BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF020M04

Length=545
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010532058.1|  PREDICTED: serine incorporator 3                   240   5e-74   Tarenaya hassleriana [spider flower]
gb|KDP41926.1|  hypothetical protein JCGZ_26944                         239   9e-74   Jatropha curcas
ref|NP_173069.1|  Serinc-domain containing serine and sphingolipi...    238   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416842.1|  hypothetical protein EUTSA_v10007762mg             238   2e-73   Eutrema salsugineum [saltwater cress]
gb|ABK96018.1|  unknown                                                 238   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_002297693.2|  TMS membrane family protein                        238   2e-73   
ref|XP_011034606.1|  PREDICTED: probable serine incorporator            238   3e-73   Populus euphratica
ref|XP_007024820.1|  Serinc-domain containing serine and sphingol...    238   4e-73   
ref|XP_009117776.1|  PREDICTED: serine incorporator 3 isoform X2        238   4e-73   Brassica rapa
emb|CDX81752.1|  BnaC08g38490D                                          237   4e-73   
ref|XP_009110458.1|  PREDICTED: serine incorporator 3-like              237   5e-73   Brassica rapa
gb|KJB68285.1|  hypothetical protein B456_010G236500                    237   5e-73   Gossypium raimondii
emb|CDY70974.1|  BnaAnng35710D                                          237   5e-73   Brassica napus [oilseed rape]
gb|KJB68286.1|  hypothetical protein B456_010G236500                    237   6e-73   Gossypium raimondii
ref|XP_002890152.1|  TMS membrane family protein                        237   6e-73   
ref|XP_010063623.1|  PREDICTED: probable serine incorporator isof...    237   8e-73   Eucalyptus grandis [rose gum]
ref|XP_010063622.1|  PREDICTED: probable serine incorporator isof...    237   8e-73   
gb|KDO46126.1|  hypothetical protein CISIN_1g032312mg                   226   2e-72   Citrus sinensis [apfelsine]
ref|XP_002512768.1|  Membrane protein PB1A10.07c, putative              235   3e-72   
gb|KHG09631.1|  Serine incorporator 3                                   235   3e-72   Gossypium arboreum [tree cotton]
gb|KJB68287.1|  hypothetical protein B456_010G236500                    235   4e-72   Gossypium raimondii
gb|KJB67012.1|  hypothetical protein B456_010G170100                    233   9e-72   Gossypium raimondii
ref|XP_002304839.2|  hypothetical protein POPTR_0003s18530g             232   1e-71   
gb|EYU21795.1|  hypothetical protein MIMGU_mgv1a007183mg                233   1e-71   Erythranthe guttata [common monkey flower]
gb|EYU21792.1|  hypothetical protein MIMGU_mgv1a007183mg                233   2e-71   Erythranthe guttata [common monkey flower]
ref|XP_006427689.1|  hypothetical protein CICLE_v10025720mg             233   2e-71   Citrus clementina [clementine]
ref|XP_006307669.1|  hypothetical protein CARUB_v10009295mg             233   2e-71   Capsella rubella
ref|XP_006493450.1|  PREDICTED: probable serine incorporator-like       233   2e-71   Citrus sinensis [apfelsine]
ref|XP_002270610.1|  PREDICTED: probable serine incorporator            233   2e-71   Vitis vinifera
emb|CDO98258.1|  unnamed protein product                                233   3e-71   Coffea canephora [robusta coffee]
gb|EPS57849.1|  hypothetical protein M569_16968                         227   4e-71   Genlisea aurea
gb|KJB67006.1|  hypothetical protein B456_010G170100                    232   5e-71   Gossypium raimondii
ref|XP_011073234.1|  PREDICTED: probable serine incorporator            231   9e-71   Sesamum indicum [beniseed]
ref|XP_010476724.1|  PREDICTED: serine incorporator 3                   231   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010459155.1|  PREDICTED: probable serine incorporator            231   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010497691.1|  PREDICTED: probable serine incorporator            231   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_011020548.1|  PREDICTED: probable serine incorporator            231   2e-70   Populus euphratica
ref|XP_009759116.1|  PREDICTED: probable serine incorporator isof...    230   3e-70   Nicotiana sylvestris
ref|XP_010318692.1|  PREDICTED: probable serine incorporator            230   3e-70   Solanum lycopersicum
ref|XP_011082649.1|  PREDICTED: probable serine incorporator            230   3e-70   Sesamum indicum [beniseed]
ref|XP_009759114.1|  PREDICTED: probable serine incorporator isof...    230   3e-70   Nicotiana sylvestris
ref|XP_006341430.1|  PREDICTED: probable serine incorporator-like...    229   5e-70   Solanum tuberosum [potatoes]
ref|XP_006341429.1|  PREDICTED: probable serine incorporator-like...    229   6e-70   Solanum tuberosum [potatoes]
ref|XP_009615679.1|  PREDICTED: probable serine incorporator isof...    229   7e-70   Nicotiana tomentosiformis
ref|XP_010687311.1|  PREDICTED: probable serine incorporator            229   7e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009615681.1|  PREDICTED: probable serine incorporator isof...    229   7e-70   Nicotiana tomentosiformis
ref|XP_010107188.1|  putative serine incorporator                       229   8e-70   Morus notabilis
ref|XP_009615680.1|  PREDICTED: serine incorporator 3 isoform X2        229   8e-70   
ref|XP_004492298.1|  PREDICTED: probable serine incorporator-like       229   9e-70   Cicer arietinum [garbanzo]
emb|CDX83957.1|  BnaC08g16880D                                          236   2e-69   
ref|XP_008342757.1|  PREDICTED: probable serine incorporator            228   3e-69   
ref|XP_010914044.1|  PREDICTED: probable serine incorporator            228   3e-69   Elaeis guineensis
ref|XP_004158797.1|  PREDICTED: probable serine incorporator-like       227   3e-69   
ref|XP_007140603.1|  hypothetical protein PHAVU_008G126100g             227   3e-69   Phaseolus vulgaris [French bean]
ref|XP_009354238.1|  PREDICTED: probable serine incorporator            227   4e-69   Pyrus x bretschneideri [bai li]
ref|XP_003532291.1|  PREDICTED: probable serine incorporator-like       227   4e-69   Glycine max [soybeans]
ref|XP_010929191.1|  PREDICTED: probable serine incorporator isof...    226   1e-68   Elaeis guineensis
ref|XP_009365247.1|  PREDICTED: probable serine incorporator            226   1e-68   Pyrus x bretschneideri [bai li]
ref|XP_010929190.1|  PREDICTED: probable serine incorporator isof...    226   2e-68   Elaeis guineensis
ref|XP_008461193.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    225   2e-68   Cucumis melo [Oriental melon]
ref|XP_008794380.1|  PREDICTED: probable serine incorporator            225   3e-68   Phoenix dactylifera
ref|XP_003552131.1|  PREDICTED: probable serine incorporator-like       224   8e-68   Glycine max [soybeans]
ref|XP_004135884.1|  PREDICTED: probable serine incorporator-like       224   9e-68   
ref|XP_008381162.1|  PREDICTED: probable serine incorporator            221   7e-67   
ref|XP_009399576.1|  PREDICTED: probable serine incorporator            221   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383181.1|  PREDICTED: probable serine incorporator            219   7e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007215457.1|  hypothetical protein PRUPE_ppa006404mg             218   2e-65   Prunus persica
ref|XP_008228861.1|  PREDICTED: probable serine incorporator            218   2e-65   Prunus mume [ume]
ref|XP_010268463.1|  PREDICTED: serine incorporator 3-like              217   4e-65   Nelumbo nucifera [Indian lotus]
ref|XP_008790112.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    217   4e-65   Phoenix dactylifera
emb|CDY52849.1|  BnaA09g56410D                                          216   8e-65   Brassica napus [oilseed rape]
gb|EAZ24909.1|  hypothetical protein OsJ_08689                          213   8e-64   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048364.1|  Os02g0792900                                       213   2e-63   
ref|NP_001130490.1|  hypothetical protein precursor                     211   9e-63   Zea mays [maize]
ref|XP_004954190.1|  PREDICTED: probable serine incorporator-like       211   1e-62   Setaria italica
ref|XP_002454688.1|  hypothetical protein SORBIDRAFT_04g035670          211   1e-62   Sorghum bicolor [broomcorn]
emb|CAN80335.1|  hypothetical protein VITISV_009414                     209   1e-62   Vitis vinifera
ref|XP_006845424.1|  hypothetical protein AMTR_s00019p00091080          210   1e-62   Amborella trichopoda
gb|ACL54492.1|  unknown                                                 209   3e-62   Zea mays [maize]
ref|XP_003570284.1|  PREDICTED: probable serine incorporator            209   3e-62   Brachypodium distachyon [annual false brome]
gb|KEH22798.1|  serinc-domain serine and sphingolipid biosynthesi...    207   1e-61   Medicago truncatula
ref|XP_006649122.1|  PREDICTED: probable serine incorporator-like       199   9e-59   
gb|EMT13726.1|  Putative serine incorporator                            200   1e-58   
gb|KEH22799.1|  serinc-domain serine and sphingolipid biosynthesi...    197   2e-57   Medicago truncatula
ref|XP_011466994.1|  PREDICTED: serine incorporator 3                   192   2e-55   Fragaria vesca subsp. vesca
ref|XP_010255869.1|  PREDICTED: probable serine incorporator            192   2e-55   Nelumbo nucifera [Indian lotus]
gb|ABR16232.1|  unknown                                                 189   2e-54   Picea sitchensis
gb|ABR17762.1|  unknown                                                 187   6e-54   Picea sitchensis
ref|XP_009391591.1|  PREDICTED: serine incorporator 3                   183   5e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008799134.1|  PREDICTED: probable serine incorporator            183   5e-52   Phoenix dactylifera
ref|XP_007215456.1|  hypothetical protein PRUPE_ppa006404mg             181   1e-51   
ref|XP_010246591.1|  PREDICTED: serine incorporator 3-like              174   6e-49   
ref|XP_001765634.1|  predicted protein                                  173   3e-48   
gb|KJB28194.1|  hypothetical protein B456_005G040500                    169   5e-48   Gossypium raimondii
gb|KDO74827.1|  hypothetical protein CISIN_1g039061mg                   171   1e-47   Citrus sinensis [apfelsine]
ref|XP_006419802.1|  hypothetical protein CICLE_v10005070mg             171   1e-47   Citrus clementina [clementine]
gb|KJB28193.1|  hypothetical protein B456_005G040500                    170   2e-47   Gossypium raimondii
ref|XP_009129653.1|  PREDICTED: probable serine incorporator            169   6e-47   Brassica rapa
ref|XP_002988580.1|  hypothetical protein SELMODRAFT_128126             168   6e-47   
emb|CDY24707.1|  BnaA05g31060D                                          169   6e-47   Brassica napus [oilseed rape]
ref|XP_002979274.1|  hypothetical protein SELMODRAFT_110336             168   6e-47   
ref|NP_187268.2|  Serinc-domain containing serine and sphingolipi...    168   1e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CDY05246.1|  BnaC05g45570D                                          168   1e-46   
ref|XP_010103434.1|  putative serine incorporator                       168   2e-46   Morus notabilis
ref|XP_002882452.1|  TMS membrane family protein                        168   2e-46   Arabidopsis lyrata subsp. lyrata
gb|AFK46909.1|  unknown                                                 166   2e-46   Lotus japonicus
ref|XP_002280143.1|  PREDICTED: serine incorporator 3                   167   2e-46   Vitis vinifera
emb|CDO98987.1|  unnamed protein product                                167   3e-46   Coffea canephora [robusta coffee]
gb|KDP40096.1|  hypothetical protein JCGZ_02094                         167   3e-46   Jatropha curcas
ref|XP_010693925.1|  PREDICTED: serine incorporator 3                   167   3e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006407970.1|  hypothetical protein EUTSA_v10020853mg             167   5e-46   Eutrema salsugineum [saltwater cress]
ref|XP_008223013.1|  PREDICTED: probable serine incorporator            166   6e-46   Prunus mume [ume]
ref|XP_007034589.1|  Serinc-domain containing serine and sphingol...    166   7e-46   
ref|XP_006297798.1|  hypothetical protein CARUB_v10013833mg             166   7e-46   
ref|XP_010938752.1|  PREDICTED: probable serine incorporator            165   2e-45   Elaeis guineensis
