BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF020N19

Length=581
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004501107.1|  PREDICTED: uncharacterized protein LOC101504607  75.1    1e-14   
ref|XP_002462705.1|  hypothetical protein SORBIDRAFT_02g030535        68.2    5e-12   
ref|XP_003625390.1|  Subtilisin-like protease                         73.2    2e-11   
ref|XP_006448873.1|  hypothetical protein CICLE_v10018283mg           65.9    8e-11   
emb|CAN73398.1|  hypothetical protein VITISV_016436                   69.7    9e-11   Vitis vinifera
emb|CBI24270.3|  unnamed protein product                              66.2    1e-10   Vitis vinifera
ref|XP_003636458.1|  Auxin-induced protein-like protein               66.6    1e-10   
ref|XP_001787081.1|  predicted protein                                66.2    2e-10   
ref|XP_007203653.1|  hypothetical protein PRUPE_ppb013559mg           62.8    7e-10   
ref|XP_006382815.1|  hypothetical protein POPTR_0005s05730g           62.8    9e-10   
gb|KEH35898.1|  transmembrane protein, putative                       62.8    1e-09   Medicago truncatula
ref|XP_007220812.1|  hypothetical protein PRUPE_ppb021274mg           62.4    1e-09   
ref|XP_003601679.1|  hypothetical protein MTR_3g084270                62.0    1e-09   
ref|XP_007161613.1|  hypothetical protein PHAVU_001G084100g           62.4    1e-09   Phaseolus vulgaris [French bean]
ref|XP_003603285.1|  hypothetical protein MTR_3g105890                62.8    1e-09   
gb|KJB73948.1|  hypothetical protein B456_011G262200                  61.6    2e-09   Gossypium raimondii
gb|KHN29733.1|  hypothetical protein glysoja_016355                   61.2    2e-09   Glycine soja [wild soybean]
gb|KHN40177.1|  hypothetical protein glysoja_041840                   60.8    2e-09   Glycine soja [wild soybean]
gb|KHN40796.1|  hypothetical protein glysoja_015163                   60.8    2e-09   Glycine soja [wild soybean]
ref|XP_007161414.1|  hypothetical protein PHAVU_001G066900g           60.8    2e-09   Phaseolus vulgaris [French bean]
gb|KEH19502.1|  hypothetical protein MTR_8g461450                     61.2    2e-09   Medicago truncatula
ref|XP_007161413.1|  hypothetical protein PHAVU_001G066700g           61.2    2e-09   Phaseolus vulgaris [French bean]
ref|XP_007204830.1|  hypothetical protein PRUPE_ppb024773mg           62.0    2e-09   
ref|XP_007139841.1|  hypothetical protein PHAVU_008G062500g           60.8    4e-09   Phaseolus vulgaris [French bean]
ref|XP_011465117.1|  PREDICTED: 50S ribosomal protein L18, chloro...  63.2    4e-09   Fragaria vesca subsp. vesca
ref|XP_007009252.1|  Uncharacterized protein isoform 2                62.4    4e-09   
ref|XP_007009251.1|  Uncharacterized protein isoform 1                62.4    5e-09   
ref|XP_003603514.1|  hypothetical protein MTR_3g108610                60.8    6e-09   
gb|KHN48479.1|  hypothetical protein glysoja_044423                   59.3    1e-08   Glycine soja [wild soybean]
gb|KJB65083.1|  hypothetical protein B456_010G079800                  59.7    1e-08   Gossypium raimondii
ref|XP_006289019.1|  hypothetical protein CARUB_v10002400mg           58.9    1e-08   
ref|XP_009623865.1|  PREDICTED: ankyrin repeat and SOCS box prote...  59.7    2e-08   
ref|XP_007136812.1|  hypothetical protein PHAVU_009G076400g           58.5    2e-08   Phaseolus vulgaris [French bean]
gb|KJB73125.1|  hypothetical protein B456_011G262800                  58.5    2e-08   Gossypium raimondii
ref|XP_009371907.1|  PREDICTED: uncharacterized protein LOC103961114  60.1    3e-08   
ref|XP_007161693.1|  hypothetical protein PHAVU_001G090500g           54.3    1e-06   Phaseolus vulgaris [French bean]
ref|XP_005842777.1|  hypothetical protein CHLNCDRAFT_55660            51.6    3e-05   Chlorella variabilis
ref|XP_733769.1|  hypothetical protein                                48.1    1e-04   
ref|XP_003619862.1|  hypothetical protein MTR_6g070990                48.5    1e-04   
ref|XP_003597731.1|  hypothetical protein MTR_2g101670                47.4    3e-04   
ref|XP_007393668.1|  hypothetical protein PHACADRAFT_88782            46.6    3e-04   Phanerochaete carnosa HHB-10118-sp



