BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF020N05

Length=537
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011072993.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       211   3e-77   Sesamum indicum [beniseed]
gb|EYU38331.1|  hypothetical protein MIMGU_mgv1a014569mg                209   4e-77   Erythranthe guttata [common monkey flower]
ref|XP_011080934.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    212   1e-76   Sesamum indicum [beniseed]
ref|XP_010089080.1|  Ubiquitin-conjugating enzyme E2 5                  211   2e-76   Morus notabilis
emb|CDP12044.1|  unnamed protein product                                210   6e-76   Coffea canephora [robusta coffee]
gb|KDP25412.1|  hypothetical protein JCGZ_20568                         209   9e-76   Jatropha curcas
ref|XP_009592682.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    208   2e-75   Nicotiana tomentosiformis
ref|XP_007040285.1|  Ubiquitin-conjugating enzyme 5                     207   2e-75   Theobroma cacao [chocolate]
ref|XP_002509830.1|  ubiquitin-conjugating enzyme h, putative           206   2e-75   Ricinus communis
ref|XP_009790425.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    208   2e-75   Nicotiana sylvestris
ref|XP_004245589.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5       208   2e-75   Solanum lycopersicum
ref|XP_002276343.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    206   3e-75   Vitis vinifera
ref|XP_006343959.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    208   3e-75   Solanum tuberosum [potatoes]
ref|XP_007209658.1|  hypothetical protein PRUPE_ppa012080mg             208   3e-75   Prunus persica
ref|XP_010670105.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    207   4e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010055667.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    210   4e-75   Eucalyptus grandis [rose gum]
ref|XP_006476536.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    206   8e-75   Citrus sinensis [apfelsine]
gb|KEH18844.1|  ubiquitin-conjugating enzyme                            208   1e-74   Medicago truncatula
ref|XP_007135093.1|  hypothetical protein PHAVU_010G100200g             206   1e-74   Phaseolus vulgaris [French bean]
gb|AFK34026.1|  unknown                                                 208   1e-74   Medicago truncatula
ref|XP_009375015.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    206   1e-74   Pyrus x bretschneideri [bai li]
ref|XP_011029312.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    213   1e-74   Populus euphratica
ref|XP_009783359.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    204   2e-74   Nicotiana sylvestris
gb|KHF98807.1|  Ubiquitin-conjugating enzyme E2 5 -like protein         205   3e-74   Gossypium arboreum [tree cotton]
ref|XP_002511883.1|  ubiquitin-conjugating enzyme h, putative           205   3e-74   Ricinus communis
ref|NP_001237603.1|  ubiquitin carrier protein 4                        206   3e-74   Glycine max [soybeans]
ref|XP_007218489.1|  hypothetical protein PRUPE_ppa012120mg             206   3e-74   Prunus persica
ref|XP_003548669.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    206   3e-74   Glycine max [soybeans]
ref|XP_011092673.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    204   3e-74   Sesamum indicum [beniseed]
ref|XP_010275657.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    204   4e-74   Nelumbo nucifera [Indian lotus]
ref|XP_010940566.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    204   5e-74   Elaeis guineensis
ref|XP_008233026.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    206   6e-74   Prunus mume [ume]
gb|KJB39652.1|  hypothetical protein B456_007G023700                    205   6e-74   Gossypium raimondii
ref|XP_006661803.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    202   8e-74   Oryza brachyantha
gb|KDP28606.1|  hypothetical protein JCGZ_14377                         201   9e-74   Jatropha curcas
ref|XP_008779270.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    202   1e-73   Phoenix dactylifera
ref|XP_004510772.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    206   1e-73   Cicer arietinum [garbanzo]
ref|XP_007139813.1|  hypothetical protein PHAVU_008G060900g             206   1e-73   Phaseolus vulgaris [French bean]
ref|XP_004229945.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    206   1e-73   Solanum lycopersicum
ref|XP_004143895.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    203   1e-73   Cucumis sativus [cucumbers]
ref|XP_003552403.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    205   1e-73   Glycine max [soybeans]
ref|XP_008801319.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    203   1e-73   Phoenix dactylifera
ref|XP_002279927.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    205   2e-73   Vitis vinifera
gb|ABB47726.2|  Ubiquitin-conjugating enzyme E2-23 kDa, putative,...    200   2e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009626849.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    202   2e-73   Nicotiana tomentosiformis
ref|XP_002465854.1|  hypothetical protein SORBIDRAFT_01g047040          201   2e-73   Sorghum bicolor [broomcorn]
ref|XP_010255296.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    202   3e-73   Nelumbo nucifera [Indian lotus]
ref|XP_006339599.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    206   3e-73   Solanum tuberosum [potatoes]
ref|XP_008794268.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    204   3e-73   Phoenix dactylifera
ref|XP_002467149.1|  hypothetical protein SORBIDRAFT_01g020460          200   3e-73   Sorghum bicolor [broomcorn]
ref|XP_010087938.1|  Ubiquitin-conjugating enzyme E2 5                  207   4e-73   Morus notabilis
ref|NP_001266400.1|  putative ubiquitin-conjugating enzyme family       201   4e-73   Zea mays [maize]
ref|XP_011023305.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    203   4e-73   Populus euphratica
ref|NP_001242818.1|  uncharacterized protein LOC100805356               203   5e-73   
ref|XP_004985701.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    200   5e-73   Setaria italica
ref|XP_009628118.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    205   6e-73   Nicotiana tomentosiformis
ref|XP_010234781.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    200   6e-73   Brachypodium distachyon [annual false brome]
ref|XP_007051764.1|  Ubiquitin-conjugating enzyme E2 5 isoform 2        201   6e-73   Theobroma cacao [chocolate]
ref|XP_008647817.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    199   7e-73   Zea mays [maize]
ref|XP_008647901.1|  PREDICTED: putative ubiquitin-conjugating en...    200   7e-73   
ref|XP_009349265.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    201   8e-73   Pyrus x bretschneideri [bai li]
ref|XP_004306758.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    206   8e-73   Fragaria vesca subsp. vesca
ref|XP_010676458.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5       207   9e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008438028.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    204   9e-73   Cucumis melo [Oriental melon]
ref|XP_008787422.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    200   9e-73   Phoenix dactylifera
ref|NP_001132171.1|  uncharacterized protein LOC100193596               200   1e-72   Zea mays [maize]
ref|NP_001132906.1|  uncharacterized protein LOC100194405               199   1e-72   Zea mays [maize]
ref|XP_010234779.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    200   1e-72   Brachypodium distachyon [annual false brome]
ref|XP_002298025.1|  Ubiquitin-conjugating enzyme E2-21 kDa 3 fam...    206   1e-72   Populus trichocarpa [western balsam poplar]
ref|XP_006358673.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    200   1e-72   Solanum tuberosum [potatoes]
ref|XP_004248050.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    200   1e-72   Solanum lycopersicum
tpg|DAA49812.1|  TPA: putative ubiquitin-conjugating enzyme family      199   1e-72   
gb|KJB52144.1|  hypothetical protein B456_008G248000                    206   1e-72   Gossypium raimondii
ref|XP_008342748.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    202   1e-72   Malus domestica [apple tree]
ref|XP_002302592.2|  ubiquitin carrier protein 4                        203   1e-72   Populus trichocarpa [western balsam poplar]
ref|XP_011093127.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    202   2e-72   Sesamum indicum [beniseed]
ref|XP_004133859.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    203   2e-72   Cucumis sativus [cucumbers]
gb|ACG24376.1|  ubiquitin-conjugating enzyme E2-21 kDa 1                199   2e-72   Zea mays [maize]
ref|XP_004298815.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    201   3e-72   Fragaria vesca subsp. vesca
ref|XP_009367807.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    201   3e-72   
ref|XP_010933128.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    202   3e-72   Elaeis guineensis
ref|XP_009400670.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    202   3e-72   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP08792.1|  unnamed protein product                                199   4e-72   Coffea canephora [robusta coffee]
ref|XP_010935786.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    201   4e-72   Elaeis guineensis
ref|XP_009397539.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    200   5e-72   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT01071.1|  Ubiquitin-conjugating enzyme E2 5                       196   7e-72   
ref|XP_006827545.1|  hypothetical protein AMTR_s00009p00214490          204   7e-72   
gb|EMS63342.1|  Ubiquitin-conjugating enzyme E2 5                       196   8e-72   Triticum urartu
ref|XP_009791637.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    201   1e-71   Nicotiana sylvestris
ref|XP_001759393.1|  predicted protein                                  199   1e-71   
gb|KDO86231.1|  hypothetical protein CISIN_1g030092mg                   203   2e-71   Citrus sinensis [apfelsine]
gb|KJB20631.1|  hypothetical protein B456_003G157300                    194   2e-71   Gossypium raimondii
gb|AFK43668.1|  unknown                                                 205   3e-71   Lotus japonicus
ref|XP_007051763.1|  Ubiquitin-conjugating enzyme E2 5 isoform 1        201   3e-71   
ref|XP_011036629.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       201   3e-71   Populus euphratica
ref|XP_003525387.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    204   3e-71   Glycine max [soybeans]
ref|XP_002320806.1|  ubiquitin carrier protein 4                        201   4e-71   Populus trichocarpa [western balsam poplar]
ref|XP_006491142.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    203   4e-71   Citrus sinensis [apfelsine]
ref|XP_009389296.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    201   6e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010275656.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    204   6e-71   Nelumbo nucifera [Indian lotus]
gb|KHN46724.1|  Ubiquitin-conjugating enzyme E2 5                       207   8e-71   Glycine soja [wild soybean]
ref|XP_006302819.1|  hypothetical protein CARUB_v10020943mg             200   1e-70   
gb|ACN39971.1|  unknown                                                 199   2e-70   Picea sitchensis
ref|XP_011022652.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    201   2e-70   Populus euphratica
ref|XP_010533643.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    204   3e-70   Tarenaya hassleriana [spider flower]
ref|XP_003557690.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    196   3e-70   Brachypodium distachyon [annual false brome]
ref|XP_004503694.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    204   4e-70   Cicer arietinum [garbanzo]
gb|ABK23779.1|  unknown                                                 197   4e-70   Picea sitchensis
ref|XP_002886384.1|  ubiquitin-conjugating enzyme 37                    199   5e-70   Arabidopsis lyrata subsp. lyrata
ref|NP_001236928.1|  uncharacterized protein LOC100527756               201   5e-70   Glycine max [soybeans]
ref|XP_002304506.1|  Ubiquitin-conjugating enzyme E2-21 kDa 3 fam...    201   6e-70   Populus trichocarpa [western balsam poplar]
ref|XP_010940563.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    190   8e-70   Elaeis guineensis
ref|XP_003558810.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    192   9e-70   Brachypodium distachyon [annual false brome]
ref|NP_564817.2|  ubiquitin-conjugating enzyme E2 5                     198   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430489.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5       198   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010418415.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    198   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010559097.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    192   2e-69   Tarenaya hassleriana [spider flower]
ref|XP_002868603.1|  hypothetical protein ARALYDRAFT_493844             196   2e-69   
ref|XP_010447359.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    196   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010436081.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       196   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006286283.1|  hypothetical protein CARUB_v10007860mg             196   2e-69   Capsella rubella
ref|NP_568589.1|  ubiquitin-conjugating enzyme E2 4                     196   3e-69   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK02014.1|  predicted protein                                      194   3e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002964045.1|  ubiquitin-conjugating enzyme 5, E2                 195   4e-69   Selaginella moellendorffii
ref|XP_010441297.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    194   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006405362.1|  hypothetical protein EUTSA_v10027948mg             194   6e-69   Eutrema salsugineum [saltwater cress]
gb|KFK33016.1|  hypothetical protein AALP_AA6G319600                    194   6e-69   Arabis alpina [alpine rockcress]
gb|EPS69444.1|  ubiquitin carrier protein                               192   7e-69   Genlisea aurea
gb|AAA32900.1|  ubiquitin conjugating enzyme                            196   1e-68   Arabidopsis thaliana [mouse-ear cress]
gb|KJB52143.1|  hypothetical protein B456_008G248000                    206   2e-68   Gossypium raimondii
ref|XP_010553532.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    202   2e-68   Tarenaya hassleriana [spider flower]
sp|P16577.1|UBC4_WHEAT  RecName: Full=Ubiquitin-conjugating enzym...    194   3e-68   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010940567.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    205   4e-68   
ref|XP_009397721.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    194   6e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006465385.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    204   8e-68   Citrus sinensis [apfelsine]
emb|CDY58954.1|  BnaCnng33990D                                          193   8e-68   Brassica napus [oilseed rape]
ref|XP_003627554.1|  Ubiquitin carrier protein                          185   1e-67   
ref|XP_010933129.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    203   1e-67   
ref|XP_006598954.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    205   2e-67   Glycine max [soybeans]
ref|XP_006586692.1|  PREDICTED: uncharacterized protein LOC100805...    204   2e-67   
gb|ABK21140.1|  unknown                                                 195   3e-67   Picea sitchensis
ref|XP_007051766.1|  Ubiquitin-conjugating enzyme E2 5 isoform 4        201   3e-67   
ref|XP_009140085.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       193   4e-67   Brassica rapa
ref|XP_010918820.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       202   5e-67   
ref|XP_006853122.1|  hypothetical protein AMTR_s00038p00146240          191   6e-67   
ref|XP_010037586.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    192   7e-67   Eucalyptus grandis [rose gum]
ref|XP_011098510.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    192   8e-67   Sesamum indicum [beniseed]
emb|CDY62172.1|  BnaC06g42330D                                          192   1e-66   Brassica napus [oilseed rape]
ref|XP_009125181.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    193   1e-66   Brassica rapa
ref|XP_008787423.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    200   1e-66   Phoenix dactylifera
gb|KGN64295.1|  hypothetical protein Csa_1G045930                       190   1e-66   Cucumis sativus [cucumbers]
gb|KGN56505.1|  hypothetical protein Csa_3G121800                       204   1e-66   Cucumis sativus [cucumbers]
ref|XP_007036155.1|  Ubiquitin-conjugating enzyme E2 5 isoform 1        191   2e-66   Theobroma cacao [chocolate]
ref|NP_001064719.1|  Os10g0447100                                       201   2e-66   
ref|XP_010935785.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    202   2e-66   Elaeis guineensis
gb|KDO86232.1|  hypothetical protein CISIN_1g030092mg                   201   2e-66   Citrus sinensis [apfelsine]
ref|XP_004251221.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    189   4e-66   Solanum lycopersicum
gb|KDP31131.1|  hypothetical protein JCGZ_11507                         191   4e-66   Jatropha curcas
ref|XP_008393051.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    189   5e-66   Malus domestica [apple tree]
ref|XP_004298926.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    189   5e-66   Fragaria vesca subsp. vesca
gb|KHG06323.1|  Ubiquitin-conjugating enzyme E2 4 -like protein         188   6e-66   Gossypium arboreum [tree cotton]
ref|XP_007209657.1|  hypothetical protein PRUPE_ppa012074mg             189   6e-66   Prunus persica
ref|XP_002985720.1|  ubiquitin-conjugating enzyme 5, E2                 185   8e-66   Selaginella moellendorffii
gb|AFK44595.1|  unknown                                                 193   9e-66   Medicago truncatula
ref|XP_002974421.1|  ubiquitin-conjugating enzyme 5, E2                 186   9e-66   Selaginella moellendorffii
ref|XP_006439774.1|  hypothetical protein CICLE_v10022463mg             191   1e-65   Citrus clementina [clementine]
gb|EPS57624.1|  ubiquitin carrier protein                               198   1e-65   Genlisea aurea
ref|XP_004508848.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    192   1e-65   Cicer arietinum [garbanzo]
ref|XP_007160084.1|  hypothetical protein PHAVU_002G291200g             196   1e-65   Phaseolus vulgaris [French bean]
gb|KJB37063.1|  hypothetical protein B456_006G188200                    187   1e-65   Gossypium raimondii
ref|XP_010532272.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    186   1e-65   Tarenaya hassleriana [spider flower]
ref|XP_003608946.1|  Ubiquitin carrier protein                          192   1e-65   Medicago truncatula
emb|CDP20894.1|  unnamed protein product                                184   2e-65   Coffea canephora [robusta coffee]
ref|XP_008647825.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    201   2e-65   Zea mays [maize]
ref|XP_006340324.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    187   2e-65   Solanum tuberosum [potatoes]
ref|XP_004152466.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    187   3e-65   Cucumis sativus [cucumbers]
ref|XP_010913550.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    191   3e-65   Elaeis guineensis
ref|XP_009783360.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    174   3e-65   Nicotiana sylvestris
ref|XP_009592505.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    187   3e-65   Nicotiana tomentosiformis
ref|XP_011028598.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    188   3e-65   Populus euphratica
ref|XP_007155401.1|  hypothetical protein PHAVU_003G198300g             191   4e-65   Phaseolus vulgaris [French bean]
ref|XP_006470379.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    186   4e-65   Citrus sinensis [apfelsine]
gb|EYU42972.1|  hypothetical protein MIMGU_mgv1a0146272mg               196   4e-65   Erythranthe guttata [common monkey flower]
gb|KHN29339.1|  Ubiquitin-conjugating enzyme E2 5                       176   5e-65   Glycine soja [wild soybean]
ref|XP_008780946.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    189   7e-65   Phoenix dactylifera
gb|KJB39653.1|  hypothetical protein B456_007G023700                    176   7e-65   Gossypium raimondii
ref|XP_006600652.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    191   7e-65   Glycine max [soybeans]
ref|XP_010107447.1|  Ubiquitin-conjugating enzyme E2 5                  186   9e-65   Morus notabilis
ref|XP_010254946.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    184   9e-65   Nelumbo nucifera [Indian lotus]
ref|XP_002321579.1|  hypothetical protein POPTR_0015s08470g             187   9e-65   Populus trichocarpa [western balsam poplar]
ref|XP_004138119.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    189   1e-64   Cucumis sativus [cucumbers]
gb|AFK44151.1|  unknown                                                 189   1e-64   Lotus japonicus
ref|XP_008453110.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    189   2e-64   Cucumis melo [Oriental melon]
ref|XP_009381635.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    189   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002280126.2|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    191   2e-64   Vitis vinifera
gb|KDP45387.1|  hypothetical protein JCGZ_09636                         186   2e-64   Jatropha curcas
gb|EYU44716.1|  hypothetical protein MIMGU_mgv1a014494mg                189   3e-64   Erythranthe guttata [common monkey flower]
ref|XP_006397787.1|  hypothetical protein EUTSA_v10001650mg             184   4e-64   Eutrema salsugineum [saltwater cress]
ref|XP_006405361.1|  hypothetical protein EUTSA_v10027948mg             194   4e-64   
ref|XP_006579381.1|  PREDICTED: uncharacterized protein LOC100527...    190   5e-64   Glycine max [soybeans]
ref|XP_007051765.1|  Ubiquitin-conjugating enzyme E2 5 isoform 3        171   6e-64   
ref|XP_010940565.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    191   7e-64   
ref|XP_009628119.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    175   8e-64   Nicotiana tomentosiformis
ref|XP_002511435.1|  ubiquitin-conjugating enzyme h, putative           187   8e-64   Ricinus communis
ref|NP_001241807.1|  ubiquitin-conjugating enzyme E2-21 kDa 1           169   8e-64   Zea mays [maize]
gb|KJB52142.1|  hypothetical protein B456_008G248000                    205   9e-64   Gossypium raimondii
gb|ACG24713.1|  ubiquitin-conjugating enzyme E2-21 kDa 1                169   1e-63   Zea mays [maize]
ref|XP_002882046.1|  ubiquitin-conjugating enzyme 6                     183   1e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_009142401.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    182   1e-63   Brassica rapa
ref|NP_001237311.1|  uncharacterized protein LOC100527526               189   1e-63   
ref|XP_004155833.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    173   2e-63   
ref|NP_566062.1|  ubiquitin-conjugating enzyme E2 6                     182   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010271991.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    186   3e-63   Nelumbo nucifera [Indian lotus]
emb|CDY27337.1|  BnaC04g50680D                                          181   3e-63   Brassica napus [oilseed rape]
ref|XP_010506595.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    183   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_009133760.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6       180   5e-63   Brassica rapa
ref|XP_010508073.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6       183   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006295060.1|  hypothetical protein CARUB_v10024128mg             181   5e-63   Capsella rubella
ref|XP_010255297.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    201   6e-63   Nelumbo nucifera [Indian lotus]
ref|XP_010518259.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    183   7e-63   Camelina sativa [gold-of-pleasure]
ref|XP_008438029.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    203   8e-63   Cucumis melo [Oriental melon]
gb|AFK33447.1|  unknown                                                 185   9e-63   Lotus japonicus
gb|AFK45061.1|  unknown                                                 184   1e-62   Lotus japonicus
ref|XP_010254271.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    184   1e-62   Nelumbo nucifera [Indian lotus]