ref|XP_010464184.1|  PREDICTED: probable serine incorporator            165   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_007222705.1|  hypothetical protein PRUPE_ppa006444mg             165   3e-45   Prunus persica
ref|XP_010486107.1|  PREDICTED: probable serine incorporator            165   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010436570.1|  PREDICTED: probable serine incorporator            165   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_008340909.1|  PREDICTED: probable serine incorporator            164   3e-45   Malus domestica [apple tree]
ref|XP_010546829.1|  PREDICTED: serine incorporator 3 isoform X1        164   8e-45   Tarenaya hassleriana [spider flower]
ref|XP_010546830.1|  PREDICTED: serine incorporator 3 isoform X2        164   8e-45   Tarenaya hassleriana [spider flower]
ref|XP_010237604.1|  PREDICTED: probable serine incorporator            164   8e-45   Brachypodium distachyon [annual false brome]
ref|NP_001130812.1|  uncharacterized protein LOC100191916               163   1e-44   Zea mays [maize]
ref|XP_002466928.1|  hypothetical protein SORBIDRAFT_01g016840          163   2e-44   Sorghum bicolor [broomcorn]
ref|XP_010322266.1|  PREDICTED: serine incorporator 3                   162   4e-44   Solanum lycopersicum
ref|XP_006356686.1|  PREDICTED: serine incorporator 3-like              161   6e-44   Solanum tuberosum [potatoes]
ref|XP_004982576.1|  PREDICTED: probable serine incorporator-like       161   9e-44   Setaria italica
ref|XP_008458551.1|  PREDICTED: serine incorporator 3                   160   1e-43   Cucumis melo [Oriental melon]
ref|XP_004150322.1|  PREDICTED: serine incorporator 3-like              160   2e-43   Cucumis sativus [cucumbers]
ref|XP_004169518.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...    160   2e-43   
ref|XP_011090806.1|  PREDICTED: probable serine incorporator            160   2e-43   Sesamum indicum [beniseed]
ref|XP_009623079.1|  PREDICTED: probable serine incorporator            159   3e-43   Nicotiana tomentosiformis
ref|XP_009799680.1|  PREDICTED: probable serine incorporator            159   4e-43   Nicotiana sylvestris
gb|KCW60869.1|  hypothetical protein EUGRSUZ_H03603                     156   3e-42   Eucalyptus grandis [rose gum]
ref|XP_010024424.1|  PREDICTED: serine incorporator 3                   156   5e-42   Eucalyptus grandis [rose gum]
ref|XP_002516786.1|  Membrane protein PB1A10.07c, putative              156   6e-42   Ricinus communis
ref|XP_006650244.1|  PREDICTED: probable serine incorporator-like       155   2e-41   Oryza brachyantha
gb|EPS68630.1|  hypothetical protein M569_06136                         154   2e-41   Genlisea aurea
gb|EYU43840.1|  hypothetical protein MIMGU_mgv1a006662mg                154   5e-41   Erythranthe guttata [common monkey flower]
ref|XP_004486156.1|  PREDICTED: probable serine incorporator-like       153   5e-41   Cicer arietinum [garbanzo]
gb|ACJ84561.1|  unknown                                                 152   1e-40   Medicago truncatula
ref|XP_009365799.1|  PREDICTED: probable serine incorporator isof...    152   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_009365800.1|  PREDICTED: probable serine incorporator isof...    152   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_009342179.1|  PREDICTED: probable serine incorporator            151   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_008390818.1|  PREDICTED: probable serine incorporator            151   4e-40   
ref|XP_002312742.1|  TMS membrane family protein                        150   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_011010290.1|  PREDICTED: probable serine incorporator            149   3e-39   Populus euphratica
gb|ABF97020.1|  TMS membrane family protein, putative, expressed        147   8e-39   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050476.1|  Os03g0454100                                       147   2e-38   
ref|XP_006595390.1|  PREDICTED: probable serine incorporator-like       145   5e-38   
dbj|BAJ86142.1|  predicted protein                                      145   6e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004296950.1|  PREDICTED: probable serine incorporator            145   9e-38   Fragaria vesca subsp. vesca
gb|KHN37564.1|  Putative serine incorporator                            144   1e-37   Glycine soja [wild soybean]
ref|XP_007147778.1|  hypothetical protein PHAVU_006G154400g             140   7e-36   Phaseolus vulgaris [French bean]
gb|AFK34472.1|  unknown                                                 133   2e-34   Lotus japonicus
ref|XP_006366267.1|  PREDICTED: cell wall integrity and stress re...    117   5e-30   Solanum tuberosum [potatoes]
ref|XP_005651318.1|  TMS membrane protein/tumor differentially hy...    120   1e-28   Coccomyxa subellipsoidea C-169
tpg|DAA49274.1|  TPA: hypothetical protein ZEAMMB73_017777              106   5e-24   
ref|XP_011397622.1|  putative serine incorporator                       106   7e-24   Auxenochlorella protothecoides
ref|XP_002506090.1|  predicted protein                                  104   5e-23   Micromonas commoda
gb|KIZ05916.1|  putative serine incorporator                            103   1e-22   Monoraphidium neglectum
ref|XP_001696805.1|  hypothetical protein CHLREDRAFT_192111           99.8    2e-22   Chlamydomonas reinhardtii
gb|KCW70853.1|  hypothetical protein EUGRSUZ_F03990                   95.1    4e-20   Eucalyptus grandis [rose gum]
ref|XP_006850791.1|  hypothetical protein AMTR_s00025p00104130        90.1    2e-18   
ref|XP_005850950.1|  hypothetical protein CHLNCDRAFT_48549            90.5    3e-18   Chlorella variabilis
ref|XP_008673654.1|  PREDICTED: uncharacterized protein LOC100191...  86.7    4e-17   Zea mays [maize]
ref|XP_003062471.1|  predicted protein                                87.4    6e-17   Micromonas pusilla CCMP1545
ref|XP_002956760.1|  hypothetical protein VOLCADRAFT_83749            85.5    2e-16   Volvox carteri f. nagariensis
ref|XP_004302121.1|  PREDICTED: serine incorporator 3-like            82.8    5e-16   Fragaria vesca subsp. vesca
gb|EMS53525.1|  putative serine incorporator                          79.3    2e-14   Triticum urartu
gb|AAF30310.1|AC018907_10  hypothetical protein                       69.3    6e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KHN33071.1|  hypothetical protein glysoja_010062                   66.6    7e-11   Glycine soja [wild soybean]
ref|XP_002965853.1|  hypothetical protein SELMODRAFT_83891            68.9    1e-10   
ref|XP_006407969.1|  hypothetical protein EUTSA_v10020853mg           67.8    2e-10   
ref|XP_001416509.1|  predicted protein                                67.8    4e-10   Ostreococcus lucimarinus CCE9901
ref|XP_001753882.1|  predicted protein                                67.4    4e-10   
emb|CAN71158.1|  hypothetical protein VITISV_036762                   65.9    8e-10   Vitis vinifera
ref|XP_011091387.1|  PREDICTED: probable serine incorporator          65.5    2e-09   Sesamum indicum [beniseed]
ref|XP_002515588.1|  conserved hypothetical protein                   63.5    8e-09   Ricinus communis
ref|XP_010249828.1|  PREDICTED: probable serine incorporator          63.2    1e-08   Nelumbo nucifera [Indian lotus]
gb|KDP32305.1|  hypothetical protein JCGZ_13230                       62.4    2e-08   Jatropha curcas
ref|XP_010527190.1|  PREDICTED: probable serine incorporator          62.0    3e-08   Tarenaya hassleriana [spider flower]
ref|XP_006414928.1|  hypothetical protein EUTSA_v10025402mg           62.0    3e-08   Eutrema salsugineum [saltwater cress]
ref|XP_008337449.1|  PREDICTED: probable serine incorporator          61.2    5e-08   
ref|XP_010915041.1|  PREDICTED: probable serine incorporator          61.2    5e-08   Elaeis guineensis
ref|XP_002966499.1|  hypothetical protein SELMODRAFT_85365            61.2    6e-08   
ref|XP_009352478.1|  PREDICTED: probable serine incorporator          60.8    6e-08   
ref|XP_002982341.1|  hypothetical protein SELMODRAFT_179397           60.8    8e-08   Selaginella moellendorffii
gb|EYU43805.1|  hypothetical protein MIMGU_mgv1a018435mg              60.5    1e-07   Erythranthe guttata [common monkey flower]
ref|XP_010047746.1|  PREDICTED: probable serine incorporator isof...  60.5    1e-07   Eucalyptus grandis [rose gum]
ref|XP_868873.1|  hypothetical protein AN9491.2                       60.8    1e-07   Aspergillus nidulans FGSC A4
ref|XP_009381145.1|  PREDICTED: probable serine incorporator          60.1    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004994555.1|  hypothetical protein PTSG_04461                  59.7    2e-07   Salpingoeca rosetta
gb|EPS58143.1|  hypothetical protein M569_16673                       57.4    2e-07   Genlisea aurea
ref|XP_009408948.1|  PREDICTED: probable serine incorporator          59.3    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010656351.1|  PREDICTED: serine incorporator 3 isoform X3      58.9    3e-07   
ref|XP_006842248.1|  hypothetical protein AMTR_s00078p00195500        58.9    3e-07   Amborella trichopoda
emb|CAN70494.1|  hypothetical protein VITISV_041932                   58.5    4e-07   Vitis vinifera
ref|XP_010656344.1|  PREDICTED: probable serine incorporator isof...  58.5    4e-07   
ref|XP_009336915.1|  PREDICTED: probable serine incorporator          58.5    5e-07   
emb|CDY39551.1|  BnaC07g07190D                                        58.2    5e-07   Brassica napus [oilseed rape]
gb|EEH05886.1|  DNA mismatch repair protein pms1                      58.5    6e-07   Histoplasma capsulatum G186AR
gb|EGC49614.1|  DNA mismatch repair protein                           58.5    6e-07   Histoplasma capsulatum H88
gb|EER41787.1|  DNA mismatch repair protein                           58.5    6e-07   Histoplasma capsulatum H143
ref|XP_007013229.1|  Serinc-domain containing serine and sphingol...  57.8    7e-07   
ref|XP_007202140.1|  hypothetical protein PRUPE_ppa006940mg           57.8    7e-07   
ref|XP_008024685.1|  hypothetical protein SETTUDRAFT_168930           58.2    7e-07   Exserohilum turcica Et28A
dbj|BAJ93223.1|  predicted protein                                    57.8    7e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007013228.1|  Serinc-domain containing serine and sphingol...  57.8    7e-07   
gb|KGQ04935.1|  Membrane protein TMS1                                 57.8    8e-07   Beauveria bassiana D1-5
ref|XP_007152808.1|  hypothetical protein PHAVU_004G161400g           57.8    8e-07   Phaseolus vulgaris [French bean]
ref|NP_001053258.1|  Os04g0506300                                     57.8    9e-07   
gb|KDO54165.1|  hypothetical protein CISIN_1g0159802mg                57.4    9e-07   Citrus sinensis [apfelsine]
ref|NP_189089.3|  Serinc-domain containing serine and sphingolipi...  57.4    9e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006451100.1|  hypothetical protein CICLE_v10008536mg           57.4    1e-06   Citrus clementina [clementine]
gb|EJU04752.1|  TMS membrane protein                                  57.4    1e-06   Dacryopinax primogenitus
ref|XP_010488550.1|  PREDICTED: probable serine incorporator          57.4    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010435285.1|  PREDICTED: probable serine incorporator          57.4    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_007709253.1|  hypothetical protein COCCADRAFT_88158            57.4    1e-06   Bipolaris zeicola 26-R-13
ref|XP_002885648.1|  TMS membrane family protein                      57.4    1e-06   
emb|CDY43689.1|  BnaC08g46960D                                        57.4    1e-06   Brassica napus [oilseed rape]
gb|KIX04087.1|  hypothetical protein Z518_07640                       57.4    1e-06   Rhinocladiella mackenziei CBS 650.93
ref|XP_003620496.1|  Serine incorporator                              57.0    1e-06   Medicago truncatula
ref|XP_008242601.1|  PREDICTED: probable serine incorporator          57.0    1e-06   Prunus mume [ume]
ref|XP_008362934.1|  PREDICTED: probable serine incorporator          57.0    1e-06   
ref|XP_007687418.1|  hypothetical protein COCMIDRAFT_93798            57.0    1e-06   Bipolaris oryzae ATCC 44560
ref|XP_009107689.1|  PREDICTED: probable serine incorporator          57.0    2e-06   