>ref|XP_004501107.1| PREDICTED: uncharacterized protein LOC101504607, partial [Cicer 
arietinum]
Length=42

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  109  RVQKNLDHFSICACHPCAGAMLIFSVSFQFYRMSPK  2
            + QKNLDHFSICACHPCAGAMLIFSVSFQFYRMSPK
Sbjct  4    KSQKNLDHFSICACHPCAGAMLIFSVSFQFYRMSPK  39



>ref|XP_002462705.1| hypothetical protein SORBIDRAFT_02g030535 [Sorghum bicolor]
 gb|EER99226.1| hypothetical protein SORBIDRAFT_02g030535 [Sorghum bicolor]
Length=43

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  104  SKKFGPFLDLCVSSLRRGHANLLCIVPILSDVSE  3
            SKKFGPFLDLCVS LRRGHANLLCIVPILSDVSE
Sbjct  7    SKKFGPFLDLCVSLLRRGHANLLCIVPILSDVSE  40



>ref|XP_003625390.1| Subtilisin-like protease [Medicago truncatula]
Length=932

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  104  SKKFGPFLDLCVSSLRRGHANLLCIVPILSDVSE  3
            +KKFGPFLDLCVSSLRRGHANLLCIVPILSDV E
Sbjct  783  AKKFGPFLDLCVSSLRRGHANLLCIVPILSDVPE  816



>ref|XP_006448873.1| hypothetical protein CICLE_v10018283mg [Citrus clementina]
 gb|ESR62113.1| hypothetical protein CICLE_v10018283mg [Citrus clementina]
Length=85

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +1

Query  1   SSETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           SSETSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  26  SSETSDKIGTIQRRLAWPLRKDDTHKSRNG  55



>emb|CAN73398.1| hypothetical protein VITISV_016436 [Vitis vinifera]
Length=377

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  101  KKFGPFLDLCVSSLRRGHANLLCIVPILSDVSE  3
            KKFGPFLDLCVSSLRRGHANLLCIVPILSDVSE
Sbjct  32   KKFGPFLDLCVSSLRRGHANLLCIVPILSDVSE  64


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  104  SKKFGPFLDLCVSSLRRGHANLLCIVPILSDVSE  3
            +KKFGPFLDLCVSSLRRGHANLLCIVPILSDVS+
Sbjct  229  TKKFGPFLDLCVSSLRRGHANLLCIVPILSDVSK  262


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  122  VFQFSGSKKFGPFLDLCVSSLRRGHANLLCIVPILSDVS  6
            V+     KKFGPFLDLCVSSLRRGHANLLCIVPILSDVS
Sbjct  124  VWWGGKKKKFGPFLDLCVSSLRRGHANLLCIVPILSDVS  162



>emb|CBI24270.3| unnamed protein product [Vitis vinifera]
Length=119

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +1

Query  1   SSETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           SSETSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  18  SSETSDKIGTIQRRLAWPLRKDDTHKSRNG  47


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    SSETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
            SSETSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  78   SSETSDKIGTIQRRLAWPLRKDDTHKSRNG  107



>ref|XP_003636458.1| Auxin-induced protein-like protein [Medicago truncatula]
Length=167

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -2

Query  97   NLDHFSICACHPCAGAMLIFSVSFQFYRMSPK  2
            NL+HFS CACHPCAGA+LIFSVSFQFYRMSPK
Sbjct  136  NLNHFSNCACHPCAGALLIFSVSFQFYRMSPK  167



>ref|XP_001787081.1| predicted protein [Physcomitrella patens]
 gb|EDQ48105.1| predicted protein [Physcomitrella patens]
Length=202

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    SSETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
            SSETSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  87   SSETSDKIGTIQRRLAWPLRKDDTHKSRNG  116