emb|CDX95674.1|  BnaC03g25550D                                          179   2e-62   
ref|XP_006580568.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    175   2e-62   Glycine max [soybeans]
ref|NP_001148188.1|  ubiquitin-conjugating enzyme E2-21 kDa 1           165   3e-62   
ref|XP_010678729.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    182   3e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008360712.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    169   4e-62   
gb|KFK37384.1|  hypothetical protein AALP_AA4G250300                    182   6e-62   Arabis alpina [alpine rockcress]
ref|XP_006374516.1|  hypothetical protein POPTR_0015s08470g             177   9e-62   
ref|XP_006584539.1|  PREDICTED: uncharacterized protein LOC100527...    172   2e-61   Glycine max [soybeans]
gb|KDO76259.1|  hypothetical protein CISIN_1g029962mg                   198   2e-61   Citrus sinensis [apfelsine]
gb|KEH21089.1|  ubiquitin-conjugating enzyme                            170   3e-61   Medicago truncatula
ref|XP_010913549.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    192   4e-61   
ref|XP_010037581.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    181   5e-61   Eucalyptus grandis [rose gum]
ref|XP_010913548.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    177   5e-61   Elaeis guineensis
ref|XP_006439519.1|  hypothetical protein CICLE_v10024671mg             196   1e-60   
ref|XP_008360711.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    169   1e-60   
gb|AAG52444.1|AC010852_1  putative ubiquitin-conjugating enzyme; ...    168   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008351691.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    169   1e-60   
ref|XP_010559098.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    163   1e-60   Tarenaya hassleriana [spider flower]
ref|XP_010658145.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    197   2e-60   Vitis vinifera
ref|XP_002517368.1|  ubiquitin-conjugating enzyme h, putative           180   2e-60   Ricinus communis
gb|EMT26310.1|  Ubiquitin-conjugating enzyme E2-23 kDa                  167   3e-60   
ref|XP_005650676.1|  ubiquitin conjugating enzyme                       185   5e-60   Coccomyxa subellipsoidea C-169
ref|XP_006600654.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    189   6e-60   
ref|XP_008453111.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    189   6e-60   
gb|ACU23231.1|  unknown                                                 193   6e-60   Glycine max [soybeans]
ref|XP_009397799.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    167   9e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB08192.1|  hypothetical protein B456_001G070300                    174   9e-60   Gossypium raimondii
ref|XP_006374515.1|  hypothetical protein POPTR_0015s08470g             185   2e-59   
ref|XP_005849389.1|  hypothetical protein CHLNCDRAFT_57433              175   3e-59   Chlorella variabilis
ref|XP_008780945.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    189   3e-59   
ref|XP_008780947.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    189   4e-59   
ref|XP_010935784.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    195   7e-59   Elaeis guineensis
emb|CCG82921.1|  Ubiquitin-conjugating enzyme E2 8                      180   2e-58   Taphrina deformans PYCC 5710
ref|XP_002955388.1|  hypothetical protein VOLCADRAFT_65865              179   3e-58   Volvox carteri f. nagariensis
ref|XP_006295061.1|  hypothetical protein CARUB_v10024128mg             182   3e-58   
gb|AAA32902.1|  ubiquitin conjugating enzyme                            190   5e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007036157.1|  Ubiquitin-conjugating enzyme E2 5 isoform 3        162   5e-58   
ref|XP_007382143.1|  hypothetical protein PUNSTDRAFT_119552             176   6e-58   Punctularia strigosozonata HHB-11173 SS5
gb|ADE77794.1|  unknown                                                 170   7e-58   Picea sitchensis
ref|XP_007880708.1|  hypothetical protein PFL1_04988                    177   7e-58   Anthracocystis flocculosa PF-1
ref|XP_006679982.1|  hypothetical protein BATDEDRAFT_35380              176   8e-58   Batrachochytrium dendrobatidis JAM81
gb|KFH71855.1|  ubiquitin-conjugating enzyme E2 8                       176   9e-58   Mortierella verticillata NRRL 6337
emb|CDH55830.1|  ubiquitin-conjugating enzyme e2 8                      174   1e-57   Lichtheimia corymbifera JMRC:FSU:9682
gb|KIZ01797.1|  ubiquitin-conjugating enzyme E2 H                       172   1e-57   Monoraphidium neglectum
gb|ESA07486.1|  hypothetical protein GLOINDRAFT_349458                  176   1e-57   
gb|KDN40970.1|  putative ubiquitin-conjugating enzyme e2-23 kda         177   2e-57   Tilletiaria anomala UBC 951
ref|XP_001906091.1|  hypothetical protein                               173   2e-57   Podospora anserina S mat+
ref|XP_006446454.1|  hypothetical protein CICLE_v10018163mg             159   3e-57   Citrus clementina [clementine]
dbj|GAC76043.1|  ubiquitin-protein ligase                               177   3e-57   Moesziomyces antarcticus T-34
ref|XP_010913552.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    164   3e-57   Elaeis guineensis
ref|XP_010913547.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    176   4e-57   
gb|EST05256.1|  ubiquitin-protein ligase                                177   4e-57   Kalmanozyma brasiliensis GHG001
ref|XP_006470380.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    158   4e-57   Citrus sinensis [apfelsine]
emb|CDS09344.1|  Putative Ubiquitin-conjugating enzyme E2 8             174   5e-57   Lichtheimia ramosa
gb|KDE04596.1|  ubiquitin-conjugating enzyme E2 8                       177   5e-57   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_005536164.1|  probable ubiquitin conjugating enzyme E2           176   6e-57   
gb|EMS19964.1|  ubiquitin-conjugating enzyme E2 H                       174   7e-57   
emb|CDX95675.1|  BnaC03g25560D                                          177   7e-57   
ref|XP_009854632.1|  hypothetical protein NEUTE1DRAFT_96207             174   7e-57   
ref|XP_010913546.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    177   9e-57   
ref|XP_009267919.1|  Ubiquitin-conjugating enzyme E2 8                  173   1e-56   
ref|XP_011389494.1|  putative E2 ubiquitin-conjugating protein          176   1e-56   
emb|CBQ73369.1|  probable ubiquitin-conjugating enzyme e2-23 kda        175   1e-56   
ref|XP_005716365.1|  Ubiquitin-conjugating enzyme, E2                   171   1e-56   
ref|XP_001690015.1|  ubiquitin conjugating enzyme E2                    176   1e-56   
emb|CDI53810.1|  probable ubiquitin-conjugating enzyme e2-23 kda        175   1e-56   
emb|CCF52557.1|  probable ubiquitin-conjugating enzyme e2-23 kda        175   1e-56   
dbj|GAM89738.1|  hypothetical protein ANO11243_077770                   170   1e-56   
ref|XP_011396851.1|  Ubiquitin-conjugating enzyme E2 5                  175   2e-56   
ref|XP_503847.2|  YALI0E12081p                                          174   2e-56   
ref|XP_007405457.1|  hypothetical protein MELLADRAFT_41986              171   3e-56   
ref|XP_003650501.1|  hypothetical protein THITE_164359                  169   3e-56   
dbj|GAC97554.1|  ubiquitin-conjugating enzyme                           175   3e-56   
dbj|GAA95767.1|  hypothetical protein E5Q_02424                         173   3e-56   
ref|XP_009381639.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    162   3e-56   
ref|XP_007268439.1|  hypothetical protein FOMMEDRAFT_125850             176   4e-56   
ref|XP_002493011.1|  Ubiquitin-conjugating enzyme that negatively...    179   5e-56   
dbj|GAN04128.1|  ubiquitin carrier protein                              173   5e-56   
gb|EPB85018.1|  ubiquitin-conjugating enzyme E2 8                       173   5e-56   
ref|XP_007672937.1|  hypothetical protein BAUCODRAFT_30071              167   5e-56   
dbj|GAK65778.1|  ubiquitin-conjugating enzyme E2 8                      174   6e-56   
gb|EGU78302.1|  hypothetical protein FOXB_11163                         172   6e-56   
ref|XP_005707261.1|  ubiquitin-conjugating enzyme E2                    176   7e-56   
gb|KDO66251.1|  hypothetical protein CISIN_1g030996mg                   185   7e-56   
ref|XP_007786132.1|  Ubiquitin-conjugating enzyme E2 8                  171   7e-56   
ref|XP_004347903.1|  ubiquitin-protein ligase                           175   8e-56   
ref|XP_010663198.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    163   9e-56   
gb|KEQ87270.1|  hypothetical protein M438DRAFT_343637                   168   9e-56   
emb|CEP12098.1|  hypothetical protein                                   172   9e-56   
ref|XP_008034846.1|  hypothetical protein TRAVEDRAFT_27362              174   1e-55   
emb|CAA73327.1|  ubiquitin-conjugating enzyme type E2                   169   1e-55   
gb|EIE82645.1|  ubiquitin-conjugating enzyme E2 8                       170   1e-55   
ref|XP_003664159.1|  hypothetical protein MYCTH_2111167                 171   1e-55   
gb|EME49711.1|  hypothetical protein DOTSEDRAFT_40871                   168   1e-55   
gb|KDQ21024.1|  hypothetical protein BOTBODRAFT_27040                   170   1e-55   
gb|EXX79120.1|  E2 ubiquitin-conjugating protein UBC8                   176   1e-55   
ref|XP_004366442.1|  Putative E2                                        167   2e-55   
gb|KIP10616.1|  hypothetical protein PHLGIDRAFT_84895                   172   2e-55   
ref|NP_596617.1|  ubiquitin conjugating enzyme Ubc8 (predicted)         173   3e-55   
ref|XP_007366093.1|  hypothetical protein DICSQDRAFT_86817              172   3e-55   
ref|XP_007391644.1|  hypothetical protein PHACADRAFT_249257             171   4e-55   
ref|XP_001876684.1|  predicted protein                                  169   4e-55   
gb|KIK06689.1|  hypothetical protein K443DRAFT_247023                   170   4e-55   
ref|XP_006694468.1|  putative ubiquitin carrier protein                 168   5e-55   
gb|KDR83726.1|  hypothetical protein GALMADRAFT_236073                  170   5e-55   
ref|XP_007875589.1|  hypothetical protein PNEG_03497                    173   5e-55   
ref|XP_010252951.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    176   5e-55   
ref|XP_007920494.1|  hypothetical protein MYCFIDRAFT_76860              167   5e-55   
gb|ETS00385.1|  ubiquitin-conjugating enzyme h                          167   5e-55   
emb|CEG73548.1|  Putative Ubiquitin-conjugating enzyme E2 8             170   6e-55   
gb|KIM46172.1|  hypothetical protein M413DRAFT_441240                   169   7e-55   
gb|KIV91990.1|  ubiquitin-conjugating enzyme E2 8                       169   9e-55   
gb|KII95190.1|  hypothetical protein PLICRDRAFT_205760                  169   9e-55   
gb|KDQ28956.1|  hypothetical protein PLEOSDRAFT_61374                   171   1e-54   
gb|EFA81552.1|  hypothetical protein PPL_05541                          166   1e-54   
gb|KEF51743.1|  ubiquitin-conjugating enzyme E2 8                       169   1e-54   
gb|EJU06180.1|  hypothetical protein DACRYDRAFT_19458                   172   1e-54   
gb|EFX01184.1|  ubiquitin-conjugating enzyme h                          164   2e-54   
gb|EPS95351.1|  hypothetical protein FOMPIDRAFT_1032934                 170   2e-54   
ref|XP_007844616.1|  ubiquitin-conjugating enzyme h                     171   2e-54   
ref|XP_005706624.1|  ubiquitin-conjugating enzyme E2                    169   3e-54   
ref|XP_007730641.1|  ubiquitin-conjugating enzyme E2 8                  168   3e-54   
gb|KIW45588.1|  ubiquitin-conjugating enzyme E2 8                       167   3e-54   
gb|KIX05777.1|  ubiquitin-conjugating enzyme E2 8                       167   3e-54   
gb|KIW49095.1|  ubiquitin-conjugating enzyme E2 8                       167   3e-54   
ref|XP_009158176.1|  ubiquitin-conjugating enzyme E2 8                  167   3e-54   
gb|KIM90816.1|  hypothetical protein PILCRDRAFT_811304                  167   4e-54   
gb|EPS57160.1|  ubiquitin carrier protein                               178   4e-54   
gb|KIW16224.1|  ubiquitin-conjugating enzyme E2 8                       167   4e-54   
gb|KIY00429.1|  ubiquitin-conjugating enzyme E2 8                       167   4e-54   
gb|KIV80147.1|  ubiquitin-conjugating enzyme E2 8                       167   4e-54   
gb|KIW96198.1|  ubiquitin-conjugating enzyme E2 8                       167   5e-54   
ref|XP_007742766.1|  ubiquitin-conjugating enzyme E2 8                  167   5e-54   
gb|EPX71182.1|  ubiquitin conjugating enzyme Ubc8                       170   5e-54   
ref|XP_007752403.1|  ubiquitin-conjugating enzyme E2 8                  167   5e-54   
ref|XP_007719409.1|  ubiquitin-conjugating enzyme E2 8                  167   6e-54   
gb|EMF16740.1|  ubiquitin-conjugating enzyme E2-21 kDa 2                161   6e-54   
ref|XP_008718299.1|  ubiquitin-conjugating enzyme E2 8                  167   6e-54   
ref|XP_008438167.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    181   7e-54   
ref|XP_008721807.1|  ubiquitin-conjugating enzyme E2 8                  167   7e-54   
gb|KIY49232.1|  ubiquitin-conjugating enzyme E2 8                       168   9e-54   
gb|KIY71413.1|  hypothetical protein CYLTODRAFT_418803                  168   9e-54   
ref|XP_001394668.2|  ubiquitin-conjugating enzyme E2 8                  162   1e-53   
ref|XP_001268055.1|  ubiquitin-conjugating enzyme h                     162   1e-53   
emb|CAK96987.1|  unnamed protein product                                162   1e-53   
ref|XP_641236.1|  hypothetical protein DDB_G0280091                     167   1e-53   
ref|XP_010252952.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    174   1e-53   
gb|KIJ56675.1|  hypothetical protein M422DRAFT_22830                    165   1e-53   
ref|XP_002557642.1|  Pc12g08100                                         159   2e-53   
gb|EPY53623.1|  ubiquitin conjugating enzyme Ubc8                       171   2e-53   
gb|EXV05682.1|  ubiquitin-activating enzyme E2 family protein           163   2e-53   
gb|AFR97603.1|  ubiquitin-conjugating enzyme E2 H                       160   3e-53   
dbj|GAM19728.1|  hypothetical protein SAMD00019534_029030               166   3e-53   
gb|KIL70043.1|  hypothetical protein M378DRAFT_599232                   162   3e-53   
gb|KIK68144.1|  hypothetical protein GYMLUDRAFT_36982                   165   3e-53   
gb|KIK30702.1|  hypothetical protein PISMIDRAFT_306973                  162   4e-53   
gb|KIO30272.1|  hypothetical protein M407DRAFT_242293                   163   4e-53   
ref|XP_010913551.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    165   5e-53   
gb|KIZ07239.1|  ubiquitin-conjugating enzyme E2 H                       160   6e-53   
emb|CAA63316.1|  ubiquitin--protein ligase                              163   6e-53   
ref|XP_007862289.1|  ubiquitin--protein ligase                          165   6e-53   
ref|XP_007773392.1|  ubiquitin-conjugating enzyme                       162   6e-53   
ref|XP_001837183.2|  ubiquitin-conjugating enzyme                       162   7e-53   
gb|KIJ20034.1|  hypothetical protein PAXINDRAFT_67754                   160   7e-53   
gb|KIK48892.1|  hypothetical protein CY34DRAFT_797682                   162   7e-53   
gb|KIK97150.1|  hypothetical protein PAXRUDRAFT_136890                  161   8e-53   
gb|EJT52901.1|  ubiquitin-conjugating enzyme                            158   8e-53   
ref|XP_007338063.1|  hypothetical protein AURDEDRAFT_110494             164   9e-53   
ref|XP_007002480.1|  hypothetical protein TREMEDRAFT_37661              162   9e-53   
ref|XP_003298790.1|  hypothetical protein PTT_09607                     159   9e-53   
ref|XP_003065972.1|  Ubiquitin-conjugating enzyme E2-21 kDa 2 , p...    159   9e-53   
gb|KIM67981.1|  hypothetical protein SCLCIDRAFT_1210133                 160   1e-52   
emb|CDM35301.1|  Ubiquitin-conjugating enzyme E2 8                      155   1e-52   
gb|EMT17761.1|  Ubiquitin-conjugating enzyme E2 5                       130   1e-52   
gb|KGO72464.1|  Ubiquitin-conjugating enzyme, E2                        156   1e-52   
gb|AAA32901.1|  ubiquitin conjugating enzyme                            176   2e-52   
gb|KIO12969.1|  hypothetical protein M404DRAFT_703782                   161   2e-52   
ref|XP_007303039.1|  ubiquitin-conjugating enzyme                       164   2e-52   
gb|KDQ64512.1|  hypothetical protein JAAARDRAFT_166836                  162   2e-52   
ref|XP_005824619.1|  hypothetical protein GUITHDRAFT_158581             168   2e-52   
gb|KEQ61405.1|  hypothetical protein M437DRAFT_85856                    156   3e-52   
gb|ESX01162.1|  Ubiquitin-conjugating enzyme E2 8                       170   3e-52   
gb|EHK48290.1|  hypothetical protein TRIATDRAFT_146505                  159   3e-52   
gb|KDP25854.1|  hypothetical protein JCGZ_22884                         165   4e-52   
ref|XP_002172123.1|  ubiquitin conjugating enzyme Ubc8                  160   4e-52   
gb|KIJ70547.1|  hypothetical protein HYDPIDRAFT_78736                   159   4e-52   
ref|XP_001773359.1|  predicted protein                                  134   6e-52   
gb|ETS62102.1|  hypothetical protein PaG_03662                          159   6e-52   
gb|KIW49096.1|  ubiquitin-conjugating enzyme E2 8, variant              166   7e-52   
gb|KIH90221.1|  ubiquitin-conjugating enzyme E2 H                       158   7e-52   
ref|XP_003852932.1|  hypothetical protein MYCGRDRAFT_70925              153   7e-52   
ref|XP_003324644.2|  ubiquitin-conjugating enzyme E2 8                  156   8e-52   
ref|XP_006669273.1|  Ubiquitin-conjugating enzyme                       156   1e-51   
gb|KFY77199.1|  hypothetical protein V499_03362                         156   1e-51   
gb|KIW78814.1|  hypothetical protein Z517_08653                         166   2e-51   
ref|XP_008599556.1|  ubiquitin-conjugating enzyme                       157   2e-51   
ref|XP_002797359.1|  ubiquitin-conjugating enzyme                       156   2e-51   
ref|XP_009543669.1|  hypothetical protein HETIRDRAFT_425501             159   3e-51   
ref|XP_003036455.1|  ubiquitin-conjugating-protein                      159   3e-51   
ref|XP_009649614.1|  ubiquitin-conjugating enzyme                       154   3e-51   
gb|EUN27589.1|  hypothetical protein COCVIDRAFT_37296                   154   4e-51   
ref|XP_007684347.1|  hypothetical protein COCMIDRAFT_85460              154   4e-51   
emb|CEJ91747.1|  Putative Ubiquitin-conjugating enzyme                  155   4e-51   
ref|XP_001383392.1|  hypothetical protein PICST_57900                   167   4e-51   
gb|EXX79122.1|  E2 ubiquitin-conjugating protein UBC8                   154   5e-51   
emb|CCO26476.1|  ubiquitin-conjugating enzyme E2 H                      155   7e-51   
gb|KHE87499.1|  hypothetical protein GE21DRAFT_1305975                  154   8e-51   
ref|XP_006955762.1|  hypothetical protein WALSEDRAFT_59010              154   8e-51   
gb|EMS49462.1|  Ubiquitin-conjugating enzyme E2 5                       124   8e-51   
ref|XP_004341551.1|  ubiquitinprotein ligase                            152   9e-51   
gb|KEP50321.1|  ubiquitin-conjugating enzyme E2                         156   1e-50   
ref|XP_003001904.1|  ubiquitin-conjugating enzyme                       152   1e-50   
gb|KEQ74345.1|  ubiquitin-conjugating enzyme                            150   2e-50   
gb|KEH18845.1|  ubiquitin-conjugating enzyme                            127   3e-50   
ref|XP_003867944.1|  Ubc8 protein                                       165   3e-50   
emb|CEP62236.1|  LALA0S05e00914g1_1                                     171   3e-50   
ref|XP_457242.2|  DEHA2B06512p                                          163   4e-50   
emb|CCK71601.1|  hypothetical protein KNAG_0H01870                      168   4e-50   
emb|CCE40645.1|  hypothetical protein CPAR2_106800                      164   5e-50   
gb|KJA30262.1|  hypothetical protein HYPSUDRAFT_273670                  170   6e-50   
ref|XP_008681159.1|  PREDICTED: uncharacterized protein LOC100193...    123   6e-50   
ref|XP_007783473.1|  ubiquitin-conjugating enzyme E2 H                  149   7e-50   
ref|XP_007315619.1|  hypothetical protein SERLADRAFT_367087             149   8e-50   
ref|XP_002550291.1|  ubiquitin-conjugating enzyme E2-21 kDa 2           162   9e-50   
ref|XP_001931954.1|  ubiquitin-conjugating enzyme E2 H                  149   1e-49   
ref|XP_002416842.1|  ubiquitin carrier protein, putative; ubiquit...    163   1e-49   
ref|XP_712965.1|  hypothetical protein CaO19.4540                       163   1e-49   
ref|XP_010913553.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    169   1e-49   
gb|KDD74288.1|  ubiquitin-conjugating enzyme                            144   1e-49   
gb|EMG46831.1|  Ubiquitin carrier protein                               163   1e-49   
gb|EMR85631.1|  putative ubiquitin-conjugating enzyme protein           149   1e-49   
ref|XP_009494520.1|  ubiquitin-conjugating enzyme E2 H, variant         153   1e-49   
ref|XP_010940569.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    122   1e-49   
ref|XP_010940568.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    122   2e-49   
ref|XP_003349160.1|  hypothetical protein SMAC_06996                    149   2e-49   
ref|XP_009261095.1|  hypothetical protein FPSE_09703                    149   2e-49   
ref|XP_006684658.1|  hypothetical protein CANTEDRAFT_112946             162   3e-49   
gb|EJY82170.1|  Ubiquitin-conjugating enzyme E2, putative               161   3e-49   
ref|XP_008901421.1|  hypothetical protein, variant 1                    152   3e-49   
ref|XP_004194772.1|  Piso0_005288                                       161   3e-49   
ref|XP_002909127.1|  ubiquitin-conjugating enzyme E2, putative          152   4e-49   
ref|WP_028830608.1|  hypothetical protein                               155   4e-49   
ref|XP_007372314.1|  hypothetical protein SPAPADRAFT_58026              160   4e-49   
ref|XP_750804.2|  ubiquitin conjugating enzyme Ubc8                     147   5e-49   
ref|XP_009529493.1|  hypothetical protein PHYSODRAFT_354813             152   5e-49   
ref|XP_567303.1|  hypothetical protein CNJ00500                         146   5e-49   
emb|CCD49367.1|  similar to ubiquitin-conjugating enzyme                147   5e-49   
gb|EPZ32929.1|  Ubiquitin-conjugating enzyme, E2 domain-containin...    149   5e-49   
ref|XP_008438030.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    125   5e-49   
gb|EUC57754.1|  ubiquitin-conjugating enzyme E2                         150   6e-49   
gb|KFY79713.1|  hypothetical protein V498_08924                         148   6e-49   
ref|XP_001744316.1|  hypothetical protein                               158   8e-49   
ref|XP_003688495.1|  hypothetical protein TPHA_0O00920                  165   8e-49   
emb|CCM02495.1|  predicted protein                                      150   9e-49   
ref|XP_003294949.1|  hypothetical protein DICPUDRAFT_44157              150   9e-49   
ref|XP_003958840.1|  hypothetical protein KAFR_0H02960                  162   1e-48   
dbj|GAA22813.1|  K7_Ubc8p                                               164   1e-48   
emb|CBJ32978.1|  ubiquitin-conjugating enzyme type E2                   154   1e-48   
gb|EAS35834.3|  ubiquitin-conjugating enzyme E2 8                       145   1e-48   
gb|EHN02811.1|  Ubc8p                                                   163   1e-48   
gb|KFY45963.1|  hypothetical protein V494_00683                         146   2e-48   
ref|XP_001526758.1|  ubiquitin-conjugating enzyme E2-21 kDa 2           164   2e-48   
ref|XP_001644268.1|  hypothetical protein Kpol_1030p18                  160   2e-48   
ref|NP_010904.2|  E2 ubiquitin-conjugating protein UBC8                 162   3e-48   
ref|XP_004195863.1|  Piso0_005288                                       159   3e-48   
gb|KGO41002.1|  Ubiquitin-conjugating enzyme, E2                        141   3e-48   
emb|CDI81712.1|  ubiquitin-conjugating enzyme e2, putative              146   4e-48   
gb|KIR56893.1|  ubiquitin-conjugating enzyme E2-24 kDa                  142   4e-48   
ref|XP_003193949.1|  ubiquitin-conjugating enzyme                       142   4e-48   
ref|XP_451487.1|  hypothetical protein                                  164   4e-48   
emb|CAA50503.1|  ubiquitin carrier protein                              166   5e-48   
gb|EGE03752.1|  ubiquitin-conjugating enzyme h                          145   5e-48   
gb|KDB24337.1|  hypothetical protein H109_03782                         145   6e-48   
gb|KIR26500.1|  ubiquitin-conjugating enzyme E2-24 kDa                  141   7e-48   
gb|KGB75201.1|  ubiquitin-protein ligase                                141   8e-48   
emb|CDW91337.1|  ubiquitin-conjugating enzyme                           144   8e-48   