gb|KIL67495.1|  hypothetical protein M378DRAFT_258687                 57.0    2e-06   Amanita muscaria Koide BX008
ref|XP_007701878.1|  hypothetical protein COCSADRAFT_121304           57.0    2e-06   Bipolaris sorokiniana ND90Pr
gb|KIV97946.1|  hypothetical protein PV10_01642                       57.0    2e-06   Exophiala mesophila
gb|EUN26863.1|  hypothetical protein COCVIDRAFT_99736                 57.0    2e-06   Bipolaris victoriae FI3
gb|KIJ14234.1|  hypothetical protein PAXINDRAFT_163421                57.0    2e-06   Paxillus involutus ATCC 200175
gb|EMD93772.1|  hypothetical protein COCHEDRAFT_1132482               57.0    2e-06   Bipolaris maydis C5
ref|XP_008793444.1|  PREDICTED: probable serine incorporator          56.6    2e-06   
emb|CDX94813.1|  BnaC03g43750D                                        56.6    2e-06   
ref|NP_001131274.1|  uncharacterized protein LOC100192587             56.2    2e-06   
ref|XP_002841809.1|  hypothetical protein                             56.6    2e-06   Tuber melanosporum Mel28
ref|XP_008081744.1|  hypothetical protein GLAREA_12772                56.6    2e-06   Glarea lozoyensis ATCC 20868
gb|KJB54128.1|  hypothetical protein B456_009G023600                  56.2    2e-06   Gossypium raimondii
ref|XP_002863245.1|  hypothetical protein ARALYDRAFT_497050           56.2    2e-06   
gb|KHG16194.1|  Serine incorporator 3                                 56.2    2e-06   Gossypium arboreum [tree cotton]
gb|AGG38116.1|  maternal effect embryo arrest 55-3 protein            53.9    2e-06   Dimocarpus longan [longan]
ref|XP_003660386.1|  hypothetical protein MYCTH_2298645               56.2    2e-06   Thermothelomyces thermophila ATCC 42464
gb|EMF14941.1|  TMS membrane protein/tumor differentially express...  56.2    2e-06   Sphaerulina musiva SO2202
ref|XP_004346817.1|  hypothetical protein CAOG_05132                  56.2    2e-06   Capsaspora owczarzaki ATCC 30864
ref|XP_002994401.1|  hypothetical protein SELMODRAFT_449363           56.2    2e-06   Selaginella moellendorffii
ref|XP_007160349.1|  hypothetical protein PHAVU_002G314300g           56.2    2e-06   Phaseolus vulgaris [French bean]
gb|KJB54130.1|  hypothetical protein B456_009G023600                  56.2    2e-06   Gossypium raimondii
ref|XP_009135894.1|  PREDICTED: probable serine incorporator isof...  56.2    2e-06   Brassica rapa
emb|CAF87545.1|  unnamed protein product                              54.3    3e-06   Tetraodon nigroviridis
gb|KJB54127.1|  hypothetical protein B456_009G023600                  56.2    3e-06   Gossypium raimondii
gb|ACG28988.1|  TMS membrane protein/tumor differentially express...  56.2    3e-06   Zea mays [maize]
gb|KIZ04409.1|  Serine incorporator 3                                 55.8    3e-06   Monoraphidium neglectum
emb|CAF88463.1|  unnamed protein product                              53.9    3e-06   Tetraodon nigroviridis
emb|CDX93013.1|  BnaA03g37350D                                        55.8    3e-06   
tpe|CBF69928.1|  TPA: membrane protein TMS1, putative (AFU_orthol...  55.8    4e-06   Aspergillus nidulans FGSC A4
ref|XP_011043440.1|  PREDICTED: probable serine incorporator          55.5    4e-06   Populus euphratica
dbj|BAK01836.1|  predicted protein                                    55.8    4e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003630817.1|  Serine incorporator                              55.5    4e-06   
ref|XP_003653050.1|  hypothetical protein THITE_2115040               55.8    4e-06   Thielavia terrestris NRRL 8126
gb|AET05293.2|  serinc-domain serine and sphingolipid biosynthesi...  55.5    4e-06   Medicago truncatula
ref|XP_003842629.1|  similar to membrane protein TMS1                 55.5    4e-06   Leptosphaeria maculans JN3
ref|XP_001223754.1|  hypothetical protein CHGG_04540                  55.5    5e-06   Chaetomium globosum CBS 148.51
ref|XP_006668148.1|  membrane protein TMS1, putative                  55.5    5e-06   Cordyceps militaris CM01
ref|XP_010656350.1|  PREDICTED: probable serine incorporator isof...  55.1    5e-06   
ref|XP_010875845.1|  PREDICTED: serine incorporator 4 isoform X1      55.5    5e-06   Esox lucius
ref|XP_010466851.1|  PREDICTED: probable serine incorporator          55.1    6e-06   Camelina sativa [gold-of-pleasure]
gb|KDQ24609.1|  hypothetical protein PLEOSDRAFT_1078682               55.5    6e-06   Pleurotus ostreatus PC15
ref|XP_010450223.1|  PREDICTED: probable serine incorporator          55.1    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_001770496.1|  predicted protein                                55.1    6e-06   
emb|CDX77425.1|  BnaA07g05630D                                        55.1    6e-06   
ref|XP_006340916.1|  PREDICTED: probable serine incorporator-like     55.1    6e-06   Solanum tuberosum [potatoes]
ref|XP_009102507.1|  PREDICTED: probable serine incorporator isof...  55.1    6e-06   Brassica rapa
ref|XP_010513493.1|  PREDICTED: probable serine incorporator          55.1    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009102508.1|  PREDICTED: probable serine incorporator isof...  55.1    6e-06   Brassica rapa
ref|XP_010875852.1|  PREDICTED: serine incorporator 4 isoform X2      55.1    6e-06   Esox lucius
gb|KDQ57032.1|  hypothetical protein JAAARDRAFT_35631                 55.1    6e-06   Jaapia argillacea MUCL 33604
emb|CCX14994.1|  Similar to Membrane protein TMS1; acc. no. Q12116    55.1    7e-06   Pyronema omphalodes CBS 100304
ref|XP_006285723.1|  hypothetical protein CARUB_v10007195mg           54.7    7e-06   
emb|CDM81834.1|  unnamed protein product                              54.7    7e-06   
ref|XP_009161557.1|  hypothetical protein HMPREF1120_09034            55.1    7e-06   
ref|XP_006297795.1|  hypothetical protein CARUB_v10013830mg           54.7    7e-06   
gb|KIZ01350.1|  hypothetical protein MNEG_6614                        52.4    8e-06   
ref|XP_001275614.1|  membrane protein TMS1, putative                  54.7    8e-06   
ref|XP_008039450.1|  hypothetical protein TRAVEDRAFT_168740           54.7    8e-06   
ref|XP_010440600.1|  PREDICTED: probable serine incorporator          54.7    8e-06   
ref|XP_008731904.1|  hypothetical protein G647_09379                  54.7    9e-06   
emb|CAG12469.1|  unnamed protein product                              54.7    9e-06   
emb|CEJ00743.1|  hypothetical protein RMCBS344292_14792               54.7    9e-06   
ref|XP_010791925.1|  PREDICTED: serine incorporator 5-like            53.5    1e-05   
ref|XP_698642.3|  PREDICTED: serine incorporator 4 isoform X1         54.7    1e-05   
dbj|GAD92421.1|  DNA mismatch repair protein (Pms1), putative         54.7    1e-05   
ref|XP_001399368.2|  membrane protein TMS1                            54.3    1e-05   
gb|KDN52824.1|  TMS membrane protein/tumor differentially express...  54.7    1e-05   
ref|XP_003332195.1|  hypothetical protein PGTG_13562                  54.3    1e-05   
gb|KID61935.1|  TMS membrane protein/tumor differentially express...  54.3    1e-05   
gb|KIK77929.1|  hypothetical protein PAXRUDRAFT_834805                54.3    1e-05   
dbj|GAA82425.1|  membrane protein TMS1                                54.3    1e-05   
ref|XP_005166547.1|  PREDICTED: serine incorporator 4 isoform X2      54.3    1e-05   
ref|XP_008789960.1|  PREDICTED: serine incorporator 3-like            52.8    1e-05   
ref|XP_004139427.1|  PREDICTED: serine incorporator 1-like            54.3    1e-05   
ref|XP_004512855.1|  PREDICTED: probable serine incorporator-like     54.3    1e-05   
ref|XP_009545469.1|  hypothetical protein HETIRDRAFT_458668           54.3    1e-05   
gb|KDR76388.1|  hypothetical protein GALMADRAFT_247842                54.3    1e-05   
gb|KIW94765.1|  hypothetical protein Z519_04742                       54.3    1e-05   
ref|XP_007744780.1|  hypothetical protein A1O5_05994                  54.3    1e-05   
emb|CAK96401.1|  unnamed protein product                              53.9    1e-05   
ref|XP_006418744.1|  hypothetical protein EUTSA_v10002545mg           53.9    1e-05   
gb|KIW83119.1|  hypothetical protein Z517_02363                       53.9    1e-05   
gb|EMT13739.1|  Putative serine incorporator                          53.9    2e-05   
ref|XP_008713987.1|  hypothetical protein HMPREF1541_11096            53.9    2e-05   
gb|KEY81584.1|  hypothetical protein membrane TMS1                    53.9    2e-05   
gb|EDP54845.1|  membrane protein TMS1, putative                       53.9    2e-05   
ref|XP_001745243.1|  hypothetical protein                             53.9    2e-05   
gb|KIW63213.1|  hypothetical protein PV04_10077                       53.9    2e-05   
ref|XP_006418745.1|  hypothetical protein EUTSA_v10002545mg           53.5    2e-05   
ref|XP_755673.1|  membrane protein TMS1                               53.9    2e-05   
gb|KFG83214.1|  putative membrane protein TMS1                        53.9    2e-05   
ref|XP_001538371.1|  conserved hypothetical protein                   53.9    2e-05   
gb|EEC70050.1|  hypothetical protein OsI_00646                        53.5    2e-05   
gb|EEE53986.1|  hypothetical protein OsJ_00615                        53.5    2e-05   
ref|XP_008471585.1|  PREDICTED: serine incorporator 1                 53.9    2e-05   
gb|ESZ95719.1|  putative membrane protein TMS1                        53.5    2e-05   
gb|AGG38115.1|  maternal effect embryo arrest 55-2 protein            53.1    2e-05   
ref|XP_003524388.1|  PREDICTED: probable serine incorporator-like...  53.5    2e-05   
ref|NP_001042203.1|  Os01g0179800                                     53.5    2e-05   
ref|XP_008600130.1|  serine incorporator                              53.5    2e-05   
ref|XP_007817272.1|  serine incorporator                              53.5    2e-05   
ref|XP_003969796.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...  53.5    2e-05   
gb|KHN21548.1|  Putative serine incorporator                          53.1    2e-05   
gb|AGG19193.1|  maternal effect embryo arrest 55-1                    53.1    2e-05   
ref|XP_007338591.1|  TMS membrane protein/tumor differentially ex...  53.1    3e-05   
ref|XP_003303516.1|  hypothetical protein PTT_15753                   53.1    3e-05   
ref|XP_009390129.1|  PREDICTED: probable serine incorporator          53.1    3e-05   
ref|XP_001935501.1|  membrane protein TMS1                            53.1    3e-05   
gb|KIW58600.1|  hypothetical protein PV05_03105                       53.1    3e-05   
emb|CEG74954.1|  hypothetical protein RMATCC62417_10078               53.1    3e-05   
emb|CEG74953.1|  hypothetical protein RMATCC62417_10078               53.1    3e-05   
ref|XP_007761600.1|  hypothetical protein A1O7_09422                  53.1    3e-05   
gb|KJB06650.1|  hypothetical protein B456_001G003900                  52.8    3e-05   
ref|XP_009171257.1|  hypothetical protein T265_07464                  53.1    3e-05   
gb|KJB06649.1|  hypothetical protein B456_001G003900                  52.8    3e-05   
ref|XP_004968422.1|  PREDICTED: probable serine incorporator-like...  52.8    3e-05   
ref|XP_002324973.1|  TMS membrane family protein                      52.8    3e-05   
ref|XP_006628900.1|  PREDICTED: serine incorporator 4-like            52.8    3e-05   
ref|XP_001260800.1|  membrane protein TMS1, putative                  52.8    4e-05   
ref|XP_007814237.1|  membrane protein TMS1, putative                  52.8    4e-05   
ref|XP_005646031.1|  Serinc-domain-containing protein                 52.8    4e-05   
ref|XP_010749554.1|  PREDICTED: serine incorporator 4                 52.8    4e-05   
ref|XP_011458210.1|  PREDICTED: probable serine incorporator isof...  52.8    4e-05   
ref|XP_010532841.1|  PREDICTED: probable serine incorporator          52.8    4e-05   
ref|XP_007420896.1|  PREDICTED: serine incorporator 3                 52.8    4e-05   
ref|XP_004287083.1|  PREDICTED: probable serine incorporator isof...  52.8    4e-05   
ref|XP_004247941.2|  PREDICTED: probable serine incorporator          52.8    4e-05   
ref|XP_010925321.1|  PREDICTED: probable serine incorporator          52.4    4e-05   
ref|XP_499892.1|  YALI0A09064p                                        52.8    4e-05   
ref|XP_003530635.1|  PREDICTED: probable serine incorporator isof...  52.4    4e-05   