>ref|XP_007203653.1| hypothetical protein PRUPE_ppb013559mg, partial [Prunus persica]
 gb|EMJ04852.1| hypothetical protein PRUPE_ppb013559mg, partial [Prunus persica]
Length=67

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 35/52 (67%), Gaps = 12/52 (23%)
 Frame = +1

Query  4    SETSDKIGTIQRRLAWPLRKDDTHKSRNGpnffepen*nTLMNLFANFSIKL  159
            S TSDKIGTIQRRLAWPLRKDDTHKSRNGP            N FA FS K 
Sbjct  14   SGTSDKIGTIQRRLAWPLRKDDTHKSRNGP------------NFFALFSAKF  53



>ref|XP_006382815.1| hypothetical protein POPTR_0005s05730g [Populus trichocarpa]
 gb|ERP60612.1| hypothetical protein POPTR_0005s05730g [Populus trichocarpa]
Length=84

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  4    SETSDKIGTIQRRLAWPLRKDDTHKSRNGpnffepen*nTLMNLF  138
            S TSDKIGTIQRRLAWPLRKDDTHKSRNG       +   +  LF
Sbjct  16   SGTSDKIGTIQRRLAWPLRKDDTHKSRNGGCGDGSNSSERVAKLF  60



>gb|KEH35898.1| transmembrane protein, putative [Medicago truncatula]
Length=88

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 37/62 (60%), Gaps = 12/62 (19%)
 Frame = +1

Query  4    SETSDKIGTIQRRLAWPLRKDDTHKSRNGpnffepen*nTLMNLFANFSIKLQYFQLVVL  183
            S TSDKIGTIQRRLAWPLRKDDTHKSRNGP            N F  FS+   +    +L
Sbjct  29   SGTSDKIGTIQRRLAWPLRKDDTHKSRNGP------------NFFCIFSLTQSFRVCPIL  76

Query  184  NF  189
              
Sbjct  77   TL  78



>ref|XP_007220812.1| hypothetical protein PRUPE_ppb021274mg, partial [Prunus persica]
 gb|EMJ22011.1| hypothetical protein PRUPE_ppb021274mg, partial [Prunus persica]
Length=83

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  46  SGTSDKIGTIQRRLAWPLRKDDTHKSRNG  74



>ref|XP_003601679.1| hypothetical protein MTR_3g084270 [Medicago truncatula]
 gb|AES71930.1| hypothetical protein MTR_3g084270 [Medicago truncatula]
Length=80

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  25  SGTSDKIGTIQRRLAWPLRKDDTHKSRNG  53



>ref|XP_007161613.1| hypothetical protein PHAVU_001G084100g, partial [Phaseolus vulgaris]
 gb|ESW33607.1| hypothetical protein PHAVU_001G084100g, partial [Phaseolus vulgaris]
Length=88

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  24  SGTSDKIGTIQRRLAWPLRKDDTHKSRNG  52



>ref|XP_003603285.1| hypothetical protein MTR_3g105890 [Medicago truncatula]
 gb|AES73536.1| transmembrane protein, putative [Medicago truncatula]
Length=113

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 51/96 (53%), Gaps = 23/96 (24%)
 Frame = +1

Query  4    SETSDKIGTIQRRLAWPLRKDDTHKSRNGpnffepen*nTLMNLFANFSIKLQYFQLVVL  183
            S TSDKIGTIQRRLAWPLRKDDTHKSRNGP            N F  FS+   +    +L
Sbjct  29   SGTSDKIGTIQRRLAWPLRKDDTHKSRNGP------------NFFCIFSLTQSFRVCPIL  76

Query  184  NFEFFLLRSSTESQNR*ALKVNIWNKLLFVSTH*VV  291
                 L+ S   S         ++ KLLF S + ++
Sbjct  77   T----LVMSPPTS-------TCMYCKLLFPSKYYII  101



>gb|KJB73948.1| hypothetical protein B456_011G262200, partial [Gossypium raimondii]
Length=72

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  42  SGTSDKIGTIQRRLAWPLRKDDTHKSRNG  70



>gb|KHN29733.1| hypothetical protein glysoja_016355, partial [Glycine soja]
Length=45