>ref|XP_011072993.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Sesamum indicum]
Length=183

 Score =   211 bits (536),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 98/101 (97%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMM+DYKVE INDGMQEFYVEFHGPKESPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMTDYKVETINDGMQEFYVEFHGPKESPYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   104 bits (260),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR+AYEQ VKE+CEKYAK  DAGVA
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRSAYEQRVKEYCEKYAKPEDAGVA  155



>gb|EYU38331.1| hypothetical protein MIMGU_mgv1a014569mg [Erythranthe guttata]
Length=185

 Score =   209 bits (531),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMM+DYKVEMINDGMQEF+VEFHGPKESPYQ GVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMTDYKVEMINDGMQEFFVEFHGPKESPYQEGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   105 bits (263),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNG+AAALMMRDRTAY+Q+VKE+CEKYAKA DAGVA
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAAALMMRDRTAYDQKVKEYCEKYAKAEDAGVA  155



>ref|XP_011080934.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Sesamum indicum]
Length=183

 Score =   212 bits (539),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 100/101 (99%), Positives = 101/101 (100%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPK+SPYQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKDSPYQGGVWRVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   101 bits (252),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAA+MMRDR AYEQ VKE+CEKYAK  DAG A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAAMMMRDRNAYEQRVKEYCEKYAKPEDAGAA  155



>ref|XP_010089080.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
 gb|EXB37327.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
Length=183

 Score =   211 bits (536),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 101/101 (100%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKESPY+GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESPYEGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   102 bits (253),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRT YEQ VKE+CEKYAK+ D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTTYEQRVKEYCEKYAKSEDIGAA  155



>emb|CDP12044.1| unnamed protein product [Coffea canephora]
Length=184

 Score =   210 bits (534),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 98/101 (97%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPK+SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKDSPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (250),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ VKE+CEKYAK  DAG A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRNTYEQRVKEYCEKYAKPEDAGAA  155



>gb|KDP25412.1| hypothetical protein JCGZ_20568 [Jatropha curcas]
Length=183

 Score =   209 bits (531),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 101/101 (100%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYVEF+GPK+SPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVEFNGPKDSPYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   101 bits (252),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR+AYEQ VKE+CEKYAKA D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRSAYEQRVKEYCEKYAKAEDIG  153



>ref|XP_009592682.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Nicotiana 
tomentosiformis]
Length=183

 Score =   208 bits (530),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMM+DYKVEMINDGMQEFYVEFHGPKESPYQGGVW+VRV LPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMTDYKVEMINDGMQEFYVEFHGPKESPYQGGVWKVRVGLPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVN+IYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNRIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   101 bits (251),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRT Y+Q VKE+CEKYAK+ DAG
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTTYDQRVKEYCEKYAKSEDAG  153



>ref|XP_007040285.1| Ubiquitin-conjugating enzyme 5 [Theobroma cacao]
 gb|EOY24786.1| Ubiquitin-conjugating enzyme 5 [Theobroma cacao]
Length=184

 Score =   207 bits (526),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPKESPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESPYHGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   102 bits (254),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEYCEKYAKPEDVGAA  155



>ref|XP_002509830.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
 gb|EEF51217.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
Length=183

 Score =   206 bits (525),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 101/101 (100%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYVEF+GPK+SPYQGG+WR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVEFNGPKDSPYQGGLWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   102 bits (255),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGV  532
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQ VKE+CEKYAK  D GV
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEYCEKYAKPEDVGV  154



>ref|XP_009790425.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Nicotiana 
sylvestris]
Length=183

 Score =   208 bits (529),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMM+DYKVEMINDGMQEFYVEFHGPKESPYQGGVW+VRVELPD YP
Sbjct  1    MSSPSKRREMDLMKLMMTDYKVEMINDGMQEFYVEFHGPKESPYQGGVWKVRVELPDVYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+N+IYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINRIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   101 bits (251),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRT Y+Q VKE+CEKYAK+ DAG
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTTYDQRVKEYCEKYAKSEDAG  153



>ref|XP_004245589.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Solanum lycopersicum]
Length=183

 Score =   208 bits (530),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 98/101 (97%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+VEFHGPKESPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFHGPKESPYLGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (249),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRT Y+Q+VKE+CEKYAK  DAG
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTTYDQKVKEYCEKYAKKEDAG  153



>ref|XP_002276343.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Vitis vinifera]
 ref|XP_010661801.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Vitis vinifera]
 emb|CAN74060.1| hypothetical protein VITISV_024680 [Vitis vinifera]
 emb|CBI40397.3| unnamed protein product [Vitis vinifera]
Length=184

 Score =   206 bits (523),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP +SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSDSPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   102 bits (255),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEYCEKYAKPEDVGAA  155



>ref|XP_006343959.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Solanum tuberosum]
Length=183

 Score =   208 bits (530),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 98/101 (97%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+VEFHGPKESPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFHGPKESPYLGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (248),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRT Y+Q VKE+CEKYAK  DAG
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTTYDQRVKEYCEKYAKKEDAG  153



>ref|XP_007209658.1| hypothetical protein PRUPE_ppa012080mg [Prunus persica]
 ref|XP_008238927.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Prunus mume]
 gb|EMJ10857.1| hypothetical protein PRUPE_ppa012080mg [Prunus persica]
Length=184

 Score =   208 bits (529),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 101/101 (100%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+F+GPKESPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFNGPKESPYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (248),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR+AYEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRSAYEQRVKEYCEKYAKPEDIGGA  155



>ref|XP_010670105.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Beta 
vulgaris subsp. vulgaris]
Length=183

 Score =   207 bits (528),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPSESPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NK+YHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKMYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (250),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  DAG
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRAAYEQRVKEYCEKYAKPEDAG  153



>ref|XP_010055667.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Eucalyptus 
grandis]
Length=183

 Score =   210 bits (535),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 98/101 (97%), Positives = 101/101 (100%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPK+SPYQGG+WR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKDSPYQGGLWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 97.8 bits (242),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNP+DPLNGEAAA+MMRDR AYEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPADPLNGEAAAIMMRDRGAYEQRVKEYCEKYAKPEDVGAA  155



>ref|XP_006476536.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Citrus sinensis]
 gb|KDO76260.1| hypothetical protein CISIN_1g029962mg [Citrus sinensis]
Length=184

 Score =   206 bits (523),  Expect(2) = 8e-75, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESSYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score =   101 bits (252),  Expect(2) = 8e-75, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY+Q VKEFCEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYDQRVKEFCEKYAKPEDIGGA  155



>gb|KEH18844.1| ubiquitin-conjugating enzyme [Medicago truncatula]
Length=185

 Score =   208 bits (529),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPYQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSESPYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 98.6 bits (244),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPTYEQRVKEYCEKYAKPEDIGAA  155



>ref|XP_007135093.1| hypothetical protein PHAVU_010G100200g [Phaseolus vulgaris]
 gb|ESW07087.1| hypothetical protein PHAVU_010G100200g [Phaseolus vulgaris]
Length=183

 Score =   206 bits (525),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (249),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAAL+MRDRT+YEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALLMRDRTSYEQRVKEYCEKYAKPEDIGAA  155



>gb|AFK34026.1| unknown [Medicago truncatula]
Length=185

 Score =   208 bits (529),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPYQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSESPYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 98.2 bits (243),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPTYEQRVKEYCEKYAKPEDLGAA  155



>ref|XP_009375015.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Pyrus 
x bretschneideri]
Length=183

 Score =   206 bits (523),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+F GPKESPYQ GVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFKGPKESPYQEGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (249),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY+Q VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYDQRVKEYCEKYAKEEDVGGA  155



>ref|XP_011029312.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Populus euphratica]
Length=212

 Score =   213 bits (541),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  19   LSIQEFEGERTRK*KVIMSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESP  198
            L  Q+   +R +K    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPKES 
Sbjct  13   LFFQQSARKRQKKEGAKMSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESL  72

Query  199  YQGGVWRVRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YQGGVWR+RVELPDAYPYKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  73   YQGGVWRIRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  130


 Score = 93.6 bits (231),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPN SDPLNGEAAALMMRD T Y+Q VKE+CEKYAK  D G
Sbjct  131  VFEVFLPQLLLYPNASDPLNGEAAALMMRDHTGYDQRVKEYCEKYAKPEDIG  182



>ref|XP_009783359.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Nicotiana sylvestris]
Length=183

 Score =   204 bits (519),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+V+VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKVKVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDL N
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLTN  101


 Score =   101 bits (252),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQ VKE+C+KYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQSVKEYCQKYAKPEDVGAA  155



>gb|KHF98807.1| Ubiquitin-conjugating enzyme E2 5 -like protein [Gossypium arboreum]
Length=184

 Score =   205 bits (522),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPK+SPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKDSPYHGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (248),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRT+YEQ VKE+CEKYAK  D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTSYEQRVKEYCEKYAKPEDIG  153



>ref|XP_002511883.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
 gb|EEF50552.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
Length=183

 Score =   205 bits (522),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP +SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNDSPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (248),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYAKPEDIGAA  155



>ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max]
 gb|AAF03236.1|AF180143_1 ubiquitin carrier protein 4 [Glycine max]
 gb|KHN26954.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=183

 Score =   206 bits (524),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 99.0 bits (245),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRATYEQRVKEYCEKYAKPEDIGAA  155



>ref|XP_007218489.1| hypothetical protein PRUPE_ppa012120mg [Prunus persica]
 gb|EMJ19688.1| hypothetical protein PRUPE_ppa012120mg [Prunus persica]
Length=183

 Score =   206 bits (525),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYV+FHGP ESPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFYVDFHGPSESPYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 99.0 bits (245),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKEFC+KYAK  D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRAAYEQRVKEFCQKYAKPEDIG  153



>ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Glycine max]
Length=183

 Score =   206 bits (524),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 99.0 bits (245),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRATYEQRVKEYCEKYAKPEDIGAA  155



>ref|XP_011092673.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Sesamum indicum]
Length=183

 Score =   204 bits (518),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP +SPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPTDSPYHGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   101 bits (251),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYE  V+E+CEKYAKA DAG A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRGAYEHRVREYCEKYAKAEDAGAA  155



>ref|XP_010275657.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Nelumbo nucifera]
Length=183

 Score =   204 bits (518),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+F+GP +SPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFNGPSDSPYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFV KIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVTKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (250),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQ VKE+CEKYAK  + G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEYCEKYAKPENVGAA  155



>ref|XP_010940566.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X3 
[Elaeis guineensis]
Length=184

 Score =   204 bits (519),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFANKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (249),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+CEKYAK  DAG
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAG  153



>ref|XP_008233026.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Prunus mume]
Length=183

 Score =   206 bits (524),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYV+FHGP ESPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFYVDFHGPSESPYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 98.2 bits (243),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAA+MMRDR AYEQ VKEFC+KYAK  D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAAMMMRDRAAYEQRVKEFCQKYAKPEDIG  153



>gb|KJB39652.1| hypothetical protein B456_007G023700 [Gossypium raimondii]
Length=184

 Score =   205 bits (522),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPK+SPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKDSPYHGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 98.6 bits (244),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRAAYEQRVKEYCEKYAKPEDIG  153



>ref|XP_006661803.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Oryza brachyantha]
Length=183

 Score =   202 bits (513),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWRVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   102 bits (253),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+CEKYAK  DAGV 
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVT  155



>gb|KDP28606.1| hypothetical protein JCGZ_14377 [Jatropha curcas]
Length=183

 Score =   201 bits (512),  Expect(2) = 9e-74, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKV++IND MQEFYV FHGP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNESPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   102 bits (253),  Expect(2) = 9e-74, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEYCEKYAKPEDIGAA  155



>ref|XP_008779270.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Phoenix dactylifera]
Length=184

 Score =   202 bits (514),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKES YQGGVW++RVELP AYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPGAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLIN  101


 Score =   101 bits (251),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+CEKYAK  DAG +
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCEKYAKPDDAGAS  155



>ref|XP_004510772.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Cicer 
arietinum]
Length=184

 Score =   206 bits (523),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP +SPYQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVIFHGPNDSPYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 97.8 bits (242),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  Y+Q VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRATYDQRVKEYCEKYAKPEDIGAA  155



>ref|XP_007139813.1| hypothetical protein PHAVU_008G060900g [Phaseolus vulgaris]
 gb|ESW11807.1| hypothetical protein PHAVU_008G060900g [Phaseolus vulgaris]
Length=183

 Score =   206 bits (525),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPK+SPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPKDSPYLGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 96.7 bits (239),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR+AYE  VKE+CEKYAK  D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRSAYELRVKEYCEKYAKPEDIG  153



>ref|XP_004229945.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Solanum lycopersicum]
Length=184

 Score =   206 bits (523),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 97.4 bits (241),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYE  VKEFC+KYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRAAYELRVKEFCQKYAKPEDVGAA  155



>ref|XP_004143895.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
 ref|XP_004169019.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
 ref|XP_008437307.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Cucumis melo]
 gb|KGN50082.1| hypothetical protein Csa_5G152970 [Cucumis sativus]
Length=183

 Score =   203 bits (516),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVE IND MQEFYV+FHGPK+S YQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETINDSMQEFYVDFHGPKDSLYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (248),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAA+MMRDRTAYEQ VKE+CEKYAK  D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAAVMMRDRTAYEQRVKEYCEKYAKPEDIG  153



>ref|XP_003552403.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Glycine max]
 gb|KHM99359.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=183

 Score =   205 bits (521),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGP +SPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 98.2 bits (243),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR +YEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPSYEQRVKEYCEKYAKPEDIGEA  155



>ref|XP_008801319.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Phoenix dactylifera]
Length=183

 Score =   203 bits (517),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYV FHGP ES YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVYFHGPNESLYQGGVWRVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 99.8 bits (247),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVF+PQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+CEKYAK  DAG
Sbjct  102  VFEVFIPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAG  153



>ref|XP_002279927.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 isoform X1 [Vitis 
vinifera]
 emb|CAN60588.1| hypothetical protein VITISV_023123 [Vitis vinifera]
 emb|CBI34362.3| unnamed protein product [Vitis vinifera]
Length=183

 Score =   205 bits (521),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYV+FHGP +SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPGDSPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 97.8 bits (242),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  + G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYAKPENIGAA  155



>gb|ABB47726.2| Ubiquitin-conjugating enzyme E2-23 kDa, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EEC67067.1| hypothetical protein OsI_33825 [Oryza sativa Indica Group]
 gb|EEE51050.1| hypothetical protein OsJ_31710 [Oryza sativa Japonica Group]
Length=183

 Score =   200 bits (509),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   102 bits (253),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+CEKYAK  DAGV 
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVT  155



>ref|XP_009626849.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
tomentosiformis]
Length=183

 Score =   202 bits (514),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKMKVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDL N
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLTN  101


 Score =   100 bits (248),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            +FEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQ VKE+C+KYAK  D G A
Sbjct  102  MFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEYCQKYAKPEDVGAA  155



>ref|XP_002465854.1| hypothetical protein SORBIDRAFT_01g047040 [Sorghum bicolor]
 gb|EER92852.1| hypothetical protein SORBIDRAFT_01g047040 [Sorghum bicolor]
Length=183

 Score =   201 bits (512),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPNESIYQGGVWRVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (250),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGV  532
            VFEVFLPQLLLYPNPSDPLNG+AAALMMRDR AYEQ+VKE+CEKYAK  DAGV
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAAALMMRDRPAYEQKVKEYCEKYAKPEDAGV  154



>ref|XP_010255296.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Nelumbo nucifera]
Length=183

 Score =   202 bits (515),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+V+F+GP +SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFHVDFNGPSDSPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 99.8 bits (247),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNG+AAALMMRDR AYEQ+VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAAALMMRDRAAYEQKVKEYCEKYAKPEDIGAA  155