gb|EYE97808.1|  TMS membrane protein/tumor differentially express...  52.4    5e-05   
ref|XP_008302146.1|  PREDICTED: serine incorporator 4                 52.0    5e-05   
ref|XP_001803629.1|  hypothetical protein SNOG_13417                  52.4    6e-05   
gb|KIN08538.1|  hypothetical protein OIDMADRAFT_108243                52.4    6e-05   
ref|XP_007779022.1|  hypothetical protein W97_02933                   52.0    6e-05   
ref|XP_002626102.1|  serine incorporator                              52.0    6e-05   
gb|EEQ92459.1|  membrane protein TMS1                                 52.0    6e-05   
emb|CCD47151.1|  similar to membrane protein TMS1                     52.0    6e-05   
ref|XP_004512960.1|  PREDICTED: probable serine incorporator-like     52.0    6e-05   
ref|XP_006680018.1|  hypothetical protein BATDEDRAFT_37095            52.0    6e-05   
gb|EJT47328.1|  vacuolar transmembrane protein, Tms1p                 52.0    6e-05   
gb|KIW14122.1|  hypothetical protein PV08_06903                       52.0    7e-05   
gb|EPE08329.1|  membrane protein                                      52.0    7e-05   
ref|XP_001910362.1|  hypothetical protein                             51.6    7e-05   
gb|KIX97644.1|  hypothetical protein Z520_06422                       52.0    7e-05   
ref|XP_009336936.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  51.6    7e-05   
ref|XP_007558907.1|  PREDICTED: serine incorporator 4 isoform X1      52.0    7e-05   
ref|XP_004301051.1|  PREDICTED: probable serine incorporator          52.0    7e-05   
ref|XP_005808175.1|  PREDICTED: serine incorporator 4-like            52.0    7e-05   
ref|XP_008404277.1|  PREDICTED: serine incorporator 4 isoform X1      52.0    7e-05   
gb|EKG14098.1|  TMS membrane protein/tumor differentially express...  52.0    8e-05   
ref|XP_001703677.1|  predicted protein                                51.6    8e-05   
gb|KEP52328.1|  TMS membrane protein/tumor differentially protein     52.0    8e-05   
ref|XP_006804507.1|  PREDICTED: serine incorporator 4-like            52.0    8e-05   
ref|XP_007558909.1|  PREDICTED: serine incorporator 4 isoform X2      51.6    8e-05   
ref|XP_962656.1|  membrane protein TMS1                               51.6    8e-05   
ref|XP_010049922.1|  PREDICTED: probable serine incorporator isof...  51.6    8e-05   
gb|KIW39489.1|  hypothetical protein PV06_08096                       51.6    9e-05   
gb|KID90718.1|  TMS membrane protein/tumor differentially express...  51.6    9e-05   
ref|XP_003936453.1|  PREDICTED: serine incorporator 3                 51.6    9e-05   
ref|XP_008404278.1|  PREDICTED: serine incorporator 4 isoform X2      51.6    1e-04   
emb|CDP30893.1|  Putative Protein similar to Membrane protein PB1...  51.6    1e-04   
gb|KGO42902.1|  TMS membrane protein/tumor differentially express...  51.6    1e-04   
ref|XP_009267712.1|  Membrane protein TMS1                            51.6    1e-04   
ref|XP_010049913.1|  PREDICTED: probable serine incorporator isof...  51.2    1e-04   
ref|XP_006459126.1|  hypothetical protein AGABI2DRAFT_218071          51.6    1e-04   
ref|XP_006653583.1|  PREDICTED: probable serine incorporator-like     51.2    1e-04   
emb|CCG81041.1|  Putative uncharacterized protein                     51.2    1e-04   
ref|XP_002455066.1|  hypothetical protein SORBIDRAFT_03g003750        51.2    1e-04   
gb|EXX52304.1|  Tms1p                                                 51.2    1e-04   
ref|XP_001190705.2|  PREDICTED: probable serine incorporator-like     51.2    1e-04   
ref|XP_007597507.1|  serine incorporator                              51.2    1e-04   
ref|XP_004566412.1|  PREDICTED: serine incorporator 4-like isofor...  51.2    1e-04   
ref|XP_008335323.1|  PREDICTED: serine incorporator 4                 51.2    1e-04   
ref|XP_005746743.1|  PREDICTED: serine incorporator 4-like isofor...  51.2    1e-04   
ref|XP_003456950.2|  PREDICTED: serine incorporator 4-like isofor...  51.2    1e-04   
gb|KFH68151.1|  hypothetical protein MVEG_06880                       51.2    1e-04   
gb|ABK22983.1|  unknown                                               51.2    1e-04   
gb|ESA19644.1|  hypothetical protein GLOINDRAFT_19362                 51.2    1e-04   
emb|CDP03356.1|  unnamed protein product                              51.2    1e-04   
gb|KIW26131.1|  hypothetical protein PV07_09255                       51.2    1e-04   
gb|KDN50456.1|  hypothetical protein RSAG8_00954                      51.2    1e-04   
emb|CDY71080.1|  BnaAnng36040D                                        50.8    1e-04   
ref|XP_006645562.1|  PREDICTED: probable serine incorporator-like     50.8    1e-04   
ref|XP_009135897.1|  PREDICTED: probable serine incorporator isof...  50.8    1e-04   
emb|CCU76055.1|  TPA membrane protein TMS1                            51.2    1e-04   
ref|NP_567403.1|  protein MATERNAL EFFECT EMBRYO ARREST 55            50.8    1e-04   
ref|NP_849373.1|  protein MATERNAL EFFECT EMBRYO ARREST 55            50.8    1e-04   
ref|XP_009619984.1|  PREDICTED: probable serine incorporator          50.8    2e-04   
ref|XP_005461684.1|  PREDICTED: serine incorporator 4-like isofor...  50.8    2e-04   
ref|XP_005746744.1|  PREDICTED: serine incorporator 4-like isofor...  50.8    2e-04   
ref|XP_002968524.1|  hypothetical protein SELMODRAFT_89240            50.8    2e-04   
ref|XP_004566413.1|  PREDICTED: serine incorporator 4-like isofor...  50.8    2e-04   
gb|KHJ32730.1|  putative serine incorporator                          50.8    2e-04   
gb|ELU40360.1|  membrane protein                                      50.8    2e-04   
ref|XP_001590962.1|  hypothetical protein SS1G_07586                  50.8    2e-04   
ref|XP_008667561.1|  PREDICTED: hypothetical protein isoform X1       50.4    2e-04   
ref|XP_006693860.1|  hypothetical protein CTHT_0034250                50.4    2e-04   
gb|ACG46077.1|  TMS membrane protein/tumor differentially express...  50.4    2e-04   
emb|CCO28932.1|  Membrane protein TMS1                                50.4    2e-04   
ref|XP_001821791.1|  membrane protein TMS1                            50.4    2e-04   
ref|XP_001245605.1|  hypothetical protein CIMG_05046                  50.4    2e-04   
ref|XP_004366977.1|  TMS membrane protein                             50.4    2e-04   
ref|XP_010879048.1|  PREDICTED: serine incorporator 3-like            50.4    2e-04   
emb|CDO99387.1|  unnamed protein product                              50.4    2e-04   
emb|CEL55425.1|  Membrane protein TMS1 OS=Saccharomyces cerevisia...  50.4    2e-04   
ref|XP_001836185.1|  membrane protein                                 50.4    2e-04   
ref|XP_007791261.1|  putative membrane protein                        50.4    2e-04   
gb|KIM58348.1|  hypothetical protein SCLCIDRAFT_1218695               50.4    3e-04   
emb|CBI33332.3|  unnamed protein product                              50.1    3e-04   
ref|NP_001085879.1|  serine incorporator 3 precursor                  50.4    3e-04   
gb|KIV83375.1|  hypothetical protein PV11_05406                       50.4    3e-04   
ref|XP_010049722.1|  PREDICTED: probable serine incorporator          50.1    3e-04   
ref|XP_007582032.1|  putative membrane protein tms1 protein           50.1    3e-04   
ref|NP_001016331.1|  serine incorporator 3 precursor                  50.1    3e-04   
ref|XP_009865640.1|  PREDICTED: serine incorporator 3                 50.1    3e-04   
ref|XP_007893061.1|  PREDICTED: serine incorporator 1-like            50.1    3e-04   
ref|XP_005057115.1|  PREDICTED: serine incorporator 3                 50.1    3e-04   
ref|XP_006956946.1|  TMS membrane protein/tumor differentially ex...  50.1    3e-04   
ref|XP_002448136.1|  hypothetical protein SORBIDRAFT_06g021920        50.1    3e-04   
ref|XP_006295917.1|  hypothetical protein CARUB_v10025054mg           50.1    3e-04   
gb|KFP75273.1|  Serine incorporator 3                                 50.1    3e-04   
ref|XP_003174803.1|  membrane protein TMS1                            50.1    3e-04   
ref|XP_010650214.1|  PREDICTED: probable serine incorporator          50.1    3e-04   
ref|XP_004336528.1|  serine incorporator 3, putative                  50.1    3e-04   
ref|XP_008210203.1|  PREDICTED: probable serine incorporator isof...  50.1    3e-04   
ref|XP_001603720.2|  PREDICTED: probable serine incorporator isof...  50.1    3e-04   
ref|XP_008210220.1|  PREDICTED: serine incorporator 1 isoform X4      50.1    3e-04   
ref|XP_008210211.1|  PREDICTED: probable serine incorporator isof...  50.1    3e-04   
ref|XP_008210234.1|  PREDICTED: serine incorporator 1 isoform X6      50.1    3e-04   
dbj|GAA56306.1|  serine incorporator 1                                50.1    3e-04   
ref|XP_002637793.1|  Hypothetical protein CBG04578                    50.1    3e-04   
ref|XP_004976160.1|  PREDICTED: probable serine incorporator-like     49.7    3e-04   
ref|XP_008210231.1|  PREDICTED: serine incorporator 1 isoform X5      50.1    3e-04   
ref|XP_010542976.1|  PREDICTED: probable serine incorporator          49.7    3e-04   
ref|XP_003848966.1|  hypothetical protein MYCGRDRAFT_76553            50.1    3e-04   
gb|KIK10300.1|  hypothetical protein K443DRAFT_670924                 50.1    4e-04   
gb|EFX81463.1|  hypothetical protein DAPPUDRAFT_303430                49.7    4e-04   
ref|XP_010047750.1|  PREDICTED: probable serine incorporator isof...  49.7    4e-04   
gb|KDN68812.1|  putative serine incorporator                          49.7    4e-04   
ref|XP_010073800.1|  PREDICTED: serine incorporator 3-like            49.7    4e-04   
ref|XP_009849713.1|  hypothetical protein NEUTE1DRAFT_60954           49.7    4e-04   
gb|KEH41193.1|  TMS membrane protein/tumor differentially protein     49.7    4e-04   
gb|EFQ27559.1|  serine incorporator                                   49.7    4e-04   
gb|KEQ97837.1|  hypothetical protein AUEXF2481DRAFT_95498             49.7    4e-04   
emb|CCF39398.1|  serine incorporator                                  49.7    4e-04   
gb|KID80601.1|  TMS membrane protein/tumor differentially express...  49.7    4e-04   
gb|KFU98253.1|  Serine incorporator 3                                 49.7    4e-04   
gb|KDE07206.1|  hypothetical protein MVLG_02606                       49.7    4e-04   
ref|XP_001625531.1|  predicted protein                                49.7    4e-04   
ref|NP_001240143.1|  uncharacterized protein LOC100788574             49.7    4e-04   
ref|XP_003019590.1|  hypothetical protein TRV_06386                   49.7    5e-04   
ref|XP_003071312.1|  TMS membrane protein, putative                   49.3    5e-04   
ref|XP_009775303.1|  PREDICTED: probable serine incorporator          49.7    5e-04   
ref|NP_850202.4|  Serinc-domain containing serine and sphingolipi...  49.3    5e-04   
gb|KEQ63452.1|  TMS membrane protein/tumor differentially express...  49.3    5e-04   
gb|EZF16039.1|  hypothetical protein H100_05889                       49.3    5e-04   
ref|XP_007145428.1|  hypothetical protein PHAVU_007G238300g           49.3    5e-04   
gb|EZF71972.1|  hypothetical protein H105_05899                       49.3    5e-04   
gb|ETE70063.1|  Serine incorporator 3                                 49.3    5e-04   
ref|XP_007145427.1|  hypothetical protein PHAVU_007G238300g           49.3    5e-04   
ref|XP_002426175.1|  serine incorporator, putative                    49.3    5e-04   
ref|XP_008438416.1|  PREDICTED: probable serine incorporator isof...  49.3    5e-04   
gb|KDQ14830.1|  hypothetical protein BOTBODRAFT_109376                49.3    5e-04   
ref|XP_008438413.1|  PREDICTED: probable serine incorporator isof...  49.3    5e-04   
ref|XP_008224089.1|  PREDICTED: probable serine incorporator          49.3    6e-04   
ref|XP_008438411.1|  PREDICTED: probable serine incorporator isof...  49.3    6e-04   
ref|XP_003016496.1|  hypothetical protein ARB_04785                   49.3    6e-04   
gb|KGY15026.1|  hypothetical protein PABG_12140                       49.7    6e-04   
ref|XP_008438414.1|  PREDICTED: probable serine incorporator isof...  49.3    6e-04   
gb|EZF28474.1|  hypothetical protein H101_07842                       49.3    6e-04   
ref|XP_003236539.1|  membrane protein                                 49.3    6e-04   