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  4   SGTSDKIGTIQRRLAWPLRKDDTHKSRNG  32



>gb|KHN40177.1| hypothetical protein glysoja_041840, partial [Glycine soja]
Length=41

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  1   SSETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
            S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  3   PSGTSDKIGTIQRRLAWPLRKDDTHKSRNG  32



>gb|KHN40796.1| hypothetical protein glysoja_015163, partial [Glycine soja]
Length=46

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  1   SSETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
            S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  3   PSGTSDKIGTIQRRLAWPLRKDDTHKSRNG  32



>ref|XP_007161414.1| hypothetical protein PHAVU_001G066900g [Phaseolus vulgaris]
 gb|ESW33408.1| hypothetical protein PHAVU_001G066900g [Phaseolus vulgaris]
Length=37

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  5   SGTSDKIGTIQRRLAWPLRKDDTHKSRNG  33



>gb|KEH19502.1| hypothetical protein MTR_8g461450 [Medicago truncatula]
Length=69

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  7   SGTSDKIGTIQRRLAWPLRKDDTHKSRNG  35



>ref|XP_007161413.1| hypothetical protein PHAVU_001G066700g [Phaseolus vulgaris]
 gb|ESW33407.1| hypothetical protein PHAVU_001G066700g [Phaseolus vulgaris]
Length=73

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/27 (100%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +1

Query  10  TSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  16  TSDKIGTIQRRLAWPLRKDDTHKSRNG  42



>ref|XP_007204830.1| hypothetical protein PRUPE_ppb024773mg, partial [Prunus persica]
 gb|EMJ06029.1| hypothetical protein PRUPE_ppb024773mg, partial [Prunus persica]
Length=100

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  61  SGTSDKIGTIQRRLAWPLRKDDTHKSRNG  89



>ref|XP_007139841.1| hypothetical protein PHAVU_008G062500g, partial [Phaseolus vulgaris]
 gb|ESW11835.1| hypothetical protein PHAVU_008G062500g, partial [Phaseolus vulgaris]
Length=83

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  38  SGTSDKIGTIQRRLAWPLRKDDTHKSRNG  66



>ref|XP_011465117.1| PREDICTED: 50S ribosomal protein L18, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=227

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  8   SGTSDKIGTIQRRLAWPLRKDDTHKSRNG  36



>ref|XP_007009252.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY18062.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=171

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  4    SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
            S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  90   SGTSDKIGTIQRRLAWPLRKDDTHKSRNG  118



>ref|XP_007009251.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY18061.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=185

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  4    SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
            S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  90   SGTSDKIGTIQRRLAWPLRKDDTHKSRNG  118



>ref|XP_003603514.1| hypothetical protein MTR_3g108610 [Medicago truncatula]
 gb|AES73765.1| hypothetical protein MTR_3g108610 [Medicago truncatula]
Length=112

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/27 (100%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +1

Query  10  TSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  50  TSDKIGTIQRRLAWPLRKDDTHKSRNG  76



>gb|KHN48479.1| hypothetical protein glysoja_044423, partial [Glycine soja]
Length=59

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           S TSDKIGTIQRRLAWPLRKDDTHKSRNG
Sbjct  10  SGTSDKIGTIQRRLAWPLRKDDTHKSRNG  38



>gb|KJB65083.1| hypothetical protein B456_010G079800 [Gossypium raimondii]
Length=90

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRN  87
           S TSDKIGTIQRRLAWPLRKDDTHKSRN
Sbjct  18  SGTSDKIGTIQRRLAWPLRKDDTHKSRN  45



>ref|XP_006289019.1| hypothetical protein CARUB_v10002400mg [Capsella rubella]
 gb|EOA21917.1| hypothetical protein CARUB_v10002400mg [Capsella rubella]
Length=54

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRN  87
           S TSDKIGTIQRRLAWPLRKDDTHKSRN
Sbjct  15  SGTSDKIGTIQRRLAWPLRKDDTHKSRN  42



>ref|XP_009623865.1| PREDICTED: ankyrin repeat and SOCS box protein 13-like, partial 
[Nicotiana tomentosiformis]
Length=120

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRN  87
           S TSDKIGTIQRRLAWPLRKDDTHKSRN
Sbjct  7   SGTSDKIGTIQRRLAWPLRKDDTHKSRN  34