>ref|XP_006339599.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
tuberosum]
Length=184

 Score =   206 bits (523),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPTESPYHGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 96.3 bits (238),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AY+  VKEFC+KYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRAAYDLRVKEFCQKYAKPEDVGAA  155



>ref|XP_008794268.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Phoenix dactylifera]
Length=183

 Score =   204 bits (519),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYV+FHGP ES YQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPNESLYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 97.8 bits (242),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+CE+YAK  D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCERYAKPEDIG  153



>ref|XP_002467149.1| hypothetical protein SORBIDRAFT_01g020460 [Sorghum bicolor]
 ref|XP_004982987.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Setaria italica]
 gb|EER94147.1| hypothetical protein SORBIDRAFT_01g020460 [Sorghum bicolor]
Length=183

 Score =   200 bits (508),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPTESIYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   101 bits (252),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+CEKYAK  DAG+ 
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGIT  155



>ref|XP_010087938.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
 gb|EXB30860.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
Length=183

 Score =   207 bits (526),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGP +SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPSDSPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 94.7 bits (234),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+ EKYAK  D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRAAYEQRVKEYREKYAKPEDIG  153



>ref|NP_001266400.1| putative ubiquitin-conjugating enzyme family [Zea mays]
 gb|ACR38079.1| unknown [Zea mays]
 tpg|DAA49816.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=370

 Score =   201 bits (510),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  188  MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  247

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  248  YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  288


 Score =   100 bits (250),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ+VKE+CEKYAK  DAG+ 
Sbjct  289  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPVYEQKVKEYCEKYAKPEDAGIT  342


 Score =   201 bits (510),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 74.7 bits (182),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK  490
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ+ K
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPVYEQKGK  140



>ref|XP_011023305.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Populus euphratica]
 gb|ABK96745.1| unknown [Populus trichocarpa x Populus deltoides]
Length=183

 Score =   203 bits (516),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVE+INDGMQEFYV F+GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNESPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 98.2 bits (243),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRD+ AYEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDKPAYEQRVKEYCEKYAKPEDIGAA  155



>ref|NP_001242818.1| uncharacterized protein LOC100805356 [Glycine max]
 gb|ACU13261.1| unknown [Glycine max]
Length=183

 Score =   203 bits (516),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGP +SPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NK YHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKFYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 98.2 bits (243),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR +YEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPSYEQRVKEYCEKYAKPEDIGEA  155



>ref|XP_004985701.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Setaria italica]
Length=183

 Score =   200 bits (509),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPNESIYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (250),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNG+AAALMMRDR AYEQ+VKE+CEKYAK  DAGV 
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVV  155



>ref|XP_009628118.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Nicotiana tomentosiformis]
Length=183

 Score =   205 bits (522),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPTESPYHGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 95.5 bits (236),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAA+LMMRDR AYE  VKE+C+KYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAASLMMRDRAAYELRVKEYCQKYAKPEDVGAA  155



>ref|XP_010234781.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Brachypodium 
distachyon]
Length=184

 Score =   200 bits (509),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (250),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+C+KYAK  DAG+ 
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCQKYAKPEDAGIT  155



>ref|XP_007051764.1| Ubiquitin-conjugating enzyme E2 5 isoform 2 [Theobroma cacao]
 gb|EOX95921.1| Ubiquitin-conjugating enzyme E2 5 isoform 2 [Theobroma cacao]
Length=183

 Score =   201 bits (511),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMIND MQEFYV F GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDSMQEFYVHFSGPNESPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (248),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRGAYEQRVKEYCEKYAKPEDIGAA  155



>ref|XP_008647817.1| PREDICTED: ubiquitin-conjugating enzyme E2-21 kDa 1 isoform X1 
[Zea mays]
 tpg|DAA43379.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=183

 Score =   199 bits (506),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKV+M+NDGMQEF+VEF GP ES YQGG+WRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMVNDGMQEFFVEFRGPNESIYQGGIWRVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   101 bits (252),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNG+AAALMMRDR AYEQ+VKE+CEKYAK  DAGV+
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVS  155



>ref|XP_008647901.1| PREDICTED: putative ubiquitin-conjugating enzyme family isoform 
X1 [Zea mays]
Length=361

 Score =   200 bits (508),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  179  MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  238

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  239  YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  279


 Score =   100 bits (249),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ+VKE+CEKYAK  DAG+ 
Sbjct  280  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPVYEQKVKEYCEKYAKPEDAGIT  333


 Score =   172 bits (435),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            MMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYPYKSPSIGF+NKIYHP
Sbjct  7    MMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYPYKSPSIGFINKIYHP  66

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  67   NVDEMSGSVCLDVINQTWSPMFDLVN  92


 Score = 74.7 bits (182),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK  490
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ+ K
Sbjct  93   VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPVYEQKGK  131



>ref|XP_009349265.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Pyrus 
x bretschneideri]
Length=183

 Score =   201 bits (510),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGM EFYV+FHGP +S YQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMHEFYVDFHGPTDSIYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNK+YHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKMYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 99.8 bits (247),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKEFC KYAKA D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEFCLKYAKAEDIGAA  155



>ref|XP_004306758.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Fragaria vesca 
subsp. vesca]
Length=183

 Score =   206 bits (523),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYV+FHGP ESPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFYVDFHGPSESPYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 94.7 bits (234),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR +YEQ VKE+C KYAK  D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRASYEQRVKEYCLKYAKPEDIG  153



>ref|XP_010676458.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Beta vulgaris subsp. 
vulgaris]
Length=186

 Score =   207 bits (528),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGP +SPYQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPSDSPYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 92.8 bits (229),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFE FLPQLLLYPNPSDPLNGEAAAL+MRD+  YEQ VKE+CEKYAK  D G
Sbjct  102  VFEAFLPQLLLYPNPSDPLNGEAAALLMRDKATYEQRVKEYCEKYAKPEDIG  153



>ref|XP_008438028.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Cucumis melo]
Length=183

 Score =   204 bits (519),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV+FHGP ESPY GG+WR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGVQEFYVDFHGPSESPYHGGLWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 96.3 bits (238),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATD  523
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+CE+YAK  D
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRVAYEQKVKEYCERYAKPED  151



>ref|XP_008787422.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X1 
[Phoenix dactylifera]
Length=184

 Score =   200 bits (508),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            Y+SPSIGFV KI HPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YRSPSIGFVTKICHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (249),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+CEKYAK  DAG
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAG  153



>ref|NP_001132171.1| uncharacterized protein LOC100193596 [Zea mays]
 gb|ACF80907.1| unknown [Zea mays]
 gb|AFW68671.1| putative ubiquitin-conjugating enzyme family [Zea mays]
Length=186

 Score =   200 bits (508),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (249),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ+VKE+CEKYAK  DAG+ 
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPVYEQKVKEYCEKYAKPEDAGIT  155



>ref|NP_001132906.1| uncharacterized protein LOC100194405 [Zea mays]
 gb|ACF81944.1| unknown [Zea mays]
 gb|AFW89659.1| putative ubiquitin-conjugating enzyme family [Zea mays]
Length=183

 Score =   199 bits (506),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPNESIYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (250),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNG+AAALMMRDR AYEQ+VKE+CEKYAK  DAGV 
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAAALMMRDRPAYEQKVKEYCEKYAKPGDAGVT  155



>ref|XP_010234779.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Brachypodium 
distachyon]
Length=184

 Score =   200 bits (508),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (248),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR +YEQ+VKE+C+KYAK  DAG+ 
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPSYEQKVKEYCQKYAKPEDAGIT  155



>ref|XP_002298025.1| Ubiquitin-conjugating enzyme E2-21 kDa 3 family protein [Populus 
trichocarpa]
 gb|ABK95388.1| unknown [Populus trichocarpa]
 gb|EEE82830.1| Ubiquitin-conjugating enzyme E2-21 kDa 3 family protein [Populus 
trichocarpa]
Length=183

 Score =   206 bits (523),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 94.4 bits (233),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPN SDPLNGEAAALMMRD TAY+Q VKE+CEKYAK  D G
Sbjct  102  VFEVFLPQLLLYPNASDPLNGEAAALMMRDHTAYDQRVKEYCEKYAKPEDIG  153



>ref|XP_006358673.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
tuberosum]
Length=183

 Score =   200 bits (508),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKIKVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NK+YHPNVDE+SGSVCLDVINQTWSPMFDL N
Sbjct  61   YKSPSIGFINKMYHPNVDEISGSVCLDVINQTWSPMFDLTN  101


 Score =   100 bits (248),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQ VKE+C+KYAK  D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEYCQKYAKPEDVG  153



>ref|XP_004248050.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
lycopersicum]
Length=183

 Score =   200 bits (508),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKIKVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NK+YHPNVDE+SGSVCLDVINQTWSPMFDL N
Sbjct  61   YKSPSIGFINKMYHPNVDEISGSVCLDVINQTWSPMFDLTN  101


 Score =   100 bits (248),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQ VKE+C+KYAK  D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEYCQKYAKPEDVG  153



>tpg|DAA49812.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
 tpg|DAA49815.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=183

 Score =   199 bits (507),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (248),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ+VKE+CEKYAK  DAG+ 
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPVYEQKVKEYCEKYAKPEDAGIT  155



>gb|KJB52144.1| hypothetical protein B456_008G248000 [Gossypium raimondii]
Length=184

 Score =   206 bits (525),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYVEF+GPK+SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMMNDGMQEFYVEFNGPKDSPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 93.6 bits (231),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYE++VKE+ EKYAK  D   A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEEKVKEYREKYAKPEDVAGA  155



>ref|XP_008342748.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
 ref|XP_008338824.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
Length=183

 Score =   202 bits (513),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGM EFYV+FHGP +S YQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMHEFYVDFHGPTDSIYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 97.8 bits (242),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKEFC KYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEFCLKYAKPEDIGAA  155



>ref|XP_002302592.2| ubiquitin carrier protein 4 [Populus trichocarpa]
 gb|EEE81865.2| ubiquitin carrier protein 4 [Populus trichocarpa]
Length=183

 Score =   203 bits (516),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVE+INDGMQEFYV F+GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNESPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 96.7 bits (239),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRD+ AYEQ V+E+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDKPAYEQRVEEYCEKYAKPEDIGAA  155



>ref|XP_011093127.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Sesamum 
indicum]
Length=183

 Score =   202 bits (514),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP +SPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSDSPYHGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NK+YHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKMYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 97.4 bits (241),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+C++YAK  D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRAAYEQKVKEYCQRYAKPEDVG  153



>ref|XP_004133859.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
Length=183

 Score =   203 bits (517),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV+FHGP ESPY GG+WR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGVQEFYVDFHGPSESPYHGGLWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFLNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 96.3 bits (238),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATD  523
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+CE+YAK  D
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRVAYEQKVKEYCERYAKPED  151



>gb|ACG24376.1| ubiquitin-conjugating enzyme E2-21 kDa 1 [Zea mays]
Length=183

 Score =   199 bits (505),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKV+M+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVQMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score =   100 bits (249),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ+VKE+CEKYAK  DAG+ 
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPVYEQKVKEYCEKYAKPEDAGIT  155



>ref|XP_004298815.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Fragaria vesca 
subsp. vesca]
Length=184

 Score =   201 bits (510),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVE I+D MQEF+V+F+GPKESPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETIDDDMQEFFVDFNGPKESPYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQ WSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQNWSPMFDLVN  101


 Score = 97.8 bits (242),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRD+TAYEQ VKEF EKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDKTAYEQRVKEFREKYAKPEDIGAA  155



>ref|XP_009367807.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Pyrus x bretschneideri]
Length=190

 Score =   201 bits (512),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGM EFYV+FHGP +S YQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMHEFYVDFHGPTDSIYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 97.1 bits (240),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKEFC KYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEFCLKYAKPEDIGGA  155



>ref|XP_010933128.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X1 
[Elaeis guineensis]
Length=183

 Score =   202 bits (513),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYV+FHGP +S YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPNDSLYQGGVWRVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNK+YHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKMYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 96.7 bits (239),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+C++YAK  D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCQRYAKPEDIG  153



>ref|XP_009400670.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   202 bits (513),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+V+FHGP ES YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVDFHGPNESLYQGGVWRVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NK+YHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKMYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 96.7 bits (239),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYE++VKE+C+KYAK  D G +
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEEKVKEYCQKYAKPEDIGAS  155



>emb|CDP08792.1| unnamed protein product [Coffea canephora]
Length=183

 Score =   199 bits (507),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKV++INDGMQEFYV FHGP +SPY GGVW++RVELPD+YP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDIINDGMQEFYVHFHGPNDSPYHGGVWKIRVELPDSYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 98.6 bits (244),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRD+TAYEQ VKE+C+KYAK  D G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDQTAYEQRVKEYCQKYAKPEDVG  153



>ref|XP_010935786.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X3 
[Elaeis guineensis]
Length=184

 Score =   201 bits (511),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGPKES YQ GVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVVFHGPKESLYQAGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVN+I+HPNVDEMSGSVCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSIGFVNRIFHPNVDEMSGSVCLDVINQTWSPMFDLIN  101


 Score = 97.1 bits (240),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            +FE FLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CE+YAK  DAG
Sbjct  102  IFEAFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCERYAKPEDAG  153



>ref|XP_009397539.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   200 bits (508),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVE +NDG+QEF+V+FHGP ES YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETVNDGIQEFFVDFHGPSESLYQGGVWRVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 97.8 bits (242),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+C+KYAK  D G +
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCKKYAKPEDIGAS  155



>gb|EMT01071.1| Ubiquitin-conjugating enzyme E2 5 [Aegilops tauschii]
Length=185

 Score =   196 bits (497),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVE +NDGMQEF VEF GP+ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETVNDGMQEFLVEFRGPQESLYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            Y+SPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YRSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score =   101 bits (252),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAAL+MRDR AYEQ+VKEFCEKYAK  DAG+ 
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALLMRDRPAYEQKVKEFCEKYAKPEDAGIT  155



>ref|XP_006827545.1| hypothetical protein AMTR_s00009p00214490 [Amborella trichopoda]
 gb|ERM94961.1| hypothetical protein AMTR_s00009p00214490 [Amborella trichopoda]
Length=183

 Score =   204 bits (518),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MDLMKLMMSDYKV+MINDGMQEFYV+FHGP ESPYQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMSDYKVDMINDGMQEFYVDFHGPNESPYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMF+LVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFELVN  101


 Score = 93.6 bits (231),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGV  532
            VFEVFLPQLLLYPNP+DPLNGEAAALMMRDRTAYEQ V+E+ EKYAK    GV
Sbjct  102  VFEVFLPQLLLYPNPTDPLNGEAAALMMRDRTAYEQRVQEYKEKYAKPEHVGV  154



>gb|EMS63342.1| Ubiquitin-conjugating enzyme E2 5 [Triticum urartu]
Length=185

 Score =   196 bits (497),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVE +NDGMQEF VEF GP+ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETVNDGMQEFLVEFRGPEESLYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            Y+SPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YRSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score =   101 bits (252),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAAL+MRDR AYEQ+VKEFCEKYAK  DAG+ 
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALLMRDRPAYEQKVKEFCEKYAKPEDAGIT  155



>ref|XP_009791637.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Nicotiana 
sylvestris]
Length=183

 Score =   201 bits (512),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV F GP ESPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFLGPTESPYHGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 95.5 bits (236),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAA+LMMRDR AYE  VKE+C+KYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAASLMMRDRAAYELRVKEYCQKYAKPEDVGAA  155



>ref|XP_001759393.1| predicted protein [Physcomitrella patens]
 gb|EDQ75695.1| predicted protein [Physcomitrella patens]
Length=183

 Score =   199 bits (507),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVEM+NDGM EFYVEFHGP+ESPYQ G W++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYKVEMVNDGMSEFYVEFHGPRESPYQEGTWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVN+I+HPNVDEMSGSVCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSIGFVNRIFHPNVDEMSGSVCLDVINQTWSPMFDLIN  101


 Score = 97.1 bits (240),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNP+DPLNGEAAALMMRDR  YEQ+VKE+CE+YAKA D G
Sbjct  102  VFEVFLPQLLLYPNPTDPLNGEAAALMMRDREHYEQKVKEYCERYAKAEDIG  153



>gb|KDO86231.1| hypothetical protein CISIN_1g030092mg [Citrus sinensis]
Length=183

 Score =   203 bits (516),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV F GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGIQEFYVHFQGPNESPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPN+DEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNIDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 92.8 bits (229),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAAL+MRDR AYEQ VKE+ EKYAKA D   A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALLMRDRAAYEQRVKEYREKYAKAEDIEAA  155



>gb|KJB20631.1| hypothetical protein B456_003G157300 [Gossypium raimondii]
Length=224

 Score =   194 bits (494),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  88   RREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSI  267
            RREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPK+SPY GGVW++RVELPDAYPYKSPSI
Sbjct  47   RREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKDSPYHGGVWKIRVELPDAYPYKSPSI  106

Query  268  GFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            GF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  107  GFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  141


 Score =   101 bits (251),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRT+YEQ VKE+CEKYAK  D G A
Sbjct  142  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTSYEQRVKEYCEKYAKLEDIGAA  195



>gb|AFK43668.1| unknown [Lotus japonicus]
Length=184

 Score =   205 bits (522),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDY VEMINDGMQEFYV FHGPKESPY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYTVEMINDGMQEFYVHFHGPKESPYEGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVD+MSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDDMSGSVCLDVINQTWSPMFDLVN  101


 Score = 90.1 bits (222),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  Y+Q VKE+ EK+AK    G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRATYDQRVKEYIEKFAKPEHIGAA  155



>ref|XP_007051763.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
 gb|EOX95920.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
Length=187

 Score =   201 bits (511),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMIND MQEFYV F GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDSMQEFYVHFSGPNESPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 94.4 bits (233),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 48/58 (83%), Gaps = 4/58 (7%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK----EFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VK    E+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRGAYEQRVKVHHLEYCEKYAKPEDIGAA  159



>ref|XP_011036629.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Populus euphratica]
Length=183

 Score =   201 bits (510),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVE+INDGMQEFYV F+GP ESPY GGVWR++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNESPYHGGVWRIKVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            Y+SPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YRSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 94.4 bits (233),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVF+PQLLLYPNPSDPLNGEAAALMMRD+ AYE  VKE+CEKYAK  D G A
Sbjct  102  VFEVFIPQLLLYPNPSDPLNGEAAALMMRDKPAYELRVKEYCEKYAKPEDIGAA  155



>ref|XP_003525387.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Glycine max]
 gb|KHM99960.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=183

 Score =   204 bits (519),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MDLMKLMMSDYKVE INDGMQEF+VEFHGPK+SPYQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMSDYKVETINDGMQEFFVEFHGPKDSPYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIFHPNVDEVSGSVCLDVINQTWSPMFDLVN  101


 Score = 91.3 bits (225),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPN SDPLNG+AAALM+RD   YEQ VKE+CEKYAK  D G A
Sbjct  102  VFEVFLPQLLLYPNASDPLNGDAAALMIRDHATYEQRVKEYCEKYAKPEDVGAA  155



>ref|XP_002320806.1| ubiquitin carrier protein 4 [Populus trichocarpa]
 gb|EEE99121.1| ubiquitin carrier protein 4 [Populus trichocarpa]
Length=183

 Score =   201 bits (510),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVE+INDGMQEFYV F+GP ESPY GGVWR++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNESPYHGGVWRIKVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            Y+SPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YRSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 94.4 bits (233),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVF+PQLLLYPNPSDPLNGEAAALMMRD+ AYE  VKE+CEKYAK  D G A
Sbjct  102  VFEVFIPQLLLYPNPSDPLNGEAAALMMRDKPAYELRVKEYCEKYAKPEDIGAA  155



>ref|XP_006491142.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Citrus sinensis]
Length=183

 Score =   203 bits (517),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV F GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGIQEFYVHFQGPNESPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPN+DEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNIDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 91.7 bits (226),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNG+AAAL+MRDR AYEQ VKE+ EKYAKA D   A
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAAALLMRDRAAYEQRVKEYREKYAKAEDIEAA  155



>ref|XP_009389296.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   201 bits (511),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLM+SDYKVEM+NDGMQEF+V+FHGP ES YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMISDYKVEMVNDGMQEFFVDFHGPNESLYQGGVWRVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 93.2 bits (230),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATD  523
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+C+KYA   D
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCQKYATPED  151



>ref|XP_010275656.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Nelumbo nucifera]
Length=201

 Score =   204 bits (520),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+F+GP +SPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFNGPSDSPYQGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFV KIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVTKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 89.7 bits (221),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 49/72 (68%), Gaps = 18/72 (25%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK------------------EFC  499
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQ VK                  E+C
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKVAVLSIDARCFQLLDDNQEYC  161