>ref|XP_010532058.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
 ref|XP_010532059.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
Length=414

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFT+LS+MM+G+KNQKDPRD +HHGGWMMKVICW +LVIFMFF+PNE+IS
Sbjct  80   VLRVSLGNFIFFTVLSVMMVGVKNQKDPRDGIHHGGWMMKVICWCILVIFMFFLPNEIIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>gb|KDP41926.1| hypothetical protein JCGZ_26944 [Jatropha curcas]
Length=413

 Score =   239 bits (610),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFT+L+I+M+G+KNQKDPRD+LHHGGWMMKVICW +LVIFMFF+PNE++S
Sbjct  80   VLRVSLGNFLFFTVLAILMVGVKNQKDPRDSLHHGGWMMKVICWCILVIFMFFLPNEIVS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|NP_173069.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 ref|NP_001185008.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAF18512.1|AC010924_25 Contains similarity to gb|AF181686 membrane protein TMS1d from 
Drosophila melanogaster. ESTs gb|R64994, gb|AI994832, gb|Z47674 
come from this gene [Arabidopsis thaliana]
 gb|AEE29416.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AEE29417.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=412

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF+ILS+MMIG+KNQKDPRD +HHGGWMMK+ICW +LVIFMFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKIICWCILVIFMFFLPNEIIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_006416842.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 ref|XP_006416843.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35195.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35196.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
Length=412

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF+ILS+MMIG+KNQKDPRD +HHGGWMMKVICW +LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKVICWCILVILMFFVPNEIIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>gb|ABK96018.1| unknown [Populus trichocarpa]
Length=414

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            TVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFHKTPDREWFETDAV
Sbjct  21   TVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEQIPWINHFHKTPDREWFETDAV  80

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FFTIL+IMM+G+KNQKDPRD+LHHGGWM KV+CW LLVIFMFF+PNE++SF
Sbjct  81   LRVSLGNFLFFTILAIMMVGVKNQKDPRDSLHHGGWMAKVVCWCLLVIFMFFLPNEIVSF  140

Query  536  YES  544
            YES
Sbjct  141  YES  143



>ref|XP_002297693.2| TMS membrane family protein [Populus trichocarpa]
 gb|EEE82498.2| TMS membrane family protein [Populus trichocarpa]
Length=414

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            TVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFHKTPDREWFETDAV
Sbjct  21   TVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEQIPWINHFHKTPDREWFETDAV  80

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FFTIL+IMM+G+KNQKDPRD+LHHGGWM KV+CW LLVIFMFF+PNE++SF
Sbjct  81   LRVSLGNFLFFTILAIMMVGVKNQKDPRDSLHHGGWMAKVVCWCLLVIFMFFLPNEIVSF  140

Query  536  YES  544
            YES
Sbjct  141  YES  143



>ref|XP_011034606.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034607.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034608.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=414

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            TVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFHKTPDREWFETDAV
Sbjct  21   TVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEQIPWINHFHKTPDREWFETDAV  80

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FFTIL+IMM+G+KNQKDPRD+LHHGGWM KV+CW LLVIFMFF+PNE++SF
Sbjct  81   LRVSLGNFLFFTILAIMMVGVKNQKDPRDSLHHGGWMAKVVCWCLLVIFMFFLPNEIVSF  140

Query  536  YES  544
            YES
Sbjct  141  YES  143



>ref|XP_007024820.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 ref|XP_007024821.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27442.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27443.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
Length=413

 Score =   238 bits (606),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTILS +MIG+KNQ+DPRD LHHGGWMMKVICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILSFLMIGVKNQRDPRDGLHHGGWMMKVICWFILVILMFFVPNEIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_009117776.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
 ref|XP_009117777.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
Length=413

 Score =   238 bits (606),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>emb|CDX81752.1| BnaC08g38490D [Brassica napus]
Length=412

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_009110458.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
 ref|XP_009110459.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
Length=412

 Score =   237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>gb|KJB68285.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
 gb|KJB68288.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
 gb|KJB68289.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=413

 Score =   237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTILS+ M+G+KNQ+DPRD +HHGGWMMK+ICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILSVSMVGVKNQRDPRDAVHHGGWMMKIICWFILVILMFFVPNEIIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>emb|CDY70974.1| BnaAnng35710D [Brassica napus]
Length=412

 Score =   237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>gb|KJB68286.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=411

 Score =   237 bits (605),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTILS+ M+G+KNQ+DPRD +HHGGWMMK+ICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILSVSMVGVKNQRDPRDAVHHGGWMMKIICWFILVILMFFVPNEIIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_002890152.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66411.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   237 bits (604),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF+ILS+MMIG+KNQKDPRD +HHGGWMMK+ICW +LVI MFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKIICWCILVILMFFLPNEIIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_010063623.1| PREDICTED: probable serine incorporator isoform X2 [Eucalyptus 
grandis]
 gb|KCW70852.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=412

 Score =   237 bits (604),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISR+SARIAYCGLF LSLIVSWILREVAAPLME +PWIN FHKTPDREWFETDA
Sbjct  20   RTVVSGISRKSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINQFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+IMMIG+KNQ+DPRD +HHGGWMMK+ICW LLVIFMFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFTILAIMMIGVKNQRDPRDGIHHGGWMMKIICWCLLVIFMFFLPNEIIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_010063622.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
Length=414

 Score =   237 bits (604),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISR+SARIAYCGLF LSLIVSWILREVAAPLME +PWIN FHKTPDREWFETDA
Sbjct  20   RTVVSGISRKSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINQFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+IMMIG+KNQ+DPRD +HHGGWMMK+ICW LLVIFMFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFTILAIMMIGVKNQRDPRDGIHHGGWMMKIICWCLLVIFMFFLPNEIIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>gb|KDO46126.1| hypothetical protein CISIN_1g032312mg [Citrus sinensis]
 gb|KDO46127.1| hypothetical protein CISIN_1g032312mg [Citrus sinensis]
Length=143

 Score =   226 bits (577),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  182  VSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLR  361
            VSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP REWFETDAVLR
Sbjct  23   VSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPSREWFETDAVLR  82

Query  362  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            VSLGNF FFTILSI+M+G+KNQKDPRD+LHHGGWMMK+ICW LLVIFMFF+PNE++SFY
Sbjct  83   VSLGNFLFFTILSILMVGVKNQKDPRDSLHHGGWMMKIICWCLLVIFMFFLPNEIVSFY  141



>ref|XP_002512768.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF49271.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=413

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+ +M+G+K+QKDPRD LHHGGWMMK+ICW +LVIFMFF+PNE++S
Sbjct  80   VLRVSLGNFLFFTILATLMVGVKSQKDPRDGLHHGGWMMKIICWCVLVIFMFFLPNEIVS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>gb|KHG09631.1| Serine incorporator 3 [Gossypium arboreum]
Length=413