>ref|XP_007136812.1| hypothetical protein PHAVU_009G076400g, partial [Phaseolus vulgaris]
 gb|ESW08806.1| hypothetical protein PHAVU_009G076400g, partial [Phaseolus vulgaris]
Length=74

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/27 (96%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  10  TSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           TSDKIGTIQRRLAWPLRKDDTHKSRN 
Sbjct  34  TSDKIGTIQRRLAWPLRKDDTHKSRNA  60



>gb|KJB73125.1| hypothetical protein B456_011G262800, partial [Gossypium raimondii]
Length=71

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRN  87
           S TSDKIGTIQRRLAWPLRKDDTHKSRN
Sbjct  44  SGTSDKIGTIQRRLAWPLRKDDTHKSRN  71



>ref|XP_009371907.1| PREDICTED: uncharacterized protein LOC103961114 [Pyrus x bretschneideri]
Length=186

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           S TSDKIGTIQRRLAWPLRKDD HKSRNG
Sbjct  13  SGTSDKIGTIQRRLAWPLRKDDKHKSRNG  41



>ref|XP_007161693.1| hypothetical protein PHAVU_001G090500g [Phaseolus vulgaris]
 gb|ESW33687.1| hypothetical protein PHAVU_001G090500g [Phaseolus vulgaris]
Length=98

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/26 (96%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  10  TSDKIGTIQRRLAWPLRKDDTHKSRN  87
           TSDKIGTIQRRLAW LRKDDTHKSRN
Sbjct  7   TSDKIGTIQRRLAWLLRKDDTHKSRN  32



>ref|XP_005842777.1| hypothetical protein CHLNCDRAFT_55660 [Chlorella variabilis]
 gb|EFN50660.1| hypothetical protein CHLNCDRAFT_55660 [Chlorella variabilis]
Length=185

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  16   DKIGTIQRRLAWPLRKDDTHKSRNG  90
            DKIGTIQRRLAWPLRKDDT  SRNG
Sbjct  154  DKIGTIQRRLAWPLRKDDTLCSRNG  178



>ref|XP_733769.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 emb|CAH86998.1| hypothetical protein PC405219.00.0 [Plasmodium chabaudi chabaudi]
Length=62

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -1

Query  101  KKFGPFLDLCVSSLRRGHANLLCIVPILSD  12
            KKF   L+  VSSLRRGHANLLCIVPILS+
Sbjct  26   KKFTFLLERHVSSLRRGHANLLCIVPILSN  55



>ref|XP_003619862.1| hypothetical protein MTR_6g070990 [Medicago truncatula]
 gb|AES76080.1| hypothetical protein MTR_6g070990 [Medicago truncatula]
Length=94

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHK  78
           S TSDKIGTIQRRLAWPLRKDDT +
Sbjct  40  SGTSDKIGTIQRRLAWPLRKDDTDQ  64



>ref|XP_003597731.1| hypothetical protein MTR_2g101670 [Medicago truncatula]
 gb|ABN06009.1| hypothetical protein MtrDRAFT_AC149489g27v2 [Medicago truncatula]
 gb|AES67982.1| hypothetical protein MTR_2g101670 [Medicago truncatula]
Length=69

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  4   SETSDKIGTIQRRLAWPLRKDDTHKSRNG  90
           S TSDKI TI RRL W L KDDTH+SRNG
Sbjct  23  SGTSDKIKTIHRRLTWLLHKDDTHQSRNG  51



>ref|XP_007393668.1| hypothetical protein PHACADRAFT_88782, partial [Phanerochaete 
carnosa HHB-10118-sp]
 gb|EKM58351.1| hypothetical protein PHACADRAFT_88782, partial [Phanerochaete 
carnosa HHB-10118-sp]
Length=49

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 33/53 (62%), Gaps = 9/53 (17%)
 Frame = +1

Query  10   TSDKIGTIQRRLAWPLRKDDTHKSRNGpnffepen*nTLMNLFANFSIKLQYF  168
            T +KIGTIQRRLAWPL KDDT  SR+G          T +N++A+FS     F
Sbjct  6    TYEKIGTIQRRLAWPLHKDDT-LSRSG--------RPTGLNIYASFSYAFARF  49



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220