Query  500  EKYAKATDAGVA  535
            EKYAK  + G A
Sbjct  162  EKYAKPENVGAA  173



>gb|KHN46724.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=205

 Score =   207 bits (527),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 86.7 bits (213),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 47/76 (62%), Gaps = 22/76 (29%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK---------------------  490
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ VK                     
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRATYEQRVKVENSMSVIHMYQLFTQVHTLS  161

Query  491  -EFCEKYAKATDAGVA  535
             E+CEKYAK  D G A
Sbjct  162  IEYCEKYAKPEDIGAA  177



>ref|XP_006302819.1| hypothetical protein CARUB_v10020943mg, partial [Capsella rubella]
 gb|EOA35717.1| hypothetical protein CARUB_v10020943mg, partial [Capsella rubella]
Length=214

 Score =   200 bits (509),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  30   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFNGPKDSIYEGGVWKIRVELPDAYP  89

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+ KIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  90   YKSPSIGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  130


 Score = 92.4 bits (228),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ VKE+CEKYAK
Sbjct  131  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPTYEQRVKEYCEKYAK  177



>gb|ACN39971.1| unknown [Picea sitchensis]
Length=183

 Score =   199 bits (506),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMM DYKVEMINDGM EFYVEF+GP++SPYQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMGDYKVEMINDGMNEFYVEFNGPRDSPYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIFHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 93.2 bits (230),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNP+DPLNGEAAALMMRDR  YEQ+VKE+C +YAK  D G
Sbjct  102  VFEVFLPQLLLYPNPTDPLNGEAAALMMRDRQVYEQKVKEYCARYAKPEDVG  153



>ref|XP_011022652.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Populus euphratica]
Length=183

 Score =   201 bits (512),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVE+INDGMQEFYVEF+GPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEIINDGMQEFYVEFNGPKESLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQ WSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQNWSPMFDLVN  101


 Score = 90.9 bits (224),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPN  DPLNGEAAALMMRD TAY+Q+VKE+CEKYAK  D G
Sbjct  102  VFEVFLPQLLLYPNALDPLNGEAAALMMRDGTAYDQKVKEYCEKYAKPEDIG  153



>ref|XP_010533643.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Tarenaya hassleriana]
Length=192

 Score =   204 bits (520),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPK+SPY+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKDSPYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFV KIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFVTKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 87.4 bits (215),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFE FLPQLLLYPN SDPLNGEAAAL MRDR AYEQ VKE+ EKYAK   AG
Sbjct  102  VFETFLPQLLLYPNASDPLNGEAAALQMRDRAAYEQRVKEYTEKYAKPEKAG  153



>ref|XP_003557690.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Brachypodium 
distachyon]
Length=186

 Score =   196 bits (497),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYV FHGP +S YQGGVW+VRVEL +AYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVHFHGPNDSIYQGGVWKVRVELTEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 95.9 bits (237),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGV  532
            +FEVFLPQLLLYPNPSDPLNG+AAALMMRD++AY+Q+V+E+C++YAK  DAGV
Sbjct  102  IFEVFLPQLLLYPNPSDPLNGDAAALMMRDQSAYDQKVREYCQRYAKPEDAGV  154



>ref|XP_004503694.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Cicer 
arietinum]
Length=183

 Score =   204 bits (520),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MDLMKLMM+DYKVEMINDGMQEF+VEFHGPK+SPYQ GVW++RVELPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMTDYKVEMINDGMQEFFVEFHGPKDSPYQEGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 87.0 bits (214),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLL YPN SDPLNG+AAALMMRD  AYEQ+VKE+CE+YAK  D G
Sbjct  102  VFEVFLPQLLNYPNASDPLNGDAAALMMRDCAAYEQKVKEYCERYAKPEDIG  153



>gb|ABK23779.1| unknown [Picea sitchensis]
Length=183

 Score =   197 bits (502),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD++KLMM DYKVEMINDGM EFYVEF+GP++SPYQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVIKLMMGDYKVEMINDGMNEFYVEFNGPRDSPYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIFHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 93.6 bits (231),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNP+DPLNGEAAALMMRDR  YEQ+VKE+C +YAK  D G
Sbjct  102  VFEVFLPQLLLYPNPTDPLNGEAAALMMRDRQVYEQKVKEYCARYAKPKDVG  153



>ref|XP_002886384.1| ubiquitin-conjugating enzyme 37 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62643.1| ubiquitin-conjugating enzyme 37 [Arabidopsis lyrata subsp. lyrata]
Length=185

 Score =   199 bits (507),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKDSIYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 91.7 bits (226),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ VKE+CEKYAK
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPTYEQRVKEYCEKYAK  148



>ref|NP_001236928.1| uncharacterized protein LOC100527756 [Glycine max]
 gb|ACU16916.1| unknown [Glycine max]
 gb|KHN16806.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=183

 Score =   201 bits (511),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MDLMKLMMSDYKVE +NDGMQEF+VEFHGPK+SPYQGGVW+VRV+LPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMSDYKVETVNDGMQEFFVEFHGPKDSPYQGGVWKVRVDLPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDEMSGSVCLDVI+QTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIFHPNVDEMSGSVCLDVISQTWSPMFDLVN  101


 Score = 89.7 bits (221),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPN SDPLNG+AAALM+RD   YEQ VKE+CEKYAK  D G
Sbjct  102  VFEVFLPQLLLYPNASDPLNGDAAALMIRDHATYEQRVKEYCEKYAKPEDVG  153



>ref|XP_002304506.1| Ubiquitin-conjugating enzyme E2-21 kDa 3 family protein [Populus 
trichocarpa]
 gb|EEE79485.1| Ubiquitin-conjugating enzyme E2-21 kDa 3 family protein [Populus 
trichocarpa]
Length=183

 Score =   201 bits (510),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YK PSIGF+NKIYHPNVDEMSGSVCLDVINQ WSPMFDLVN
Sbjct  61   YKPPSIGFINKIYHPNVDEMSGSVCLDVINQNWSPMFDLVN  101


 Score = 90.1 bits (222),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPN  DPLNGEAAALMMRD TAY+Q VKE+CEKYAK  D G
Sbjct  102  VFEVFLPQLLLYPNALDPLNGEAAALMMRDGTAYDQRVKEYCEKYAKPEDIG  153



>ref|XP_010940563.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X1 
[Elaeis guineensis]
Length=206

 Score =   190 bits (483),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 98/123 (80%), Gaps = 22/123 (18%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKE-------------------  192
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKE                   
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKEITLEAGRGMHQSLPLLTNF  60

Query  193  ---SPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFD  363
                 YQGGVW++RVELPDAYPYKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFD
Sbjct  61   RDFGLYQGGVWKIRVELPDAYPYKSPSIGFANKIYHPNVDEMSGSVCLDVINQTWSPMFD  120

Query  364  LVN  372
            LVN
Sbjct  121  LVN  123


 Score =   100 bits (248),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+CEKYAK  DAG
Sbjct  124  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAG  175



>ref|XP_003558810.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Brachypodium 
distachyon]
Length=185

 Score =   192 bits (488),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMM DYKVEM+NDGMQEF++EF GP ES YQGGVW+VRVE PDAYP
Sbjct  1    MSSPSKRREMDLMKLMMRDYKVEMVNDGMQEFFIEFRGPNESLYQGGVWKVRVEFPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            Y+SPS+GF NKIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YRSPSVGFCNKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 98.2 bits (243),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAAL+MRDR AYEQ+VKE CEKYAK  DAG+ 
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALLMRDRAAYEQKVKECCEKYAKPEDAGIT  155



>ref|NP_564817.2| ubiquitin-conjugating enzyme E2 5 [Arabidopsis thaliana]
 sp|P42749.2|UBC5_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 5; AltName: Full=Ubiquitin 
carrier protein 5; AltName: Full=Ubiquitin-conjugating 
enzyme E2-21 kDa 2; AltName: Full=Ubiquitin-protein ligase 
5 [Arabidopsis thaliana]
 gb|AAL67043.1| putative E2, ubiquitin-conjugating enzyme UBC5 [Arabidopsis thaliana]
 gb|AAM45109.1| putative E2, ubiquitin-conjugating enzyme UBC5 [Arabidopsis thaliana]
 gb|AAY44846.1| ubiquitinating enzyme [Arabidopsis thaliana]
 dbj|BAF02237.1| putative ubiquitin-conjugating enzyme [Arabidopsis thaliana]
 gb|AEE34149.1| ubiquitin-conjugating enzyme E2 5 [Arabidopsis thaliana]
Length=185

 Score =   198 bits (503),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+VEF GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 92.0 bits (227),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ VKE+CEKYAK
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPTYEQRVKEYCEKYAK  148



>ref|XP_010430489.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Camelina sativa]
 ref|XP_010473625.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Camelina sativa]
Length=186

 Score =   198 bits (503),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFNGPKDSIYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 91.7 bits (226),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ VKE+CEKYAK
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPTYEQRVKEYCEKYAK  148



>ref|XP_010418415.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Camelina sativa]
Length=186

 Score =   198 bits (503),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFNGPKDSIYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 91.7 bits (226),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ VKE+CEKYAK
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPTYEQRVKEYCEKYAK  148



>ref|XP_010559097.1| PREDICTED: ubiquitin-conjugating enzyme E2 6 isoform X1 [Tarenaya 
hassleriana]
Length=183

 Score =   192 bits (489),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMIND M+ FYV FHGP +S YQGGVWR+RVELPD+YP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDEMRAFYVRFHGPTDSLYQGGVWRIRVELPDSYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFVNKIYHPNVDE SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGSVCLDVINQTWSPMFDLVN  101


 Score = 96.7 bits (239),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDP NGEAA+LMMRDR AYEQ+VKE+C++YAK  D G A
Sbjct  102  VFEVFLPQLLLYPNPSDPFNGEAASLMMRDRAAYEQKVKEYCKRYAKPVDIGAA  155



>ref|XP_002868603.1| hypothetical protein ARALYDRAFT_493844 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44862.1| hypothetical protein ARALYDRAFT_493844 [Arabidopsis lyrata subsp. 
lyrata]
Length=189

 Score =   196 bits (497),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYVEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 93.2 bits (230),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDA  526
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  + 
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYAKPGEG  152



>ref|XP_010447359.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Camelina sativa]
Length=189

 Score =   196 bits (497),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYVEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 93.2 bits (230),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDA  526
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  + 
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYAKPGEG  152



>ref|XP_010436081.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Camelina sativa]
Length=188

 Score =   196 bits (497),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYVEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 93.2 bits (230),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDA  526
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  + 
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYAKPGEG  152



>ref|XP_006286283.1| hypothetical protein CARUB_v10007860mg [Capsella rubella]
 gb|EOA19181.1| hypothetical protein CARUB_v10007860mg [Capsella rubella]
Length=191

 Score =   196 bits (497),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYVEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 93.2 bits (230),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDA  526
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  + 
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYAKPGEG  152



>ref|NP_568589.1| ubiquitin-conjugating enzyme E2 4 [Arabidopsis thaliana]
 sp|P42748.2|UBC4_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 4; AltName: Full=Ubiquitin 
carrier protein 4; AltName: Full=Ubiquitin-conjugating 
enzyme E2-21 kDa 1; AltName: Full=Ubiquitin-protein ligase 
4 [Arabidopsis thaliana]
 dbj|BAB08506.1| ubiquitin-conjugating enzyme E2-21 kD 1 (ubiquitin-protein ligase 
4) (ubiquitin carrier protein 4) [Arabidopsis thaliana]
 gb|AAL38801.1| putative E2, ubiquitin-conjugating enzyme UBC4 [Arabidopsis thaliana]
 gb|AAM20237.1| putative ubiquitin-conjugating enzyme E2-21 kD 1 [Arabidopsis 
thaliana]
 gb|AAY44845.1| ubiquitinating enzyme [Arabidopsis thaliana]
 gb|AED94667.1| ubiquitin-conjugating enzyme E2 4 [Arabidopsis thaliana]
Length=187

 Score =   196 bits (497),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYVEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 93.2 bits (230),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDA  526
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  + 
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYAKPGEG  152



>dbj|BAK02014.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02064.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87655.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03350.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=184

 Score =   194 bits (494),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKV+MINDGMQEF+V FHGP +S YQGGVW+VRVEL +AYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMQEFFVHFHGPNDSIYQGGVWKVRVELTEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 94.0 bits (232),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKA  517
            +FEVFLPQLLLYPNPSDPLNGEAA+LMMRD+ AYEQ+VKE+CE+YAKA
Sbjct  102  IFEVFLPQLLLYPNPSDPLNGEAASLMMRDKNAYEQKVKEYCERYAKA  149



>ref|XP_002964045.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 ref|XP_002975471.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 gb|EFJ23672.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 gb|EFJ34378.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
Length=182

 Score =   195 bits (495),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVEM+NDGM EF VEFHGP++SPYQ G W+VRVELP+AYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYKVEMVNDGMNEFNVEFHGPRDSPYQTGTWKVRVELPEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVN+I+HPNVDEMSGSVCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSIGFVNRIFHPNVDEMSGSVCLDVINQTWSPMFDLIN  101


 Score = 93.2 bits (230),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNP+DPLNGEAAALMMRDR  Y+Q+VKE+CE+YAK+ D  
Sbjct  102  VFEVFLPQLLLYPNPTDPLNGEAAALMMRDRDRYDQKVKEYCERYAKSEDTA  153



>ref|XP_010441297.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Camelina sativa]
Length=189

 Score =   194 bits (494),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYVEF+GPK+S YQGGVW++RV+LPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVQLPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 93.2 bits (230),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDA  526
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  + 
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYAKPGEG  152



>ref|XP_006405362.1| hypothetical protein EUTSA_v10027948mg [Eutrema salsugineum]
 dbj|BAJ34442.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46815.1| hypothetical protein EUTSA_v10027948mg [Eutrema salsugineum]
Length=187

 Score =   194 bits (494),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEF+VEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 93.2 bits (230),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDA  526
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  + 
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYAKPGEG  152



>gb|KFK33016.1| hypothetical protein AALP_AA6G319600 [Arabis alpina]
Length=187

 Score =   194 bits (494),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEF+VEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 93.2 bits (230),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDA  526
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  + 
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYAKPGEG  152



>gb|EPS69444.1| ubiquitin carrier protein [Genlisea aurea]
Length=186

 Score =   192 bits (488),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMDLMKLMMSDYKVE INDG+QEF+V FHGP  SPY GGVW++RVELPDAYP
Sbjct  1    MASPSKRREMDLMKLMMSDYKVETINDGVQEFFVHFHGPSGSPYHGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDE+SGSVCLDVINQ WSPMFDLVN
Sbjct  61   YKSPSIGFMNKIYHPNVDEISGSVCLDVINQKWSPMFDLVN  101


 Score = 95.1 bits (235),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATD  523
            VFEVF+PQLLLYPNPSDPLNGEAAALMMRDR AY+Q VKE+CEKYAKA +
Sbjct  102  VFEVFMPQLLLYPNPSDPLNGEAAALMMRDRAAYDQRVKEYCEKYAKAEE  151



>gb|AAA32900.1| ubiquitin conjugating enzyme [Arabidopsis thaliana]
Length=187

 Score =   196 bits (497),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYVEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 90.9 bits (224),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDA  526
            VFE FLPQLLLYPNPSDPLNGEAAALMMRD  AYEQ VKE+CEKYAK  + 
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDHPAYEQRVKEYCEKYAKPGEG  152



>gb|KJB52143.1| hypothetical protein B456_008G248000 [Gossypium raimondii]
Length=171

 Score =   206 bits (523),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYVEF+GPK+SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMMNDGMQEFYVEFNGPKDSPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 80.1 bits (196),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK  490
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYE++VK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEEKVK  140



>ref|XP_010553532.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Tarenaya hassleriana]
Length=189

 Score =   202 bits (515),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+F+GPK+SPY+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFNGPKDSPYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFV KIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFVTKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 83.2 bits (204),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPN SDPLNGEAAAL MRDR AY+Q VKE+ EKYAK
Sbjct  102  VFETFLPQLLLYPNASDPLNGEAAALQMRDRAAYDQRVKEYTEKYAK  148



>sp|P16577.1|UBC4_WHEAT RecName: Full=Ubiquitin-conjugating enzyme E2-23 kDa; AltName: 
Full=Ubiquitin carrier protein; AltName: Full=Ubiquitin-protein 
ligase [Triticum aestivum]
 gb|AAA34309.1| ubiquitin carrier protein [Triticum aestivum]
Length=184

 Score =   194 bits (493),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKV+MINDGM EF+V FHGPK+S YQGGVW+VRVEL +AYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFFVHFHGPKDSIYQGGVWKVRVELTEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 90.9 bits (224),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            +FEVFLPQLLLYPNPSDPLNGEAA+LMMRD+ AYE +VKE+CE+YAK
Sbjct  102  IFEVFLPQLLLYPNPSDPLNGEAASLMMRDKNAYENKVKEYCERYAK  148



>ref|XP_010940567.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X4 
[Elaeis guineensis]
Length=164

 Score =   205 bits (522),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFANKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 79.3 bits (194),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFC  499
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VK   
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKNIA  143



>ref|XP_009397721.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=183

 Score =   194 bits (494),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MS PSKRREMDLMKLMMSDYKVEM NDGM EF V+FHGPKESPYQGGVWR+RVELPD YP
Sbjct  1    MSFPSKRREMDLMKLMMSDYKVEMTNDGMHEFLVDFHGPKESPYQGGVWRIRVELPDGYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            Y SPSIGFVNK+YHPNVDEMSGS+CLDVINQTWSPM+DLVN
Sbjct  61   YHSPSIGFVNKMYHPNVDEMSGSICLDVINQTWSPMYDLVN  101


 Score = 89.4 bits (220),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNP DPLNGEAAAL+MRD  AYEQ+VKE+C KYAK  D G +
Sbjct  102  VFEVFLPQLLLYPNPLDPLNGEAAALLMRDEPAYEQKVKEYCLKYAKPEDIGAS  155



>ref|XP_006465385.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Citrus sinensis]
 gb|KDO76261.1| hypothetical protein CISIN_1g029962mg [Citrus sinensis]
Length=150

 Score =   204 bits (518),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 100/101 (99%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESSYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 80.1 bits (196),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK  490
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY+Q VK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYDQRVK  140



>emb|CDY58954.1| BnaCnng33990D [Brassica napus]
Length=186

 Score =   193 bits (491),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEF+VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 90.5 bits (223),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDA  526
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR  YE  VKE+CEKYAKA + 
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPTYELRVKEYCEKYAKAGEG  152



>ref|XP_003627554.1| Ubiquitin carrier protein [Medicago truncatula]
Length=191

 Score =   185 bits (469),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 95/107 (89%), Gaps = 6/107 (6%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESP---YQGGVWRVRVELPD  240
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP E     YQGGVW+VRVELPD
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSEIDSVLYQGGVWKVRVELPD  60

Query  241  AYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSP---MFDLVN  372
            AYPYKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSP   M  LVN
Sbjct  61   AYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPCLVMIYLVN  107


 Score = 98.6 bits (244),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ VKE+CEKYAK  D G A
Sbjct  108  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPTYEQRVKEYCEKYAKPEDIGAA  161



>ref|XP_010933129.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Elaeis guineensis]
Length=164

 Score =   203 bits (516),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYV+FHGP +S YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPNDSLYQGGVWRVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNK+YHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKMYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 80.1 bits (196),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCE  502
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VK   +
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKNIVK  144



>ref|XP_006598954.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 
[Glycine max]
Length=155

 Score =   205 bits (521),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 77.8 bits (190),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK  490
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ VK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRATYEQRVK  140



>ref|XP_006586692.1| PREDICTED: uncharacterized protein LOC100805356 isoform X1 [Glycine 
max]
Length=166

 Score =   204 bits (519),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGP +SPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 78.2 bits (191),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 43/59 (73%), Gaps = 6/59 (10%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK------EFCEKYAKATDAGV  532
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR +YEQ VK        C+  +K+   G 
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPSYEQRVKVVLFWSSSCQPQSKSKPRGT  160



>gb|ABK21140.1| unknown [Picea sitchensis]
Length=183

 Score =   195 bits (496),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSDYKVEM+NDGM EF VEFHGP++SPY+GGVW++RVELPDAYP
Sbjct  1    MASPSKRREMDVMKLMMSDYKVEMLNDGMHEFNVEFHGPQDSPYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 86.7 bits (213),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDA  526
            VFE FLPQLLLYPNP+DPLNG+AA+LMMRDR  YEQ+VKE+CE+YA+  + 
Sbjct  102  VFESFLPQLLLYPNPTDPLNGDAASLMMRDREQYEQKVKEYCERYARGENG  152



>ref|XP_007051766.1| Ubiquitin-conjugating enzyme E2 5 isoform 4 [Theobroma cacao]
 gb|EOX95923.1| Ubiquitin-conjugating enzyme E2 5 isoform 4 [Theobroma cacao]
Length=174