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+  M+G+KNQ+DPRD +HHGGWMMK+ICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILAFSMVGVKNQRDPRDAVHHGGWMMKIICWFILVILMFFVPNEIIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>gb|KJB68287.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=411

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTILS+ M+G+KNQ+DPRD +HHGGWMMK+ICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILSVSMVGVKNQRDPRDAVHHGGWMMKIICWFILVILMFFVPNEIIS  139

Query  533  FYES  544
            FY S
Sbjct  140  FYAS  143



>gb|KJB67012.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
Length=374

 Score =   233 bits (593),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSL VSWILREVAAPLME +PWINHFHKTP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLFVSWILREVAAPLMEQLPWINHFHKTPNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTILS +MIG+KNQ+DPRD LHHG WMMK++CWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILSFLMIGVKNQRDPRDGLHHGRWMMKIVCWFILVILMFFVPNEIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_002304839.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
 gb|EEE79818.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
Length=364

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +2

Query  179  VVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVL  358
            VVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDAVL
Sbjct  22   VVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDAVL  81

Query  359  RVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            RVSLGNF FFTIL+ MM+G+KNQKDPRD+LHHGGWM KV+CW +LVI MFF+PNE++SFY
Sbjct  82   RVSLGNFMFFTILATMMVGVKNQKDPRDSLHHGGWMAKVVCWCILVILMFFLPNEIVSFY  141

Query  539  ES  544
            ES
Sbjct  142  ES  143



>gb|EYU21795.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=414

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFH+TPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINHFHQTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I MIG+KNQKDPRD++HHGGWMMK+ICW +LVI MFFVPN +IS
Sbjct  80   VLRVSLGNFLFFTILAIFMIGVKNQKDPRDSVHHGGWMMKIICWCVLVILMFFVPNGIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYEA  143



>gb|EYU21792.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21793.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21794.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=416

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFH+TPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINHFHQTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I MIG+KNQKDPRD++HHGGWMMK+ICW +LVI MFFVPN +IS
Sbjct  80   VLRVSLGNFLFFTILAIFMIGVKNQKDPRDSVHHGGWMMKIICWCVLVILMFFVPNGIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYEA  143



>ref|XP_006427689.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
 gb|ESR40929.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
Length=413

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  182  VSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLR  361
            VSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP REWFETDAVLR
Sbjct  23   VSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPSREWFETDAVLR  82

Query  362  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYE  541
            VSLGNF FFTILSI+M+G+KNQKDPRD+LHHGGWMMK+ICW LLVIFMFF+PNE++SFYE
Sbjct  83   VSLGNFLFFTILSILMVGVKNQKDPRDSLHHGGWMMKIICWCLLVIFMFFLPNEIVSFYE  142

Query  542  S  544
            S
Sbjct  143  S  143



>ref|XP_006307669.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
 gb|EOA40567.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
Length=412

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF+ILS+MMIG+KNQKDPRD +HHGGWMMK+I W +LVI MFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKIISWCILVILMFFLPNEIIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_006493450.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
Length=413

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  182  VSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLR  361
            VSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP REWFETDAVLR
Sbjct  23   VSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPSREWFETDAVLR  82

Query  362  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYE  541
            VSLGNF FFTILSI+M+G+KNQKDPRD+LHHGGWMMK+ICW LLVIFMFF+PNE++SFYE
Sbjct  83   VSLGNFLFFTILSILMVGVKNQKDPRDSLHHGGWMMKIICWCLLVIFMFFLPNEIVSFYE  142

Query  542  S  544
            S
Sbjct  143  S  143



>ref|XP_002270610.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 ref|XP_010655133.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 emb|CBI25248.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVS GNF FFTIL+I+MIG+KNQKDPRD +HHGGWMMK+ICW +LVIF FF+PNELIS
Sbjct  80   VLRVSFGNFLFFTILAILMIGVKNQKDPRDGMHHGGWMMKIICWCILVIFTFFLPNELIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>emb|CDO98258.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISR+SARIAYCGLF  SLIVSWILREVAAPLME IPWINHFH+TPDREWFETDA
Sbjct  20   RTVVSGISRKSARIAYCGLFAFSLIVSWILREVAAPLMEKIPWINHFHQTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL++ M+GIKNQKDPRD++HHGGWM+K+ICW LLVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILAVFMMGIKNQKDPRDSVHHGGWMIKIICWCLLVILMFFVPNEIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>gb|EPS57849.1| hypothetical protein M569_16968, partial [Genlisea aurea]
Length=239

 Score =   227 bits (578),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +2

Query  182  VSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLR  361
            +SGISRRSARIAYCGLFGLSLIVSWILREVAAPLME IPWINHFH+TPD+EWFETDAVLR
Sbjct  23   ISGISRRSARIAYCGLFGLSLIVSWILREVAAPLMEKIPWINHFHQTPDKEWFETDAVLR  82

Query  362  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYE  541
            VSLGNF FFTIL+I+M+GIKNQ+DPRD +HHGGWMMK+ CWF+LVI MFF+PN ++SFYE
Sbjct  83   VSLGNFLFFTILAILMVGIKNQRDPRDTVHHGGWMMKIFCWFVLVILMFFIPNGIVSFYE  142

Query  542  S  544
            S
Sbjct  143  S  143



>gb|KJB67006.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67007.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67008.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67009.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67010.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67011.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67013.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
Length=412

 Score =   232 bits (592),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSL VSWILREVAAPLME +PWINHFHKTP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLFVSWILREVAAPLMEQLPWINHFHKTPNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTILS +MIG+KNQ+DPRD LHHG WMMK++CWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILSFLMIGVKNQRDPRDGLHHGRWMMKIVCWFILVILMFFVPNEIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_011073234.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073235.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073236.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   231 bits (590),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSL+V+W+LREVAAPLME IPWINHFH+TPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVAWMLREVAAPLMEKIPWINHFHQTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I MIG+KNQKDPRD++HHGGWMMK+ICW +LVI MFFVPN +IS
Sbjct  80   VLRVSLGNFLFFTILAIFMIGVKNQKDPRDSIHHGGWMMKIICWCILVILMFFVPNGIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYEA  143



>ref|XP_010476724.1| PREDICTED: serine incorporator 3 [Camelina sativa]
Length=412

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF ILS+MMIG+K QKDPRD +HHGGWMMK+I W +LVI MFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFAILSVMMIGVKTQKDPRDGIHHGGWMMKIISWCILVILMFFLPNEIIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_010459155.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF ILS+MMIG+K QKDPRD +HHGGWMMK+I W +LVI MFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFAILSVMMIGVKTQKDPRDGIHHGGWMMKIISWCILVILMFFLPNEIIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_010497691.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497697.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497701.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497705.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF ILS+MMIG+K QKDPRD +HHGGWMMK+I W +LVI MFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFAILSVMMIGVKTQKDPRDGIHHGGWMMKIISWCILVILMFFLPNEIIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_011020548.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=415

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +2

Query  179  VVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVL  358
            VVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDAVL
Sbjct  22   VVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDAVL  81

Query  359  RVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            RVSLGNF FFTIL+ MM+G+KNQKDPRD+LHHGGWM KV+CW +LVI MFF+PNE++SFY
Sbjct  82   RVSLGNFMFFTILATMMVGVKNQKDPRDSLHHGGWMAKVVCWCILVILMFFLPNEIVSFY  141

Query  539  ES  544
            ES
Sbjct  142  ES  143



>ref|XP_009759116.1| PREDICTED: probable serine incorporator isoform X2 [Nicotiana 
sylvestris]
Length=411

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINSFHSTPNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_010318692.1| PREDICTED: probable serine incorporator [Solanum lycopersicum]
Length=413

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINSFHTTPNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_011082649.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME IPWINHFH+TPDREWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKIPWINHFHQTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I MIG+KNQKD RD+LHHGGWMMK+ICW +LVI MFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAIFMIGVKNQKDSRDSLHHGGWMMKIICWCILVILMFFLPNGIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYEA  143



>ref|XP_009759114.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009759115.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
Length=413

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINSFHSTPNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_006341430.1| PREDICTED: probable serine incorporator-like isoform X2 [Solanum 
tuberosum]
Length=411

 Score =   229 bits (585),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILRE+AAPLME IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREIAAPLMEKIPWINSFHTTPNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_006341429.1| PREDICTED: probable serine incorporator-like isoform X1 [Solanum 
tuberosum]
Length=413

 Score =   229 bits (584),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILRE+AAPLME IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREIAAPLMEKIPWINSFHTTPNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_009615679.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   229 bits (584),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINSFHSTPNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_010687311.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687312.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
Length=413

 Score =   229 bits (584),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISR+SARIAYCGLF LSLIV+WILREVAAPLME IPWIN+F +TPD+EWF+TDA
Sbjct  20   RTVVSGISRKSARIAYCGLFALSLIVAWILREVAAPLMEKIPWINYFQQTPDKEWFQTDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+++MIG+KNQKDPRDNLHHGGWMMK+ICW LLVI MFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFTILAVLMIGVKNQKDPRDNLHHGGWMMKIICWCLLVILMFFLPNEMIS  139

Query  533  FYES  544
             YE+
Sbjct  140  LYEA  143



>ref|XP_009615681.1| PREDICTED: probable serine incorporator isoform X3 [Nicotiana 
tomentosiformis]
Length=411

 Score =   229 bits (584),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINSFHSTPNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_010107188.1| putative serine incorporator [Morus notabilis]
 gb|EXC14084.1| putative serine incorporator [Morus notabilis]
Length=413

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWIN+FH TP REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINNFHHTPSREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I+M+G+KNQ+DPRD LHHGGWMMK+ICW LLVIFMFF+PNE+I+
Sbjct  80   VLRVSLGNFLFFTILAILMVGVKNQRDPRDGLHHGGWMMKIICWCLLVIFMFFLPNEIIN  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_009615680.1| PREDICTED: serine incorporator 3 isoform X2 [Nicotiana tomentosiformis]
Length=413

 Score =   229 bits (583),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH TP+REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINSFHSTPNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+PN +IS
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLPNGIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_004492298.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=410

 Score =   229 bits (583),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF LSL+V+WILREVAAPLME+IPWINHF +TP REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVAWILREVAAPLMESIPWINHFKQTPSREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+ +MIG+K QKDPRD LHHGGWMMK+ICW L+VIFMFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFTILATLMIGVKTQKDPRDGLHHGGWMMKIICWCLMVIFMFFLPNEIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>emb|CDX83957.1| BnaC08g16880D [Brassica napus]
Length=821

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVPNE+IS
Sbjct  80   VLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVPNEVIS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_008342757.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN F++T +REWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINQFNETHNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTILS+MM+G+KNQKDPRD+LHHGGWMMKVICW LLVIFMFFVPNE++S
Sbjct  80   VLRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVPNEIVS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_010914044.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=415

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            R+VV GISRRS+RIAYCGLF  SLIVSWILREVAAPLME +PWINHFH+TPDREWFETDA
Sbjct  20   RSVVGGISRRSSRIAYCGLFAFSLIVSWILREVAAPLMEKLPWINHFHRTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL++MM+GIK+QKDPRD LHHGGWM K++CWF+LVI MFFVPN L+S
Sbjct  80   VLRVSLGNFLFFTILALMMVGIKDQKDPRDRLHHGGWMAKIVCWFVLVILMFFVPNGLVS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_004158797.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
 gb|KGN45209.1| hypothetical protein Csa_7G431410 [Cucumis sativus]
Length=411

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH+TP R+WF+TDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINTFHETPSRDWFQTDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTILS+MM+G+K+Q+DPRDN+HHGGWM+KVICWFLLV+ MFFVPNE+I+
Sbjct  80   VLRVSLGNFLFFTILSVMMVGVKSQRDPRDNIHHGGWMVKVICWFLLVVLMFFVPNEIIT  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_007140603.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
 gb|ESW12597.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
Length=410

