHICRAHSIFTSLHPNARKDLLDRCGGNWKKVL  94

Query  378  RYLLAGEACS  407
            R+L + E  S
Sbjct  95   RFLQSVEQSS  104



>ref|XP_010905534.1| PREDICTED: ultraviolet-B receptor UVR8 [Elaeis guineensis]
 ref|XP_010905535.1| PREDICTED: ultraviolet-B receptor UVR8 [Elaeis guineensis]
Length=492

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 35/70 (50%), Gaps = 0/70 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
               TC  FR      P    S+ E AA  +C   ++F  +    ++DL  RCGG+WK VL
Sbjct  35   LETTCQMFRGSHGICPSKFRSMVEFAAFHICQAHSIFTSLHPNARKDLLDRCGGNWKKVL  94

Query  378  RYLLAGEACS  407
            R+L + E  S
Sbjct  95   RFLQSVEQSS  104



>ref|XP_002528573.1| Ran GTPase binding protein, putative [Ricinus communis]
 gb|EEF33828.1| Ran GTPase binding protein, putative [Ricinus communis]
Length=497

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  237  FPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEACS  407
            +P  F+ SL + AA  +C   +V+  M    Q++L  RCGG+WK VLR+LLA E  S
Sbjct  49   YPHKFK-SLVDFAAFQLCASHSVYTGMLWNAQKELLDRCGGNWKRVLRFLLAVEESS  104



>gb|KEH38764.1| chromosome condensation regulator RCC1 repeat protein [Medicago 
truncatula]
Length=491

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 33/57 (58%), Gaps = 1/57 (2%)
 Frame = +3

Query  237  FPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEACS  407
            +P  F+ SL + AA  +C   A+F  M    Q +L  RCGG+WK VLR+L + E  S
Sbjct  49   YPLKFK-SLVDFAAFQLCDSHAIFSQMVLNSQNELYDRCGGNWKRVLRFLQSLEQSS  104



>ref|XP_004487688.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like [Cicer 
arietinum]
Length=492

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 31/95 (33%), Positives = 44/95 (46%), Gaps = 21/95 (22%)
 Frame = +3

Query  123  LVILQTKAXNFGKISHGF*GILRSLFNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRA  302
            LV L+  +  FG  +HGF                    +P  F+ SL + AA  +C   A
Sbjct  32   LVCLEFTSKTFGASNHGF--------------------YPFKFK-SLIDFAAFQLCASNA  70

Query  303  VFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEACS  407
             +  M    Q++L  RCGG+WK VLR+L + E  S
Sbjct  71   TYSMMGLNSQRELYDRCGGNWKRVLRFLQSVEQSS  105



>ref|XP_002448070.1| hypothetical protein SORBIDRAFT_06g020480 [Sorghum bicolor]
 gb|EES12398.1| hypothetical protein SORBIDRAFT_06g020480 [Sorghum bicolor]
Length=200

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +3

Query  216  FFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKL  371
            FFR+ A+F PD  LSL +LAA D C ++A+FKPM  E ++  +      W L
Sbjct  80   FFRRRANFEPDATLSLPKLAAYDTCCQKAIFKPMKHEGKKKREAEAAVRWLL  131



>ref|XP_009398507.1| PREDICTED: ultraviolet-B receptor UVR8 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009399235.1| PREDICTED: ultraviolet-B receptor UVR8 [Musa acuminata subsp. 
malaccensis]
Length=492

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/63 (37%), Positives = 32/63 (51%), Gaps = 0/63 (0%)
 Frame = +3

Query  198  FNATCSFFRQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVL  377
              ATC  FR      PD   SL E AA  +C+   +F  +    + +L  RC G+WK +L
Sbjct  35   LEATCRMFRGADGLFPDKFRSLVEFAAFHICNVHPIFGSLPHNARANLLDRCNGNWKRLL  94

Query  378  RYL  386
            R+L
Sbjct  95   RFL  97



>ref|XP_010099004.1| hypothetical protein L484_025664 [Morus notabilis]
 gb|EXB76306.1| hypothetical protein L484_025664 [Morus notabilis]
Length=492

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  237  FPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYLLAGEACS  407
            +P  F+ SL +LAA  +C   +++  +++  Q++L  RC G+WK VLR+LL+ E  S
Sbjct  49   YPQKFR-SLVDLAAFQLCVSHSIYSCLSRNAQRELCDRCDGNWKRVLRFLLSVEQSS  104



>ref|XP_009389235.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389236.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389237.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389238.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=492

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 2/64 (3%)
 Frame = +3

Query  198  FNATCSFF-RQPAHFPPDFQLSLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLV  374
            F ATC  F      FP  FQ S+ E+AA  +C   ++F       +  L  RCGG+WK V
Sbjct  35   FEATCRMFCGDHGLFPDRFQ-SMVEIAAFHLCKAHSIFSSFPPTARTKLLDRCGGNWKKV  93

Query  375  LRYL  386
            L++L
Sbjct  94   LKFL  97



>ref|XP_010695029.1| PREDICTED: ultraviolet-B receptor UVR8 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +3

Query  258  SLXELAALDMCHKRAVFKPMTQEEQQDLKQRCGGSWKLVLRYL  386
            SL +LAA  +C    V+ PM  E ++ L  RCGG+WK VLR+L
Sbjct  50   SLVDLAAFQLCVSHPVYAPMGFEARKALIDRCGGNWKRVLRFL  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553413336175