 Score =   201 bits (511),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMIND MQEFYV F GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDSMQEFYVHFSGPNESPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 80.5 bits (197),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKE  493
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRGAYEQRVKE  141



>ref|XP_009140085.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Brassica rapa]
 emb|CDY39744.1| BnaA04g11090D [Brassica napus]
Length=186

 Score =   193 bits (490),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEF+VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 88.6 bits (218),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDA  526
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR  YE  VKE+CEKYAK  + 
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPTYELRVKEYCEKYAKPGEG  152



>ref|XP_010918820.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Elaeis guineensis]
Length=146

 Score =   202 bits (514),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 96/101 (95%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDY+VEM+NDGMQEFYV FHGP ES YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYRVEMVNDGMQEFYVYFHGPNESLYQGGVWRVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 79.0 bits (193),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK  490
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVK  140



>ref|XP_006853122.1| hypothetical protein AMTR_s00038p00146240 [Amborella trichopoda]
 gb|ERN14589.1| hypothetical protein AMTR_s00038p00146240 [Amborella trichopoda]
Length=184

 Score =   191 bits (486),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVEMINDGM EF VEF+GP ES Y+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYKVEMINDGMHEFNVEFNGPNESLYEGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQTWSPMFDLLN  101


 Score = 89.7 bits (221),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNP+DPLNG+AA+LMMRDR  YEQ+VKE+CE+YAK  +   A
Sbjct  102  VFEVFLPQLLLYPNPTDPLNGDAASLMMRDRQQYEQKVKEYCERYAKRENISNA  155



>ref|XP_010037586.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Eucalyptus 
grandis]
 gb|KCW49310.1| hypothetical protein EUGRSUZ_K02866 [Eucalyptus grandis]
Length=185

 Score =   192 bits (487),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQSWSPMFDLLN  101


 Score = 89.0 bits (219),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPNPSDPLNG+AA+LMM+DR  Y+Q+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMMKDRKQYDQKVKEYCERYAK  148



>ref|XP_011098510.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Sesamum indicum]
Length=187

 Score =   192 bits (488),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKESPY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVEPINDGINEFNVEFHGPKESPYEGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 88.2 bits (217),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPNPSDPLNG+AA+LMM+D+  YEQ+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMMKDKAQYEQKVKEYCERYAK  148



>emb|CDY62172.1| BnaC06g42330D [Brassica napus]
Length=189

 Score =   192 bits (489),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEF+VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 87.4 bits (215),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR  YE  VKE+C+KYAK  ++ 
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPTYELRVKEYCDKYAKPGESS  153



>ref|XP_009125181.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Brassica rapa]
 emb|CDX67494.1| BnaA07g15340D [Brassica napus]
Length=184

 Score =   193 bits (490),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEF+VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 87.4 bits (215),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR  YE  VKE+C+KYAK
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPTYELRVKEYCDKYAK  148



>ref|XP_008787423.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Phoenix dactylifera]
Length=157

 Score =   200 bits (509),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            Y+SPSIGFV KI HPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YRSPSIGFVTKICHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 79.7 bits (195),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGV  532
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VK   ++       G+
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKGCTDRMTAHLQIGL  154



>gb|KGN64295.1| hypothetical protein Csa_1G045930 [Cucumis sativus]
Length=252

 Score =   190 bits (483),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSP+KRR+MD+MKLMMSDYKVEMI+DG+ EF VEF+GPKES Y+GGVW++ VELPDAYP
Sbjct  79   MSSPNKRRDMDVMKLMMSDYKVEMIDDGLSEFNVEFNGPKESVYEGGVWKIHVELPDAYP  138

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMFDL+N
Sbjct  139  YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLLN  179


 Score = 89.4 bits (220),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 50/55 (91%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK---ATDAG  529
            VFEVFLPQLLLYPNPSDPLNG+AA+LM++DR+ Y+Q+VKE+CE+YAK    T++G
Sbjct  180  VFEVFLPQLLLYPNPSDPLNGDAASLMLKDRSQYDQKVKEYCERYAKRENVTNSG  234



>gb|KGN56505.1| hypothetical protein Csa_3G121800 [Cucumis sativus]
Length=163

 Score =   204 bits (518),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV+FHGP ESPY GG+WR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGVQEFYVDFHGPSESPYHGGLWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFLNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 76.3 bits (186),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQE  484
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRVAYEQK  138



>ref|XP_007036155.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
 ref|XP_007036156.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
 gb|EOY20656.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
 gb|EOY20657.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
Length=184

 Score =   191 bits (485),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDEMSGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFMNKIFHPNVDEMSGSVCLDVINQSWSPMFDLLN  101


 Score = 88.6 bits (218),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            +FEVFLPQLLLYPNPSDPLNG+AA+LMM+DR  Y+Q+VKE+CE+YAK
Sbjct  102  IFEVFLPQLLLYPNPSDPLNGDAASLMMKDRKQYDQKVKEYCERYAK  148



>ref|NP_001064719.1| Os10g0447100 [Oryza sativa Japonica Group]
 gb|ABG66102.1| Ubiquitin-conjugating enzyme E2-23 kDa, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26633.1| Os10g0447100 [Oryza sativa Japonica Group]
 dbj|BAG90217.1| unnamed protein product [Oryza sativa Japonica Group]
Length=144

 Score =   201 bits (510),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 79.0 bits (193),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK  490
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVK  140



>ref|XP_010935785.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 
[Elaeis guineensis]
Length=220

 Score =   202 bits (514),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGPKES YQ GVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVVFHGPKESLYQAGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVN+I+HPNVDEMSGSVCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSIGFVNRIFHPNVDEMSGSVCLDVINQTWSPMFDLIN  101


 Score = 76.6 bits (187),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK  490
            +FE FLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VK
Sbjct  102  IFEAFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVK  140



>gb|KDO86232.1| hypothetical protein CISIN_1g030092mg [Citrus sinensis]
Length=153

 Score =   201 bits (511),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV F GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGIQEFYVHFQGPNESPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPN+DEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIYHPNIDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 77.8 bits (190),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK  490
            VFEVFLPQLLLYPNPSDPLNGEAAAL+MRDR AYEQ VK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALLMRDRAAYEQRVK  140



>ref|XP_004251221.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
lycopersicum]
 ref|XP_004251222.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
lycopersicum]
Length=185

 Score =   189 bits (481),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDYKVE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYKVETINDGITEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 88.6 bits (218),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPNPSDPLNG+AA+LMM+D+  YEQ+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMMKDKNQYEQKVKEYCERYAK  148



>gb|KDP31131.1| hypothetical protein JCGZ_11507 [Jatropha curcas]
Length=184

 Score =   191 bits (484),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 87.4 bits (215),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPNPSDPLNG+AA+LM+RDR  Y+Q+VKE+CE+YA+
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMIRDREKYDQKVKEYCERYAR  148



>ref|XP_008393051.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
 ref|XP_008393052.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
 ref|XP_008393053.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
Length=184

 Score =   189 bits (481),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFMNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 88.6 bits (218),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPNPSDPLNG+AA+LMM+DR  Y+Q+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMMKDRKLYDQKVKEYCERYAK  148



>ref|XP_004298926.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Fragaria 
vesca subsp. vesca]
Length=184

 Score =   189 bits (479),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESIYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFMNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 89.0 bits (219),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPNPSDPLNG+AA+LMM+DR  Y+Q+VKE+CEKYAK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMMKDRKLYDQKVKEYCEKYAK  148



>gb|KHG06323.1| Ubiquitin-conjugating enzyme E2 4 -like protein [Gossypium arboreum]
 gb|KJB37061.1| hypothetical protein B456_006G188200 [Gossypium raimondii]
 gb|KJB37062.1| hypothetical protein B456_006G188200 [Gossypium raimondii]
 gb|KJB37064.1| hypothetical protein B456_006G188200 [Gossypium raimondii]
Length=185

 Score =   188 bits (477),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF V+FHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVKFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            +KSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   FKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 89.7 bits (221),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATD  523
            +FEVFLPQLLLYPNPSDPLNG+AA+LMM+DR  Y+Q+VKE+CE+YAK  D
Sbjct  102  IFEVFLPQLLLYPNPSDPLNGDAASLMMKDRKQYDQKVKEYCERYAKKED  151



>ref|XP_007209657.1| hypothetical protein PRUPE_ppa012074mg [Prunus persica]
 ref|XP_008239732.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Prunus 
mume]
 gb|EMJ10856.1| hypothetical protein PRUPE_ppa012074mg [Prunus persica]
Length=184

 Score =   189 bits (481),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFINKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 88.2 bits (217),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPNPSDPLNG+AA+LMM+DR  Y+Q+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMMKDRKLYDQKVKEYCERYAK  148



>ref|XP_002985720.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 gb|EFJ13298.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
Length=183

 Score =   185 bits (470),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPS+RREMD+MKLMMSDYKVEM+NDGM EF V+F GP +SPY+ GVW+VRVELPD+YP
Sbjct  1    MSSPSRRREMDVMKLMMSDYKVEMLNDGMNEFIVDFQGPADSPYESGVWKVRVELPDSYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE SGSVCLDVIN TWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIFHPNVDESSGSVCLDVINHTWSPMFDLVN  101


 Score = 91.7 bits (226),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFE FLPQLLLYPNPSDPLNGEA +LMMRD+  YEQ+VKE+CE+YAK  DA  A
Sbjct  102  VFESFLPQLLLYPNPSDPLNGEAGSLMMRDKEKYEQKVKEYCERYAKPKDAQTA  155



>gb|AFK44595.1| unknown [Medicago truncatula]
Length=185

 Score =   193 bits (490),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLTEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 84.0 bits (206),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPN SDPLNG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLLYPNASDPLNGDAASLMMKDKKLYDQKVKEYCERYAK  148



>ref|XP_002974421.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 gb|EFJ24643.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
Length=183

 Score =   186 bits (471),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPS+RREMD+MKLMMSDYKVEM+NDGM EF V+F GP +SPY+ GVW+VRVELPD+YP
Sbjct  1    MSSPSRRREMDVMKLMMSDYKVEMLNDGMNEFIVDFQGPADSPYESGVWKVRVELPDSYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE SGSVCLDVIN TWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIFHPNVDESSGSVCLDVINHTWSPMFDLVN  101


 Score = 91.3 bits (225),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFE FLPQLLLYPNPSDPLNGEA +LMMRD+  YEQ+VKE+CE+YAK  DA  A
Sbjct  102  VFESFLPQLLLYPNPSDPLNGEAGSLMMRDKERYEQKVKEYCERYAKPKDAQTA  155



>ref|XP_006439774.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 ref|XP_006439775.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 ref|XP_006439776.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 ref|XP_006476744.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Citrus sinensis]
 ref|XP_006476745.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Citrus sinensis]
 gb|ESR53014.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 gb|ESR53015.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 gb|ESR53016.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 gb|KDO69726.1| hypothetical protein CISIN_1g030037mg [Citrus sinensis]
 gb|KDO69727.1| hypothetical protein CISIN_1g030037mg [Citrus sinensis]
Length=184

 Score =   191 bits (485),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQSWSPMFDLLN  101


 Score = 85.9 bits (211),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            +FE FLPQLLLYPNPSDPLNG+AA+LMM+DR  Y+Q+VKE+CE+YAK
Sbjct  102  IFESFLPQLLLYPNPSDPLNGDAASLMMKDRKQYDQKVKEYCERYAK  148



>gb|EPS57624.1| ubiquitin carrier protein, partial [Genlisea aurea]
Length=140

 Score =   198 bits (503),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV F GP +SPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGIQEFYVHFKGPNDSPYHGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 78.6 bits (192),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK  490
            VFEVF+PQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VK
Sbjct  102  VFEVFMPQLLLYPNPSDPLNGEAAALMMRDRAAYEQKVK  140



>ref|XP_004508848.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Cicer 
arietinum]
Length=185

 Score =   192 bits (487),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLSEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 84.7 bits (208),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPN SDPLNG+AA+LMM+D+  YEQ+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLLYPNASDPLNGDAASLMMKDKKLYEQKVKEYCERYAK  148



>ref|XP_007160084.1| hypothetical protein PHAVU_002G291200g [Phaseolus vulgaris]
 gb|ESW32078.1| hypothetical protein PHAVU_002G291200g [Phaseolus vulgaris]
Length=183

 Score =   196 bits (497),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MDLMKLMMSDYKVEMINDGMQEF+VEF GPK+SPY+ GVW+++VELPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMSDYKVEMINDGMQEFFVEFRGPKDSPYEVGVWKIKVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SG+VCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGAVCLDVINQTWSPMFDLVN  101


 Score = 80.9 bits (198),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPN SDPLN + AALM+RD   YEQ VKE+CEKYAK  D G
Sbjct  102  VFEVFLPQLLLYPNASDPLNSD-AALMIRDHATYEQRVKEYCEKYAKPEDIG  152



>gb|KJB37063.1| hypothetical protein B456_006G188200 [Gossypium raimondii]
Length=247

 Score =   187 bits (475),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF V+FHGPKES Y+GGVW++RVELPDAYP
Sbjct  63   MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVKFHGPKESLYEGGVWKIRVELPDAYP  122

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            +KSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  123  FKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  163


 Score = 89.4 bits (220),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATD  523
            +FEVFLPQLLLYPNPSDPLNG+AA+LMM+DR  Y+Q+VKE+CE+YAK  D
Sbjct  164  IFEVFLPQLLLYPNPSDPLNGDAASLMMKDRKQYDQKVKEYCERYAKKED  213



>ref|XP_010532272.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Tarenaya 
hassleriana]
 ref|XP_010532273.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Tarenaya 
hassleriana]
Length=185

 Score =   186 bits (471),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE IND + EF VEFHGPKES Y+GGVW++ VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYSVETINDCLNEFNVEFHGPKESLYEGGVWKIHVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 90.9 bits (224),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            +FEVFLPQLLLYPNPSDPLNG+AA+LMMRDRT Y+Q+V+E+CE+YAK
Sbjct  102  IFEVFLPQLLLYPNPSDPLNGDAASLMMRDRTQYDQKVREYCERYAK  148



>ref|XP_003608946.1| Ubiquitin carrier protein [Medicago truncatula]
 gb|AES91143.1| ubiquitin-conjugating enzyme [Medicago truncatula]
Length=185

 Score =   192 bits (489),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLTEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 83.6 bits (205),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPN SDPLNG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLLYPNASDPLNGDAASLMMKDKKLYDQKVKEYCERYAK  148



>emb|CDP20894.1| unnamed protein product [Coffea canephora]
Length=184

 Score =   184 bits (468),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSDY VE +NDG+ EF V FHGPKES Y+GGVW+V VELPDAYP
Sbjct  1    MTSPSKRREMDVMKLMMSDYSVETVNDGLSEFNVLFHGPKESTYEGGVWKVHVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 91.7 bits (226),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKA  517
            +FEVFLPQLLLYPNPSDPLNG+AA+LMM+D+T YEQ+VKE+CE+YAKA
Sbjct  102  IFEVFLPQLLLYPNPSDPLNGDAASLMMKDKTQYEQKVKEYCERYAKA  149



>ref|XP_008647825.1| PREDICTED: ubiquitin-conjugating enzyme E2-21 kDa 1 isoform X2 
[Zea mays]
Length=162

 Score =   201 bits (511),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKV+M+NDGMQEF+VEF GP ES YQGG+WRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMVNDGMQEFFVEFRGPNESIYQGGIWRVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  101


 Score = 74.7 bits (182),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQE  484
            VFEVFLPQLLLYPNPSDPLNG+AAALMMRDR AYEQ+
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAAALMMRDRPAYEQK  138



>ref|XP_006340324.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
tuberosum]
Length=185

 Score =   187 bits (474),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVETINDGITEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 88.6 bits (218),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPNPSDPLNG+AA+LMM+D+  YEQ+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMMKDKNQYEQKVKEYCERYAK  148



>ref|XP_004152466.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform 1 [Cucumis 
sativus]
 ref|XP_004152467.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform 2 [Cucumis 
sativus]
 ref|XP_004157792.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform 1 [Cucumis 
sativus]
 ref|XP_004157793.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform 2 [Cucumis 
sativus]
 ref|XP_008438150.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Cucumis melo]
 ref|XP_008438158.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Cucumis melo]
Length=183

 Score =   187 bits (475),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSP+KRR+MD+MKLMMSDYKVEMI+DG+ EF VEF+GPKES Y+GGVW++ VELPDAYP
Sbjct  1    MSSPNKRRDMDVMKLMMSDYKVEMIDDGLSEFNVEFNGPKESVYEGGVWKIHVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLLN  101


 Score = 88.2 bits (217),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 50/55 (91%), Gaps = 3/55 (5%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK---ATDAG  529
            VFEVFLPQLLLYPNPSDPLNG+AA+LM++DR+ Y+Q+VKE+CE+YAK    T++G
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMLKDRSQYDQKVKEYCERYAKRENVTNSG  156



>ref|XP_010913550.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X5 [Elaeis guineensis]
Length=184

 Score =   191 bits (485),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKESPY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYIVETINDGLSEFNVEFHGPKESPYEGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDE+SGS+CLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDLLN  101


 Score = 84.3 bits (207),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            +FEVFLPQLLLYPNP+DPLNG+AA+LM++D+  YEQ+VKE+CE+YAK
Sbjct  102  IFEVFLPQLLLYPNPADPLNGDAASLMLKDQQQYEQKVKEYCERYAK  148



>ref|XP_009783360.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Nicotiana sylvestris]
Length=168

 Score =   174 bits (440),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            MMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+V+VELPDAYPYKSPSIGFVNKIYHP
Sbjct  1    MMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKVKVELPDAYPYKSPSIGFVNKIYHP  60

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDEMSGSVCLDVINQTWSPMFDL N
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLTN  86


 Score =   101 bits (252),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQ VKE+C+KYAK  D G A
Sbjct  87   VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQSVKEYCQKYAKPEDVGAA  140



>ref|XP_009592505.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
tomentosiformis]
 ref|XP_009592506.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
tomentosiformis]
 ref|XP_009794391.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
sylvestris]
 ref|XP_009794393.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
sylvestris]
Length=185

 Score =   187 bits (474),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVETINDGITEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 88.6 bits (218),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPNPSDPLNG+AA+LMM+D+  YEQ+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMMKDKNQYEQKVKEYCERYAK  148



>ref|XP_011028598.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Populus euphratica]
 ref|XP_011028599.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Populus euphratica]
Length=186

 Score =   188 bits (478),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++ VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESIYEGGVWKIHVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 86.7 bits (213),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLL+YPNPSDPLNG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLIYPNPSDPLNGDAASLMMKDKEQYDQKVKEYCERYAK  148



>ref|XP_007155401.1| hypothetical protein PHAVU_003G198300g [Phaseolus vulgaris]
 gb|ESW27395.1| hypothetical protein PHAVU_003G198300g [Phaseolus vulgaris]
Length=185

 Score =   191 bits (485),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLSEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 84.0 bits (206),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPN SDPLNG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLLYPNASDPLNGDAASLMMKDKKLYDQKVKEYCERYAK  148



>ref|XP_006470379.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Citrus sinensis]
Length=187

 Score =   186 bits (471),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSP KRREMD+MKLMMSDY VE INDG+ E  VEFHGPK+S Y+GG+W++RVELPDAYP
Sbjct  1    MSSPCKRREMDVMKLMMSDYSVEPINDGISELKVEFHGPKDSLYEGGIWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQTWSPMFDLLN  101


 Score = 89.4 bits (220),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            +FEVFLPQLLLYPNPSDPLNG+AA+LMM+DR  YEQ VKE+CE+YAK
Sbjct  102  IFEVFLPQLLLYPNPSDPLNGDAASLMMKDRKQYEQRVKEYCERYAK  148



>gb|EYU42972.1| hypothetical protein MIMGU_mgv1a0146272mg, partial [Erythranthe 
guttata]
Length=140

 Score =   196 bits (499),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSP+KRREMDLMKLMMSDYKVEMINDGM +FYV FHGP +SPY GGVW+VRVELPDAYP
Sbjct  1    MSSPTKRREMDLMKLMMSDYKVEMINDGMHQFYVHFHGPSDSPYHGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NK+YHPNVDE SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSIGFINKMYHPNVDETSGSVCLDVINQTWSPMFDLVN  101


 Score = 78.2 bits (191),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK  490
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRD+ AYEQ+VK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDKAAYEQKVK  140



>gb|KHN29339.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=185

 Score =   176 bits (447),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +1

Query  103  LMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNK  282
            + + MMSDYKVEMINDGMQEFYV+FHGP +SPY GGVW+VRVELPDAYPYKSPSIGF+NK
Sbjct  14   VFRRMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINK  73

Query  283  IYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            IYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  74   IYHPNVDEMSGSVCLDVINQTWSPMFDLVN  103