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF  SLIV+WILREVAAPLME++PWINHF  TP REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFAFSLIVAWILREVAAPLMESLPWINHFSHTPSREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+++M G+K Q+DPRD +HHGGWMMK+ICWFLLVIFMFFVPNE+I 
Sbjct  80   VLRVSLGNFLFFTILAVLMTGVKTQRDPRDGMHHGGWMMKIICWFLLVIFMFFVPNEIIG  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_009354238.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009354239.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370970.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370971.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   227 bits (579),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN F++T +REWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINQFNETHNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTILS+MM+G+KNQKDPRD+LHHGGWMMKVICW LLVIFMFFVPNE++S
Sbjct  80   VLRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVPNEIVS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_003532291.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN07179.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   227 bits (578),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF  SL+V+WILREVAAPLME++PWINHF  TP REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFAFSLVVAWILREVAAPLMESLPWINHFKHTPSREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+++M+G+K Q+DPRD++HHGGWMMK+ICW LLVIFMFFVPNE+IS
Sbjct  80   VLRVSLGNFLFFTILAVLMVGVKTQRDPRDSMHHGGWMMKIICWCLLVIFMFFVPNEIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_010929191.1| PREDICTED: probable serine incorporator isoform X2 [Elaeis guineensis]
Length=415

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            R+VV GISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFH+TPDREWFETDA
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHQTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+++M+GIK+QKDPRD LHHGGWM K++CW +LVI MFFVPN L+S
Sbjct  80   VLRVSLGNFLFFTILAVLMVGIKDQKDPRDRLHHGGWMAKIVCWCVLVILMFFVPNGLVS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_009365247.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009365248.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWI+ F++T +REWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWISQFNETHNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTILS+MM+G+KNQKDPRD+LHHGGWMMKVICW LLVIFMFFVPNE++S
Sbjct  80   VLRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVPNEIVS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_010929190.1| PREDICTED: probable serine incorporator isoform X1 [Elaeis guineensis]
Length=423

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            R+VV GISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFH+TPDREWFETDA
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHQTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+++M+GIK+QKDPRD LHHGGWM K++CW +LVI MFFVPN L+S
Sbjct  80   VLRVSLGNFLFFTILAVLMVGIKDQKDPRDRLHHGGWMAKIVCWCVLVILMFFVPNGLVS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_008461193.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Cucumis melo]
Length=416

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH+TP R+WF+TDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINTFHETPSRDWFQTDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTILS+MM+G+K Q+DPRDN+HHGGWM+KVICWFLLV+ MFF+PNE+I+
Sbjct  80   VLRVSLGNFLFFTILSVMMVGVKTQRDPRDNIHHGGWMVKVICWFLLVVLMFFIPNEIIT  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_008794380.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=415

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            R+VV GISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFH+TPDREWFETDA
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHRTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+++M GIK+QKDPRD LHHGGWM KV+CW +LVI MFFVPN L+S
Sbjct  80   VLRVSLGNFLFFTILALLMAGIKDQKDPRDRLHHGGWMAKVVCWCVLVILMFFVPNGLVS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_003552131.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN15373.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVSGISRRSARIAYCGLF  SL+V+WILREVAAPLME++PWINHF  TP REWFETDA
Sbjct  20   RTVVSGISRRSARIAYCGLFAFSLVVAWILREVAAPLMESLPWINHFKHTPSREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I+M+G+K Q+DPRD++HHGGWMMK+ICW LLVI MFF+PNE+IS
Sbjct  80   VLRVSLGNFLFFTILAILMVGVKTQRDPRDSMHHGGWMMKIICWCLLVISMFFIPNEIIS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_004135884.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
Length=422

 Score =   224 bits (570),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH+TP R+WF+TDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINTFHETPSRDWFQTDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTILS+MM+G+K+Q+DPRDN+HHGGWM+KVICWFLLV+ MFFVPNE+I+
Sbjct  80   VLRVSLGNFLFFTILSVMMVGVKSQRDPRDNIHHGGWMVKVICWFLLVVLMFFVPNEIIT  139

Query  533  FY  538
            FY
Sbjct  140  FY  141



>ref|XP_008381162.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVS ILREVAAPL+E IPWI+ F++T +REWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSXILREVAAPLLEKIPWISQFNETHNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTILS+MM+G+KNQKDPRD+LHHGGWMMKVICW LLVIFMFFVPNE++S
Sbjct  80   VLRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVPNEIVS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_009399576.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            R+V   ISRRSARIAYCGLF LSL+VSW LREVAAPLME++PWINHFHKTPDREWFETDA
Sbjct  20   RSVAGSISRRSARIAYCGLFALSLVVSWGLREVAAPLMESLPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+++MIGIK+QKDPRD LHHGGWM K++CWF++V  MFFVPN ++S
Sbjct  80   VLRVSLGNFVFFTILAVVMIGIKDQKDPRDQLHHGGWMAKIVCWFIVVFLMFFVPNGIVS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_009383181.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   219 bits (557),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            R+VV GISRRSARIAYCGLF LSL+VSW+LREVAAPLME++PWINHF KTPDREWFETDA
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLVVSWVLREVAAPLMESLPWINHFRKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFT+L+++MIGIK+QKDPRD LHHGGWM K++CW ++V  MFFVPN ++S
Sbjct  80   VLRVSLGNFFFFTLLAVLMIGIKDQKDPRDRLHHGGWMAKIVCWCIVVFLMFFVPNGIVS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_007215457.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 ref|XP_007215458.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16656.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16657.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=413

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWI  F++T +REWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWITQFNQTHNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL++MM+G+K+QKDPRD+LHHGGWMMK+I W LLVIFMFF+PNE++S
Sbjct  80   VLRVSLGNFLFFTILAVMMVGVKSQKDPRDSLHHGGWMMKIISWCLLVIFMFFIPNEIVS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_008228861.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228862.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228863.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228864.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=413

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWI  F++T +REWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWITQFNQTHNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL++MM+G+K+QKDPRD+LHHGGWMMK+I W LLVIFMFF+PNE++S
Sbjct  80   VLRVSLGNFLFFTILAVMMVGVKSQKDPRDSLHHGGWMMKIISWCLLVIFMFFIPNEIVS  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYET  143



>ref|XP_010268463.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=414

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            R+V S ISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFH+TP+REWFETDA
Sbjct  20   RSVASSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINHFHQTPNREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I+MIG+K+QKDPRD LHHGGWM K++CW +LV  MFF+PN ++S
Sbjct  80   VLRVSLGNFLFFTILAILMIGVKDQKDPRDRLHHGGWMTKIVCWCILVFIMFFLPNAIVS  139

Query  533  FYES  544
             YE+
Sbjct  140  SYET  143



>ref|XP_008790112.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
 ref|XP_008778863.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
Length=415

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            R+VV GISRRS+RIAYCGLF  SLIVSWILREVAAP ME +PWINHFH+TPDREWFETDA
Sbjct  20   RSVVGGISRRSSRIAYCGLFAFSLIVSWILREVAAPFMEKLPWINHFHQTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+++M+GIK+QKDPRD LHHGGWM K++ WF+LVI MFFVPN L+S
Sbjct  80   VLRVSLGNFLFFTILALVMVGIKDQKDPRDRLHHGGWMAKIVGWFVLVILMFFVPNGLVS  139

Query  533  FYES  544
             YE+
Sbjct  140  SYET  143



>emb|CDY52849.1| BnaA09g56410D [Brassica napus]
Length=400

 Score =   216 bits (549),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHK+PDREWFETDA
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKSPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MF  P +  +
Sbjct  80   VLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFSFPMKSSA  139

Query  533  F  535
            F
Sbjct  140  F  140



>gb|EAZ24909.1| hypothetical protein OsJ_08689 [Oryza sativa Japonica Group]
Length=414

 Score =   213 bits (543),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RT V  I RRSARIAYCGLF LSL+ SW LREVAAPL+++IPWINHFHKTPDREWFETDA
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLLASWALREVAAPLLQSIPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I+M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++S
Sbjct  80   VLRVSLGNFVFFTILAIIMAGIKDQKDPRDKIHHGGWMAKIFCWVVIVFLMFFVPNGVVS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|NP_001048364.1| Os02g0792900 [Oryza sativa Japonica Group]
 dbj|BAD19186.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAD19654.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAF10278.1| Os02g0792900 [Oryza sativa Japonica Group]
 gb|EAY87831.1| hypothetical protein OsI_09251 [Oryza sativa Indica Group]
 dbj|BAG96913.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97616.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99574.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDREWFETDA
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+I+M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++S
Sbjct  80   VLRVSLGNFVFFTILAIIMAGIKDQKDPRDKIHHGGWMAKIFCWVVIVFLMFFVPNGVVS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|NP_001130490.1| hypothetical protein precursor [Zea mays]
 gb|ACF78724.1| unknown [Zea mays]
 gb|ACN28943.1| unknown [Zea mays]
 gb|AFW73836.1| hypothetical protein ZEAMMB73_916907 [Zea mays]
Length=413

 Score =   211 bits (536),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDREWFETDA
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+++M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++S
Sbjct  80   VLRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWVIIVFLMFFVPNGVVS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_004954190.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=413

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDREWFETDA
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+++M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++S
Sbjct  80   VLRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWAIIVFLMFFVPNGVVS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_002454688.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
 gb|EES07664.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
Length=413

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDREWFETDA
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+++M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++S
Sbjct  80   VLRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWAVIVFLMFFVPNGVVS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>emb|CAN80335.1| hypothetical protein VITISV_009414 [Vitis vinifera]
Length=382

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 117/170 (69%), Gaps = 46/170 (27%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPW-----------------  301
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +P+                 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPYFGCSFIFLRNLLRFLLS  79

Query  302  -----------------------------INHFHKTPDREWFETDAVLRVSLGNFTFFTI  394
                                         INHFHKTP+REWFETDAVLRVS GNF FFTI
Sbjct  80   LLGLKLSLKIKPARVAQLVRANTRKCGPRINHFHKTPNREWFETDAVLRVSFGNFLFFTI  139

Query  395  LSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES  544
            L+I+MIG+KNQKDPRD +HHGGWMMK+ICW +LVIF FF+PNELISFYE+
Sbjct  140  LAILMIGVKNQKDPRDGMHHGGWMMKIICWCILVIFTFFLPNELISFYET  189



>ref|XP_006845424.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
 gb|ERN07099.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
Length=415

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            R+VV GISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHF  TPDREWF+TDA
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFAHTPDREWFQTDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFT+L+++MIG+KNQKDPRD+LHHGGWM+K++ W ++VI MFF+ N ++ 
Sbjct  80   VLRVSLGNFLFFTLLAVIMIGVKNQKDPRDSLHHGGWMVKIVTWCIVVILMFFLSNGIVE  139

Query  533  FYES  544
            FYE+
Sbjct  140  FYEA  143



>gb|ACL54492.1| unknown [Zea mays]
Length=413

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDREWFETDA
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+++M GIK+QKDPRD +HHGGWM K+ CW ++   MFFVPN ++S
Sbjct  80   VLRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWVIIAFLMFFVPNGVVS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>ref|XP_003570284.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=414

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RT V  I RRSARIAYCGLF LSL+ SW+LREVAAPL+++IPWINHFHKTPDREWFETDA
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLLTSWVLREVAAPLLQSIPWINHFHKTPDREWFETDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL+ +M GIK+QKDPRD +HHGGWM K+ CW ++V  MF VPN ++S
Sbjct  80   VLRVSLGNFLFFTILAGIMAGIKDQKDPRDKIHHGGWMAKIFCWAVIVFLMFLVPNGVVS  139