 Score = 98.2 bits (243),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR +YEQ VKE+CEKYAK  D G A
Sbjct  104  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPSYEQRVKEYCEKYAKPEDIGEA  157



>ref|XP_008780946.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Phoenix dactylifera]
Length=234

 Score =   189 bits (480),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKESPY+GGVW+V VELPDAYP
Sbjct  51   MSSPSKRRDMDVMKLMMSDYTVETINDGLSEFNVEFHGPKESPYEGGVWKVHVELPDAYP  110

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDE+SGS+CLDVINQ+WSPMFDL N
Sbjct  111  YKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDLSN  151


 Score = 85.1 bits (209),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            +FEVFLPQLLLYPNP+DPLNG+AA+LM++D+  YEQ+VKE+CE+YAK
Sbjct  152  IFEVFLPQLLLYPNPADPLNGDAASLMLKDQQQYEQKVKEYCERYAK  198



>gb|KJB39653.1| hypothetical protein B456_007G023700 [Gossypium raimondii]
Length=169

 Score =   176 bits (445),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            MMSDYKVEMINDGMQEFYVEF+GPK+SPY GGVW++RVELPDAYPYKSPSIGF+NKIYHP
Sbjct  1    MMSDYKVEMINDGMQEFYVEFNGPKDSPYHGGVWKIRVELPDAYPYKSPSIGFINKIYHP  60

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVN  86


 Score = 98.6 bits (244),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  D G
Sbjct  87   VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRAAYEQRVKEYCEKYAKPEDIG  138



>ref|XP_006600652.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X1 
[Glycine max]
 ref|XP_006600653.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Glycine max]
 gb|KHN18475.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=184

 Score =   191 bits (484),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYAVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 83.2 bits (204),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPN SDPLNG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLLYPNASDPLNGDAASLMMKDKKLYDQKVKEYCERYAK  148



>ref|XP_010107447.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
 gb|EXC16031.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
Length=186

 Score =   186 bits (473),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPK+S Y+GG W++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKDSLYEGGFWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SG+VCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGAVCLDVINQSWSPMFDLLN  101


 Score = 87.0 bits (214),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPNPSDPLNG+AA+LMM++R  Y+Q+VKE+CEKYAK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMMKNRKLYDQKVKEYCEKYAK  148



>ref|XP_010254946.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
 ref|XP_010254947.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
 ref|XP_010254948.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
Length=184

 Score =   184 bits (467),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMM+DYKVE IND + EF+VEF+GP  S Y GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMTDYKVETINDSVSEFFVEFNGPPNSLYSGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVN+IYHPN+DEMSGSVCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSIGFVNRIYHPNIDEMSGSVCLDVINQTWSPMFDLIN  101


 Score = 89.7 bits (221),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATD  523
            +FEVFLPQLLLYPNP+DPLNGEAAALMMRDR  YEQ+VKE C +YAK  D
Sbjct  102  IFEVFLPQLLLYPNPTDPLNGEAAALMMRDRKVYEQKVKEHCARYAKPED  151



>ref|XP_002321579.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
 gb|ABK95704.1| unknown [Populus trichocarpa]
 gb|EEF05706.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
Length=186

 Score =   187 bits (474),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ +F VEFHGPKES Y+GGVW++ VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNDFNVEFHGPKESLYEGGVWKIHVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 86.7 bits (213),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLL+YPNPSDPLNG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLIYPNPSDPLNGDAASLMMKDKEQYDQKVKEYCERYAK  148



>ref|XP_004138119.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
 ref|XP_004166497.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
 gb|KGN63598.1| hypothetical protein Csa_1G005590 [Cucumis sativus]
Length=188

 Score =   189 bits (481),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VEMINDG+ EF VEFHGPKES Y+ GVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVEMINDGLSEFNVEFHGPKESLYEAGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 83.6 bits (205),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATD  523
            VFEVFLPQLLLYPNPSDPLNG+AA+LMM+D   Y+++VKE+CE+YAK  +
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMMKDPKQYDEKVKEYCERYAKKDN  151



>gb|AFK44151.1| unknown [Lotus japonicus]
Length=186

 Score =   189 bits (481),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLSEFNVEFHGPKESLYEGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            +KSPSIGFVNKI+HPNVDE+SGSVCLDVINQ WSPMFDL+N
Sbjct  61   FKSPSIGFVNKIFHPNVDELSGSVCLDVINQNWSPMFDLLN  101


 Score = 83.6 bits (205),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPN SDPLNG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  102  VFEVFLPQLLLYPNASDPLNGDAASLMMKDKKLYDQKVKEYCERYAK  148



>ref|XP_008453110.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Cucumis melo]
Length=187

 Score =   189 bits (481),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VEMINDG+ EF VEFHGPKES Y+ GVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVEMINDGLSEFNVEFHGPKESLYEAGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 83.2 bits (204),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATD  523
            VFEVFLPQLLLYPNPSDPLNG+AA+LMM+D   Y+++VKE+CE+YAK  +
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMMKDPKQYDEKVKEYCERYAKKDN  151



>ref|XP_009381635.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009381636.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009381637.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009381638.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   189 bits (480),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDY VE  NDG+ EF VEFHGPK+SPY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVETTNDGLTEFNVEFHGPKQSPYEGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDE+SGS+CLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDLLN  101


 Score = 83.2 bits (204),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            +FEVFLPQLLLYPNP+DPLNG+AA+L+++D+  YEQ+VKE+CE+YAK
Sbjct  102  IFEVFLPQLLLYPNPADPLNGDAASLLLKDQQQYEQKVKEYCERYAK  148



>ref|XP_002280126.2| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Vitis vinifera]
 ref|XP_003634294.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Vitis vinifera]
 ref|XP_010663196.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Vitis vinifera]
 emb|CBI15064.3| unnamed protein product [Vitis vinifera]
Length=184

 Score =   191 bits (486),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 80.9 bits (198),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPN SDPLNG+AA++MM+++  YE++VKE+CE+YAK
Sbjct  102  VFEVFLPQLLLYPNASDPLNGDAASMMMKNKDQYEKKVKEYCERYAK  148



>gb|KDP45387.1| hypothetical protein JCGZ_09636 [Jatropha curcas]
Length=217

 Score =   186 bits (473),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++ VELPDAYP
Sbjct  31   MSSPSKRRDMDVMKLMMSDYAVEPINDGISEFNVEFHGPKESLYEGGVWKIHVELPDAYP  90

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDEMSGSVCLDVINQ+WSPMFDL+N
Sbjct  91   YKSPSIGFLNKIFHPNVDEMSGSVCLDVINQSWSPMFDLLN  131


 Score = 85.5 bits (210),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPNPSDPLNG+AA+LMM+D+  YE++VKE+CE YAK
Sbjct  132  VFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYEEKVKEYCELYAK  178



>gb|EYU44716.1| hypothetical protein MIMGU_mgv1a014494mg [Erythranthe guttata]
 gb|EYU44717.1| hypothetical protein MIMGU_mgv1a014494mg [Erythranthe guttata]
Length=187

 Score =   189 bits (479),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKESPY+GG W+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYIVEPINDGINEFNVEFHGPKESPYEGGFWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 83.2 bits (204),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            +FEVFLPQLLLYPNP DPLNG+AA+LMM+D+T Y+ +VKE+CE+YAK
Sbjct  102  IFEVFLPQLLLYPNPLDPLNGDAASLMMKDKTQYDLKVKEYCERYAK  148



>ref|XP_006397787.1| hypothetical protein EUTSA_v10001650mg [Eutrema salsugineum]
 gb|ESQ39240.1| hypothetical protein EUTSA_v10001650mg [Eutrema salsugineum]
Length=189

 Score =   184 bits (467),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S YQGGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLIN  101


 Score = 87.4 bits (215),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATD  523
            VFE FLPQLLLYPNPSDP NGEAA+L+MRDR AYEQ+VKE+C+ YAK  D
Sbjct  102  VFESFLPQLLLYPNPSDPFNGEAASLLMRDRAAYEQKVKEYCKTYAKPED  151



>ref|XP_006405361.1| hypothetical protein EUTSA_v10027948mg [Eutrema salsugineum]
 gb|ESQ46814.1| hypothetical protein EUTSA_v10027948mg [Eutrema salsugineum]
Length=148

 Score =   194 bits (494),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEF+VEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVN  101


 Score = 76.6 bits (187),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK  490
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VK
Sbjct  102  VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVK  140



>ref|XP_006579381.1| PREDICTED: uncharacterized protein LOC100527526 isoform X1 [Glycine 
max]
 gb|KHN48608.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=185

 Score =   190 bits (483),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 80.9 bits (198),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPN SDPLNG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  102  VFEAFLPQLLLYPNASDPLNGDAASLMMKDKELYDQKVKEYCERYAK  148



>ref|XP_007051765.1| Ubiquitin-conjugating enzyme E2 5 isoform 3 [Theobroma cacao]
 gb|EOX95922.1| Ubiquitin-conjugating enzyme E2 5 isoform 3 [Theobroma cacao]
Length=194

 Score =   171 bits (433),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            MMSDYKVEMIND MQEFYV F GP ESPY GGVWR+RVELPDAYPYKSPSIGFVNKIYHP
Sbjct  27   MMSDYKVEMINDSMQEFYVHFSGPNESPYHGGVWRIRVELPDAYPYKSPSIGFVNKIYHP  86

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  87   NVDEMSGSVCLDVINQTWSPMFDLVN  112


 Score = 99.8 bits (247),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYAK  D G A
Sbjct  113  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRGAYEQRVKEYCEKYAKPEDIGAA  166



>ref|XP_010940565.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 
[Elaeis guineensis]
Length=186

 Score =   191 bits (486),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 98/123 (80%), Gaps = 22/123 (18%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKE-------------------  192
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKE                   
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKEITLEAGRGMHQSLPLLTNF  60

Query  193  ---SPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFD  363
                 YQGGVW++RVELPDAYPYKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFD
Sbjct  61   RDFGLYQGGVWKIRVELPDAYPYKSPSIGFANKIYHPNVDEMSGSVCLDVINQTWSPMFD  120

Query  364  LVN  372
            LVN
Sbjct  121  LVN  123


 Score = 79.3 bits (194),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCE  502
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VK    
Sbjct  124  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKNIAR  166



>ref|XP_009628119.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X2 
[Nicotiana tomentosiformis]
Length=168

 Score =   175 bits (444),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            MMSDYKVEMINDGMQEFYV FHGP ESPY GGVW++RVELPDAYPYKSPSIGF+NKIYHP
Sbjct  1    MMSDYKVEMINDGMQEFYVHFHGPTESPYHGGVWKIRVELPDAYPYKSPSIGFINKIYHP  60

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVN  86


 Score = 95.1 bits (235),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAA+LMMRDR AYE  VKE+C+KYAK  D G A
Sbjct  87   VFEVFLPQLLLYPNPSDPLNGEAASLMMRDRAAYELRVKEYCQKYAKPEDVGAA  140



>ref|XP_002511435.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
 gb|EEF52037.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
Length=184

 Score =   187 bits (476),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPK S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKGSLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 82.8 bits (203),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPNPSDPLNG+AA+LMM+DR  Y+++VKE+ +KYAK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMMKDREQYDEKVKEYLDKYAK  148



>ref|NP_001241807.1| ubiquitin-conjugating enzyme E2-21 kDa 1 [Zea mays]
 gb|ACG48923.1| ubiquitin-conjugating enzyme E2-21 kDa 1 [Zea mays]
 tpg|DAA43377.1| TPA: putative ubiquitin-conjugating enzyme family isoform 1 [Zea 
mays]
 tpg|DAA43378.1| TPA: putative ubiquitin-conjugating enzyme family isoform 2 [Zea 
mays]
Length=168

 Score =   169 bits (428),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            MMSDYKV+M+NDGMQEF+VEF GP ES YQGG+WRVRVELPDAYPYKSPSIGF+NKIYHP
Sbjct  1    MMSDYKVDMVNDGMQEFFVEFRGPNESIYQGGIWRVRVELPDAYPYKSPSIGFINKIYHP  60

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVN  86


 Score =   101 bits (251),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNG+AAALMMRDR AYEQ+VKE+CEKYAK  DAGV+
Sbjct  87   VFEVFLPQLLLYPNPSDPLNGDAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVS  140



>gb|KJB52142.1| hypothetical protein B456_008G248000 [Gossypium raimondii]
Length=164

 Score =   205 bits (522),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYVEF+GPK+SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMMNDGMQEFYVEFNGPKDSPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNG  375
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFD +NG
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDPLNG  102


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  422  DPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            DPLNGEAAALMMRDRTAYE++VKE+ EKYAK  D   A
Sbjct  98   DPLNGEAAALMMRDRTAYEEKVKEYREKYAKPEDVAGA  135



>gb|ACG24713.1| ubiquitin-conjugating enzyme E2-21 kDa 1 [Zea mays]
 tpg|DAA49814.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=174

 Score =   169 bits (429),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  106  MKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKI  285
            +  MMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYPYKSPSIGF+NKI
Sbjct  4    LSWMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYPYKSPSIGFINKI  63

Query  286  YHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  64   YHPNVDEMSGSVCLDVINQTWSPMFDLVN  92


 Score =   100 bits (248),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ+VKE+CEKYAK  DAG+ 
Sbjct  93   VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPVYEQKVKEYCEKYAKPEDAGIT  146



>ref|XP_002882046.1| ubiquitin-conjugating enzyme 6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58305.1| ubiquitin-conjugating enzyme 6 [Arabidopsis lyrata subsp. lyrata]
Length=186

 Score =   183 bits (465),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S YQGGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLIN  101


 Score = 86.7 bits (213),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPNPSDP NGEAA+L+MRDR AYE +VKE+CEKYAK
Sbjct  102  VFESFLPQLLLYPNPSDPFNGEAASLLMRDRAAYELKVKEYCEKYAK  148



>ref|XP_009142401.1| PREDICTED: ubiquitin-conjugating enzyme E2 6-like [Brassica rapa]
 emb|CDY37084.1| BnaA04g26620D [Brassica napus]
Length=189

 Score =   182 bits (461),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S Y+GGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYEGGVWKIKVELPEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLIN  101


 Score = 87.8 bits (216),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFE FLPQLLLYPNPSDP NGEAA+L+MRDR AYE++VKE+C+ YAK  D G
Sbjct  102  VFESFLPQLLLYPNPSDPFNGEAASLLMRDRAAYEKKVKEYCKAYAKPEDIG  153



>ref|NP_001237311.1| uncharacterized protein LOC100527526 [Glycine max]
 gb|ACU16622.1| unknown [Glycine max]
Length=185

 Score =   189 bits (479),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY +E INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTMETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 80.9 bits (198),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPN SDPLNG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  102  VFEAFLPQLLLYPNASDPLNGDAASLMMKDKELYDQKVKEYCERYAK  148



>ref|XP_004155833.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
Length=168

 Score =   173 bits (439),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            MMSDYKVEMINDG+QEFYV+FHGP ESPY GG+WR+RVELPDAYPYKSPSIGF+NKIYHP
Sbjct  1    MMSDYKVEMINDGVQEFYVDFHGPSESPYHGGLWRIRVELPDAYPYKSPSIGFLNKIYHP  60

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVN  86


 Score = 95.9 bits (237),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATD  523
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+CE+YAK  D
Sbjct  87   VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRVAYEQKVKEYCERYAKPED  136



>ref|NP_566062.1| ubiquitin-conjugating enzyme E2 6 [Arabidopsis thaliana]
 sp|P42750.2|UBC6_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 6; AltName: Full=Ubiquitin 
carrier protein 6; AltName: Full=Ubiquitin-conjugating 
enzyme E2-21 kDa 3; AltName: Full=Ubiquitin-protein ligase 
6 [Arabidopsis thaliana]
 gb|AAB32508.1| UBC6=E2-related ubiquitin-conjugating protein [Arabidopsis thaliana, 
Peptide, 183 aa]
 gb|AAC62907.1| E2, ubiquitin-conjugating enzyme 6 (UBC6) [Arabidopsis thaliana]
 gb|AAO63272.1| At2g46030 [Arabidopsis thaliana]
 gb|AAY44847.1| ubiquitinating enzyme [Arabidopsis thaliana]
 dbj|BAF00193.1| putative ubiquitin-conjugating enzyme E2 [Arabidopsis thaliana]
 gb|AEC10634.1| ubiquitin-conjugating enzyme E2 6 [Arabidopsis thaliana]
Length=183

 Score =   182 bits (463),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSDYKV+ +ND +Q FYV FHGP +S YQGGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLIN  101


 Score = 86.3 bits (212),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPNPSDP NGEAA+L+MRDR AYE +VKE+CEKYAK
Sbjct  102  VFESFLPQLLLYPNPSDPFNGEAASLLMRDRAAYELKVKEYCEKYAK  148



>ref|XP_010271991.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
Length=184

 Score =   186 bits (473),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVEPINDGINEFNVEFHGPKESLYEGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 82.0 bits (201),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLL YPNPSDPLNG+AA+LM++D+  YE +VKE+CE+YAK
Sbjct  102  VFEVFLPQLLRYPNPSDPLNGDAASLMLKDQQQYEHKVKEYCERYAK  148



>emb|CDY27337.1| BnaC04g50680D [Brassica napus]
Length=189

 Score =   181 bits (458),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S Y+GGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYEGGVWKIKVELPEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFVNKI+HPNVDE SG+VCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSVGFVNKIFHPNVDESSGAVCLDVINQTWSPMFDLIN  101


 Score = 87.8 bits (216),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFE FLPQLLLYPNPSDP NGEAA+L+MRDR AYE++VKE+C+ YAK  D G
Sbjct  102  VFESFLPQLLLYPNPSDPFNGEAASLLMRDRAAYEKKVKEYCKAYAKPEDIG  153



>ref|XP_010506595.1| PREDICTED: ubiquitin-conjugating enzyme E2 6-like [Camelina sativa]
Length=183

 Score =   183 bits (465),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S YQGGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLIN  101


 Score = 84.3 bits (207),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPNPSDP NGEAA+L+MRDR AYE +VKE+C+KYA+
Sbjct  102  VFESFLPQLLLYPNPSDPFNGEAASLLMRDRAAYELKVKEYCDKYAQ  148



>ref|XP_009133760.1| PREDICTED: ubiquitin-conjugating enzyme E2 6 [Brassica rapa]
 emb|CDX83382.1| BnaA03g21240D [Brassica napus]
Length=187

 Score =   180 bits (457),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSDYKV+ +ND +  FYV FHGP +S Y+GGVW+++VELPDAYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTVNDDLHMFYVTFHGPTDSLYEGGVWKIKVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLIN  101


 Score = 87.4 bits (215),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFE FLPQLLLYPNPSDP NGEAA+L+MRDR AYE +VKE+C++YAK  D G
Sbjct  102  VFESFLPQLLLYPNPSDPFNGEAASLLMRDRPAYELKVKEYCKRYAKPEDIG  153



>ref|XP_010508073.1| PREDICTED: ubiquitin-conjugating enzyme E2 6 [Camelina sativa]
Length=187

 Score =   183 bits (465),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S YQGGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLIN  101


 Score = 84.3 bits (207),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPNPSDP NGEAA+L+MRDR AYE +VKE+C+KYA+
Sbjct  102  VFESFLPQLLLYPNPSDPFNGEAASLLMRDRAAYELKVKEYCDKYAQ  148



>ref|XP_006295060.1| hypothetical protein CARUB_v10024128mg [Capsella rubella]
 gb|EOA27958.1| hypothetical protein CARUB_v10024128mg [Capsella rubella]
Length=187

 Score =   181 bits (459),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSDYKV+ +ND +Q FYV FHGP +S Y+GGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDSLYEGGVWKIKVELPEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLIN  101


 Score = 86.7 bits (213),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKA  517
            VF+ FLPQLLLYPNPSDP NGEAA+L+MRDR AYE +VKE+CEKYAKA
Sbjct  102  VFDSFLPQLLLYPNPSDPFNGEAASLLMRDRPAYELKVKEYCEKYAKA  149



>ref|XP_010255297.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 isoform X2 [Nelumbo 
nucifera]
Length=163

 Score =   201 bits (512),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+V+F+GP +SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFHVDFNGPSDSPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNG  375
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFD +NG
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDPLNG  102


 Score = 66.2 bits (160),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  422  DPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            DPLNG+AAALMMRDR AYEQ+VKE+CEKYAK  D G A
Sbjct  98   DPLNGDAAALMMRDRAAYEQKVKEYCEKYAKPEDIGAA  135



>ref|XP_010518259.1| PREDICTED: ubiquitin-conjugating enzyme E2 6-like [Camelina sativa]
Length=181

 Score =   183 bits (465),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S YQGGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLIN  101


 Score = 84.0 bits (206),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPNPSDP NGEAA+L+MRDR AYE +VKE+C+KYA+
Sbjct  102  VFESFLPQLLLYPNPSDPFNGEAASLLMRDRAAYELKVKEYCDKYAQ  148



>ref|XP_008438029.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X2 
[Cucumis melo]
Length=163

 Score =   203 bits (516),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/102 (92%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV+FHGP ESPY GG+WR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGVQEFYVDFHGPSESPYHGGLWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNG  375
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFD +NG
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDPLNG  102


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  422  DPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATD  523
            DPLNGEAAALMMRDR AYEQ+VKE+CE+YAK  D
Sbjct  98   DPLNGEAAALMMRDRVAYEQKVKEYCERYAKPED  131



>gb|AFK33447.1| unknown [Lotus japonicus]
Length=178

 Score =   185 bits (469),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSP+KRR+MD MKLMMSDYKVE IND MQEF+VEFHGPK SPYQ GVW+++VE+PDAYP
Sbjct  1    MSSPTKRRDMDFMKLMMSDYKVETINDDMQEFFVEFHGPKNSPYQDGVWKLKVEIPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            +KSPSIGFVNKIYHPN+DE SG++CLDVINQ WSPM+DL+N
Sbjct  61   FKSPSIGFVNKIYHPNIDEPSGTICLDVINQRWSPMYDLIN  101


 Score = 82.4 bits (202),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPN SDP+N +AA LM++D  AYEQ+V+E+CEKYAK  D G
Sbjct  102  VFEVFLPQLLLYPNASDPMNADAADLMLKDPAAYEQKVREYCEKYAKPEDIG  153



>gb|AFK45061.1| unknown [Lotus japonicus]
Length=195

 Score =   184 bits (467),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSP+KRR+MD MKLMMSDYKVE IND MQEF+VEFHGPK SPYQ GVW+++VE+PDAYP
Sbjct  1    MSSPTKRRDMDFMKLMMSDYKVETINDDMQEFFVEFHGPKNSPYQDGVWKLKVEIPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            +KSPSIGFVNKIYHPN+DE SG++CLDVINQ WSPM+DL+N
Sbjct  61   FKSPSIGFVNKIYHPNIDEPSGTICLDVINQRWSPMYDLIN  101


 Score = 82.0 bits (201),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPN SDP+N +AA LM++D  AYEQ+V+E+CEKYAK  D G
Sbjct  102  VFEVFLPQLLLYPNASDPMNADAADLMLKDPAAYEQKVREYCEKYAKPEDIG  153



>ref|XP_010254271.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
 ref|XP_010254278.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
 ref|XP_010254285.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
Length=184

 Score =   184 bits (467),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW+V VELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYIVEPINDGINEFNVEFHGPKESLYEGGVWKVHVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 82.0 bits (201),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLL YPNPSDPLNG+AA+LM++D+  YEQ+VKE+CE YAK
Sbjct  102  VFEVFLPQLLRYPNPSDPLNGDAASLMLKDQQQYEQKVKEYCELYAK  148



>emb|CDX95674.1| BnaC03g25550D [Brassica napus]
Length=187

 Score =   179 bits (453),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSDYKV+ +ND +  FYV FHGP +S Y+GGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTVNDDLHMFYVTFHGPTDSLYEGGVWKIKVELPEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLIN  101


 Score = 87.4 bits (215),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFE FLPQLLLYPNPSDP NGEAA+L+MRDR AYE +VKE+C++YAK  D G
Sbjct  102  VFESFLPQLLLYPNPSDPFNGEAASLLMRDRPAYELKVKEYCKRYAKPEDIG  153



>ref|XP_006580568.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 
[Glycine max]
Length=168

 Score =   175 bits (443),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            MMSDYKVE INDGMQEF+VEFHGPK+SPYQGGVW+VRVELPDAYPYKSPSIGFVNKI+HP
Sbjct  1    MMSDYKVETINDGMQEFFVEFHGPKDSPYQGGVWKVRVELPDAYPYKSPSIGFVNKIFHP  60

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   NVDEVSGSVCLDVINQTWSPMFDLVN  86


 Score = 90.9 bits (224),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPN SDPLNG+AAALM+RD   YEQ VKE+CEKYAK  D G A
Sbjct  87   VFEVFLPQLLLYPNASDPLNGDAAALMIRDHATYEQRVKEYCEKYAKPEDVGAA  140



>ref|NP_001148188.1| ubiquitin-conjugating enzyme E2-21 kDa 1 [Zea mays]
 gb|ACG30125.1| ubiquitin-conjugating enzyme E2-21 kDa 1 [Zea mays]
Length=174

 Score =   165 bits (417),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  106  MKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKI  285
            +  MMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYPYKSPSIGF+NKI
Sbjct  4    LSWMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYPYKSPSIGFINKI  63

Query  286  YHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YHPNVDEMSGSV LDVINQTWSPMFDLVN
Sbjct  64   YHPNVDEMSGSVYLDVINQTWSPMFDLVN  92


 Score =   100 bits (249),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ+VKE+CEKYAK  DAG+ 
Sbjct  93   VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPVYEQKVKEYCEKYAKPEDAGIT  146



>ref|XP_010678729.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Beta 
vulgaris subsp. vulgaris]
Length=184

 Score =   182 bits (462),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF + F+GPK+S Y+GGVW+V VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYSVETINDGLNEFNILFNGPKDSLYEGGVWKVHVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKIYHPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFINKIYHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 82.8 bits (203),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGV  532
            VFEVFLPQLLLYPN  DPLNG+AA+LMM+DR  YEQ+VKE+C++YAK  +  +
Sbjct  102  VFEVFLPQLLLYPNALDPLNGDAASLMMKDRQQYEQKVKEYCDRYAKKENFSI  154



>ref|XP_008360712.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Malus domestica]
Length=168

 Score =   169 bits (429),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            M SDYKVEMINDGMQEFYV+F+GPKES YQGGVWR+RVEL DAYPYKSPSIGFVNKIYHP
Sbjct  1    MXSDYKVEMINDGMQEFYVDFNGPKESLYQGGVWRIRVELLDAYPYKSPSIGFVNKIYHP  60

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVN  86


 Score = 95.5 bits (236),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAAL MRDRTAY+Q VK +CEKYAK  D G A
Sbjct  87   VFEVFLPQLLLYPNPSDPLNGEAAALXMRDRTAYDQRVKXYCEKYAKPEDIGGA  140



>gb|KFK37384.1| hypothetical protein AALP_AA4G250300 [Arabis alpina]
Length=188

 Score =   182 bits (463),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S YQGGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLIN  101


 Score = 81.3 bits (199),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYA  511
            VFE FLPQLLLYPNPSDP NGEAA+L+MRDR AYE++VKE+C+ YA
Sbjct  102  VFESFLPQLLLYPNPSDPFNGEAASLLMRDRPAYEKKVKEYCKLYA  147



>ref|XP_006374516.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
 gb|ERP52313.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
Length=182

 Score =   177 bits (448),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 4/101 (4%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ +F VEFHGPKES    GVW++ VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNDFNVEFHGPKES----GVWKIHVELPDAYP  56

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  57   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  97


 Score = 86.7 bits (213),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLL+YPNPSDPLNG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  98   VFEVFLPQLLIYPNPSDPLNGDAASLMMKDKEQYDQKVKEYCERYAK  144



>ref|XP_006584539.1| PREDICTED: uncharacterized protein LOC100527756 isoform X1 [Glycine 
max]
Length=168

 Score =   172 bits (437),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            MMSDYKVE +NDGMQEF+VEFHGPK+SPYQGGVW+VRV+LPDAYPYKSPSIGFVNKI+HP
Sbjct  1    MMSDYKVETVNDGMQEFFVEFHGPKDSPYQGGVWKVRVDLPDAYPYKSPSIGFVNKIFHP  60

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDEMSGSVCLDVI+QTWSPMFDLVN
Sbjct  61   NVDEMSGSVCLDVISQTWSPMFDLVN  86


 Score = 89.7 bits (221),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAG  529
            VFEVFLPQLLLYPN SDPLNG+AAALM+RD   YEQ VKE+CEKYAK  D G
Sbjct  87   VFEVFLPQLLLYPNASDPLNGDAAALMIRDHATYEQRVKEYCEKYAKPEDVG  138



>gb|KDO76259.1| hypothetical protein CISIN_1g029962mg [Citrus sinensis]
Length=141

 Score =   198 bits (504),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/100 (92%), Positives = 97/100 (97%), Gaps = 0/100 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESSYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLV  369
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMF+  
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFEFC  100



>gb|KEH21089.1| ubiquitin-conjugating enzyme [Medicago truncatula]
Length=167

 Score =   170 bits (431),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            MM+DYKVEMIND MQEF+V+FHGPK+SPYQ GVW++RVELPDAYPYKSPSIGFVNKIYHP
Sbjct  1    MMTDYKVEMINDCMQEFFVQFHGPKDSPYQEGVWKIRVELPDAYPYKSPSIGFVNKIYHP  60

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDE+SGSVCLDVINQTWSPMFDLVN
Sbjct  61   NVDEISGSVCLDVINQTWSPMFDLVN  86


 Score = 91.7 bits (226),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLL+YPN SDPLN EAA+LMMRDR AYEQ+VKE+CEKYAK  D G +
Sbjct  87   VFEVFLPQLLIYPNASDPLNDEAASLMMRDRAAYEQKVKEYCEKYAKPEDIGAS  140



>ref|XP_010913549.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X4 
[Elaeis guineensis]
Length=198

 Score =   192 bits (487),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKESPY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYIVETINDGLSEFNVEFHGPKESPYEGGVWKVRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGF+NKI+HPNVDE+SGS+CLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDLLN  101


 Score = 70.1 bits (170),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCE  502
            +FEVFLPQLLLYPNP+DPLNG+AA+LM++D+  YEQ+VK    
Sbjct  102  IFEVFLPQLLLYPNPADPLNGDAASLMLKDQQQYEQKVKNIVS  144



>ref|XP_010037581.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Eucalyptus 
grandis]
 ref|XP_010037582.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Eucalyptus 
grandis]
 gb|KCW49308.1| hypothetical protein EUGRSUZ_K02864 [Eucalyptus grandis]
Length=184

 Score =   181 bits (459),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRRE D+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++ V+LPDAYP
Sbjct  1    MSSPSKRRERDVMKLMMSDYTVETINDGLNEFNVEFHGPKESLYEGGVWKIWVKLPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSI FVNKIYHPNV+EMSGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIKFVNKIYHPNVNEMSGSVCLDVINQSWSPMFDLLN  101


 Score = 80.1 bits (196),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFEVFLPQLLLYPNPS  LNG+AA+LMM+DR  Y+Q+VKE+C++YAK
Sbjct  102  VFEVFLPQLLLYPNPSSFLNGDAASLMMKDRKQYDQKVKEYCKQYAK  148



>ref|XP_010913548.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X3 [Elaeis guineensis]
Length=205

 Score =   177 bits (448),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 96/122 (79%), Gaps = 21/122 (17%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLM---------------------MSDYKVEMINDGMQEFYVEFHGP  186
            MSSPSKRR+MD+MK M                     MSDY VE INDG+ EF VEFHGP
Sbjct  1    MSSPSKRRDMDVMKFMERCQGAMQTPQYACSVWQGRMMSDYIVETINDGLSEFNVEFHGP  60

Query  187  KESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDL  366
            KESPY+GGVW+VRVELPDAYPYKSPSIGF+NKI+HPNVDE+SGS+CLDVINQ+WSPMFDL
Sbjct  61   KESPYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDL  120

Query  367  VN  372
            +N
Sbjct  121  LN  122


 Score = 84.3 bits (207),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            +FEVFLPQLLLYPNP+DPLNG+AA+LM++D+  YEQ+VKE+CE+YAK
Sbjct  123  IFEVFLPQLLLYPNPADPLNGDAASLMLKDQQQYEQKVKEYCERYAK  169



>ref|XP_006439519.1| hypothetical protein CICLE_v10024671mg [Citrus clementina]
 gb|ESR52759.1| hypothetical protein CICLE_v10024671mg [Citrus clementina]
 gb|KDO76262.1| hypothetical protein CISIN_1g029962mg [Citrus sinensis]
 gb|KDO76263.1| hypothetical protein CISIN_1g029962mg [Citrus sinensis]
Length=120

 Score =   196 bits (498),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/97 (95%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESSYQGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMF  360
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMF
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMF  97



>ref|XP_008360711.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Malus domestica]
Length=169

 Score =   169 bits (428),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            M SDYKVEMINDGMQEFYV+F+GPKES YQGGVWR+RVEL DAYPYKSPSIGFVNKIYHP
Sbjct  1    MXSDYKVEMINDGMQEFYVDFNGPKESLYQGGVWRIRVELLDAYPYKSPSIGFVNKIYHP  60

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVN  86


 Score = 90.9 bits (224),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK-EFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAAL MRDRTAY+Q VK  +CEKYAK  D G A
Sbjct  87   VFEVFLPQLLLYPNPSDPLNGEAAALXMRDRTAYDQRVKGXYCEKYAKPEDIGGA  141



>gb|AAG52444.1|AC010852_1 putative ubiquitin-conjugating enzyme; 71876-72824 [Arabidopsis 
thaliana]
Length=170

 Score =   168 bits (426),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            MMSDYKVEMINDGMQEF+VEF GPK+S Y+GGVW++RVELPDAYPYKSPS+GF+ KIYHP
Sbjct  1    MMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYPYKSPSVGFITKIYHP  60

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVN  86


 Score = 91.7 bits (226),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            VFE FLPQLLLYPNPSDPLNGEAAALMMRDR  YEQ VKE+CEKYAK
Sbjct  87   VFETFLPQLLLYPNPSDPLNGEAAALMMRDRPTYEQRVKEYCEKYAK  133



>ref|XP_008351691.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like, partial [Malus 
domestica]
Length=149

 Score =   169 bits (428),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            M SDYKVEMINDGMQEFYV+F+GPKES YQGGVWR+RVEL DAYPYKSPSIGFVNKIYHP
Sbjct  1    MXSDYKVEMINDGMQEFYVDFNGPKESLYQGGVWRIRVELLDAYPYKSPSIGFVNKIYHP  60

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVN  86


 Score = 90.5 bits (223),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKE-FCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDPLNGEAAAL MRDRTAY+Q VK  +CEKYAK  D G A
Sbjct  87   VFEVFLPQLLLYPNPSDPLNGEAAALXMRDRTAYDQRVKGVYCEKYAKPEDIGGA  141



>ref|XP_010559098.1| PREDICTED: ubiquitin-conjugating enzyme E2 6 isoform X2 [Tarenaya 
hassleriana]
Length=168

 Score =   163 bits (413),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            MMSDYKVEMIND M+ FYV FHGP +S YQGGVWR+RVELPD+YPYKSPS+GFVNKIYHP
Sbjct  1    MMSDYKVEMINDEMRAFYVRFHGPTDSLYQGGVWRIRVELPDSYPYKSPSVGFVNKIYHP  60

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDE SGSVCLDVINQTWSPMFDLVN
Sbjct  61   NVDESSGSVCLDVINQTWSPMFDLVN  86


 Score = 96.3 bits (238),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNPSDP NGEAA+LMMRDR AYEQ+VKE+C++YAK  D G A
Sbjct  87   VFEVFLPQLLLYPNPSDPFNGEAASLMMRDRAAYEQKVKEYCKRYAKPVDIGAA  140



>ref|XP_010658145.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 isoform X2 [Vitis 
vinifera]
Length=176

 Score =   197 bits (501),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYV+FHGP +SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPGDSPYHGGVWRIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMF  360
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMF
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMF  97


 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 52/68 (76%), Gaps = 6/68 (9%)
 Frame = +2

Query  347  GARCL-----IW*MVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYA  511
            G+ CL      W  +F VFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ VKE+CEKYA
Sbjct  82   GSVCLDVINQTWSPMF-VFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYA  140

Query  512  KATDAGVA  535
            K  + G A
Sbjct  141  KPENIGAA  148



>ref|XP_002517368.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
 gb|EEF44910.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
Length=186

 Score =   180 bits (457),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF V+FHGPK S Y+GGVW++ VELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVEPINDGINEFNVKFHGPKRSLYEGGVWKIHVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPS+GF+NKIYHPNVDEMSGSVCLDVINQ+W+PMFDL N
Sbjct  61   YKSPSVGFLNKIYHPNVDEMSGSVCLDVINQSWNPMFDLFN  101


 Score = 78.6 bits (192),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            +FE FLPQLLLYPNPSDPLN +A +LM++D+  YE++VKE+CE+YAK
Sbjct  102  IFEDFLPQLLLYPNPSDPLNSDAGSLMIKDKKLYEEKVKEYCERYAK  148



>gb|EMT26310.1| Ubiquitin-conjugating enzyme E2-23 kDa [Aegilops tauschii]
Length=211

 Score =   167 bits (424),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 92/117 (79%), Gaps = 8/117 (7%)
 Frame = +1

Query  22   SIQEFEGERTRK*KVIMSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPY  201
            SI      RT    +I++  S R        MMSDYKV+MINDGMQEF+V FHGPK+S Y
Sbjct  19   SIHSLSLVRTVDSCLILACFSCR--------MMSDYKVDMINDGMQEFFVHFHGPKDSIY  70

Query  202  QGGVWRVRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            QGGVW+VRVEL +AYPYKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN
Sbjct  71   QGGVWKVRVELTEAYPYKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  127


 Score = 90.5 bits (223),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAK  514
            +FEVFLPQLLLYPNPSDPLNGEAA+LMMRD+ AYE +VKE+CE+YAK
Sbjct  128  IFEVFLPQLLLYPNPSDPLNGEAASLMMRDKNAYENKVKEYCERYAK  174



>ref|XP_005650676.1| ubiquitin conjugating enzyme [Coccomyxa subellipsoidea C-169]
 gb|EIE26132.1| ubiquitin conjugating enzyme [Coccomyxa subellipsoidea C-169]
Length=190

 Score =   185 bits (470),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            M+SPSKRREMD+MKLMMSD+KVE++ND + E YVEF GPK+SPY+GG WRV VELPD YP
Sbjct  1    MTSPSKRREMDVMKLMMSDWKVELVNDSVNELYVEFQGPKDSPYEGGFWRVHVELPDGYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVN+IYHPNVDEM+GSVCLDVINQTWSPMFDL+N
Sbjct  61   YKSPSIGFVNRIYHPNVDEMAGSVCLDVINQTWSPMFDLLN  101


 Score = 72.4 bits (176),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATD  523
            VFE FLPQLLLYPNP+DPLNGEAAAL+MR+  AY  +VKE   ++AK  D
Sbjct  102  VFETFLPQLLLYPNPTDPLNGEAAALLMREPEAYNAKVKECTARFAKKED  151



>ref|XP_006600654.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X3 
[Glycine max]
Length=160

 Score =   189 bits (481),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYAVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 67.8 bits (164),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK  490
            VFEVFLPQLLLYPN SDPLNG+AA+LMM+D+  Y+Q+VK
Sbjct  102  VFEVFLPQLLLYPNASDPLNGDAASLMMKDKKLYDQKVK  140



>ref|XP_008453111.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Cucumis melo]
Length=171

 Score =   189 bits (480),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMD+MKLMMSDY VEMINDG+ EF VEFHGPKES Y+ GVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVEMINDGLSEFNVEFHGPKESLYEAGVWKIRVELPDAYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN  372
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLN  101


 Score = 68.2 bits (165),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVK  490
            VFEVFLPQLLLYPNPSDPLNG+AA+LMM+D   Y+++VK
Sbjct  102  VFEVFLPQLLLYPNPSDPLNGDAASLMMKDPKQYDEKVK  140



>gb|ACU23231.1| unknown [Glycine max]
Length=102

 Score =   193 bits (491),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  70   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  249
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGP +SPY GGVW+VRVELPD YP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDTYP  60

Query  250  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMF  360
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMF
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMF  97



>ref|XP_009397799.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=168

 Score =   167 bits (424),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +1

Query  115  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  294
            MMSDYKVEM NDGM EF V+FHGPKESPYQGGVWR+RVELPD YPY SPSIGFVNK+YHP
Sbjct  1    MMSDYKVEMTNDGMHEFLVDFHGPKESPYQGGVWRIRVELPDGYPYHSPSIGFVNKMYHP  60

Query  295  NVDEMSGSVCLDVINQTWSPMFDLVN  372
            NVDEMSGS+CLDVINQTWSPM+DLVN
Sbjct  61   NVDEMSGSICLDVINQTWSPMYDLVN  86


 Score = 89.4 bits (220),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  374  VFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQEVKEFCEKYAKATDAGVA  535
            VFEVFLPQLLLYPNP DPLNGEAAAL+MRD  AYEQ+VKE+C KYAK  D G +
Sbjct  87   VFEVFLPQLLLYPNPLDPLNGEAAALLMRDEPAYEQKVKEYCLKYAKPEDIGAS  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800