Query  533  FYES  544
            FYES
Sbjct  140  FYES  143



>gb|KEH22798.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=410

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            ARIAYCGLF LSL+V+W+LREVAAPLME+IPWINHF +TP REWFETDAVLRVS GNF F
Sbjct  31   ARIAYCGLFALSLVVAWMLREVAAPLMESIPWINHFKQTPSREWFETDAVLRVSFGNFLF  90

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES  544
            FTIL+ MM+G+K QKDPRD LHHGGWMMK+ICW LLVIFMFF+PNE+ISFYE+
Sbjct  91   FTILAAMMVGVKTQKDPRDGLHHGGWMMKIICWCLLVIFMFFLPNEIISFYET  143



>ref|XP_006649122.1| PREDICTED: probable serine incorporator-like, partial [Oryza 
brachyantha]
Length=384

 Score =   199 bits (507),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            ARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDREWFETDAVLRVSLGNF F
Sbjct  1    ARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFETDAVLRVSLGNFVF  60

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES  544
            FTIL+I+M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++SFYES
Sbjct  61   FTILAIIMAGIKDQKDPRDKIHHGGWMAKIFCWVVIVFLMFFVPNGVVSFYES  113



>gb|EMT13726.1| Putative serine incorporator [Aegilops tauschii]
Length=414

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPW-INHFHKTPDREWFETD  349
            RT V  I RRSARIAYCGLF LSL+ SW+LREVAAPL+++ P  INHFHKTPDREWFETD
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLLASWVLREVAAPLLQSHPHRINHFHKTPDREWFETD  79

Query  350  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  529
            AVLRVSLGNF FFTIL+ +M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++
Sbjct  80   AVLRVSLGNFLFFTILAAIMAGIKDQKDPRDKVHHGGWMAKIFCWVVIVFLMFFVPNGVV  139

Query  530  SFYES  544
            SFYES
Sbjct  140  SFYES  144



>gb|KEH22799.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=427

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 104/130 (80%), Gaps = 17/130 (13%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIP-----------------WINHFHKTPDRE  334
            ARIAYCGLF LSL+V+W+LREVAAPLME+IP                 WINHF +TP RE
Sbjct  31   ARIAYCGLFALSLVVAWMLREVAAPLMESIPCIGAVWIELLELIGVSSWINHFKQTPSRE  90

Query  335  WFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFV  514
            WFETDAVLRVS GNF FFTIL+ MM+G+K QKDPRD LHHGGWMMK+ICW LLVIFMFF+
Sbjct  91   WFETDAVLRVSFGNFLFFTILAAMMVGVKTQKDPRDGLHHGGWMMKIICWCLLVIFMFFL  150

Query  515  PNELISFYES  544
            PNE+ISFYE+
Sbjct  151  PNEIISFYET  160



>ref|XP_011466994.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466995.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466996.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466997.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
Length=414

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = +2

Query  116  MWaasclasccaacacdacRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI  295
            MWAASCLASCCA CAC+ C++ VS ISRRSARIAYC LF  SLI SWILR+VA PL+E I
Sbjct  1    MWAASCLASCCAGCACNLCQSAVSSISRRSARIAYCFLFAFSLIASWILRDVAPPLLEKI  60

Query  296  PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV  475
            PWINHFH+ PDREWFET+AVLRVSLGNF FFTILS++MIG+K+QKDPRD++HHGGWMMKV
Sbjct  61   PWINHFHQIPDREWFETEAVLRVSLGNFLFFTILSVVMIGVKSQKDPRDSIHHGGWMMKV  120

Query  476  ICW-FLLVIFMFFVPNELISFYES  544
            ICW  L++  +FFVPN +ISFYE+
Sbjct  121  ICWFLLVLFSLFFVPNGVISFYET  144



>ref|XP_010255869.1| PREDICTED: probable serine incorporator [Nelumbo nucifera]
Length=416

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGISRRSAR+AYCGLFG SLIVSWILREVAAPLME IPWIN +  TP +EWF+T+A
Sbjct  17   SSVASGISRRSARLAYCGLFGASLIVSWILREVAAPLMEKIPWINTYAHTPSKEWFQTNA  76

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF + +++MIG+K+Q D RD+ HHGGW++K++ W LL+I MFFVPN +I+
Sbjct  77   VLRVSLGNFLFFVVFALVMIGVKDQNDKRDSWHHGGWILKIVVWVLLIILMFFVPNAIIT  136

Query  533  FYES  544
             YE+
Sbjct  137  IYET  140



>gb|ABR16232.1| unknown [Picea sitchensis]
Length=407

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            ++   ++RRSAR+AYCGLFG SLI++WILREVAAPLME IPWIN F  TP +EWF+T AV
Sbjct  12   SLAGTVTRRSARLAYCGLFGFSLIIAWILREVAAPLMEKIPWINDFVHTPTKEWFQTSAV  71

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FFTI ++ MIGIK QKD RD  HHGGW++K+ICW LLV+ MFF+PN +IS 
Sbjct  72   LRVSLGNFLFFTIFAVTMIGIKTQKDIRDGWHHGGWIVKIICWALLVVLMFFLPNSVISV  131

Query  536  YES  544
            YE+
Sbjct  132  YET  134



>gb|ABR17762.1| unknown [Picea sitchensis]
 gb|ABR17907.1| unknown [Picea sitchensis]
Length=417

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            ++V  GISRRSARIAYCGLF LSL V+WI RE+A PLME IPWIN+F +TP REWF+TDA
Sbjct  20   KSVAGGISRRSARIAYCGLFALSLFVAWIFREIAPPLMEKIPWINYFAETPSREWFQTDA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLG+F FF + +++MIG+K+Q+D RD+ HHGGWM K++ W  LV+ MFFVPN LI 
Sbjct  80   VLRVSLGSFLFFAVFALIMIGVKDQRDARDSWHHGGWMAKIMTWCTLVVLMFFVPNGLIG  139

Query  533  FYES  544
             YE+
Sbjct  140  IYET  143



>ref|XP_009391591.1| PREDICTED: serine incorporator 3 [Musa acuminata subsp. malaccensis]
Length=417

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MWaasclasccaacacdacRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI  295
            MWAASCLASCCA C C  C +V +GISRRSAR+ YCGLF LSL++SWILREVAAPL+E I
Sbjct  1    MWAASCLASCCATCTCGLCTSVAAGISRRSARLGYCGLFALSLVISWILREVAAPLLEKI  60

Query  296  PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV  475
            PWIN F   P +EWF+T+AVLRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW++K+
Sbjct  61   PWINTFTHAPPKEWFQTNAVLRVSLGNFLFFAIFALLMIGVKDQNDKRDSWHHGGWIVKI  120

Query  476  ICWFLLVIFMFFVPNELISFYES  544
            I W LL++ MFF+PN +I+ YE+
Sbjct  121  IIWALLIVLMFFLPNIVITIYET  143



>ref|XP_008799134.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=416

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  116  MWaasclasccaacacdacRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI  295
            MWAASCLASCCA+C C  C +V S +SRRSAR+AYCGLF LSLI+SWILREVAAPL+E I
Sbjct  1    MWAASCLASCCASCTCGLCTSVASSMSRRSARLAYCGLFALSLILSWILREVAAPLLEKI  60

Query  296  PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV  475
            PWIN F  TP +EWF+TDAVLRVSLGNF FF I ++MMIG+K+Q D R + HHGGW+ K+
Sbjct  61   PWINTFSHTPSKEWFQTDAVLRVSLGNFLFFAIFALMMIGVKDQNDKRYSWHHGGWIAKI  120

Query  476  ICWFLLVIFMFFVPNELISFYES  544
            + W +L+I MFF+PN +I+ YE+
Sbjct  121  VVWAVLIILMFFLPNIVITIYET  143



>ref|XP_007215456.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16655.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=397

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 16/124 (13%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IP+                A
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPY----------------A  63

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FFTIL++MM+G+K+QKDPRD+LHHGGWMMK+I W LLVIFMFF+PNE++S
Sbjct  64   VLRVSLGNFLFFTILAVMMVGVKSQKDPRDSLHHGGWMMKIISWCLLVIFMFFIPNEIVS  123

Query  533  FYES  544
            FYE+
Sbjct  124  FYET  127



>ref|XP_010246591.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=409

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (84%), Gaps = 4/124 (3%)
 Frame = +2

Query  182  VSGIS--RRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINH-FHKTPDREWFETDA  352
            +SG S  R SARIAYCGLF LSLIVSWIL EVAAP MEN PWI+H F +TP++EWFETDA
Sbjct  16   MSGASCVRLSARIAYCGLFALSLIVSWILGEVAAPPMENHPWIDHNFQQTPNKEWFETDA  75

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRV+LGNF FFTIL+++MIGIK++ D RD LHHGG M K++ W L+VIFMFF+PN + S
Sbjct  76   VLRVNLGNFLFFTILAVLMIGIKDE-DSRDRLHHGGXMTKIVSWCLVVIFMFFLPNGIAS  134

Query  533  FYES  544
            FYE+
Sbjct  135  FYET  138



>ref|XP_001765634.1| predicted protein [Physcomitrella patens]
 gb|EDQ69473.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            + V SGISRRSARIAYCGLF LSLIVSW+LR+ A PL+  IPWIN F  TP  EWF T A
Sbjct  20   QGVASGISRRSARIAYCGLFALSLIVSWLLRDFAGPLLAKIPWINTFTDTPSPEWFATQA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF   +I+MIG+K+Q++ RD+ HHGGWM+K+I W + +I MFF+PN L+S
Sbjct  80   VLRVSLGNFLFFLAFAILMIGVKDQREQRDSWHHGGWMVKLILWCITIILMFFLPNGLVS  139

Query  533  FYES  544
             Y S
Sbjct  140  AYGS  143



>gb|KJB28194.1| hypothetical protein B456_005G040500 [Gossypium raimondii]
Length=291

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 97/122 (80%), Gaps = 2/122 (2%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            TV SGISR+SAR+AYCGLFGLSLIVSWILREV APL+E +PWI     T  + W++  AV
Sbjct  18   TVASGISRKSARLAYCGLFGLSLIVSWILREVGAPLLEKLPWIKS--STQTKTWYQEQAV  75

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LLVI MFF+PN +I+ 
Sbjct  76   LRVSLGNFLFFAILALIMIGVKDQNDRRDSWHHGGWTAKMVIWILLVILMFFLPNVVITV  135

Query  536  YE  541
            YE
Sbjct  136  YE  137



>gb|KDO74827.1| hypothetical protein CISIN_1g039061mg [Citrus sinensis]
Length=399

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFH-KTPDREWFETD  349
             +V SGIS++SAR+AYCGLFGLSLIVSWILREV  PL+E  PWIN     T  +EW++  
Sbjct  17   SSVASGISKKSARLAYCGLFGLSLIVSWILREVGTPLLEKFPWINTSDGDTRTKEWYQIQ  76

Query  350  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  529
            AVLRVSLGNF FF ILS++MIGIK+Q D RD+ HHGGW  K+I W LLV+ MFF+PN +I
Sbjct  77   AVLRVSLGNFLFFGILSLIMIGIKDQNDKRDSWHHGGWCAKIIIWALLVVLMFFLPNVVI  136

Query  530  SFYES  544
            S YE+
Sbjct  137  SIYET  141



>ref|XP_006419802.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
 ref|XP_006489289.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
 gb|ESR33042.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
Length=414

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFH-KTPDREWFETD  349
             +V SGIS++SAR+AYCGLFGLSLIVSWILREV  PL+E  PWIN     T  +EW++  
Sbjct  17   SSVASGISKKSARLAYCGLFGLSLIVSWILREVGTPLLEKFPWINTSDGDTRTKEWYQIQ  76

Query  350  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  529
            AVLRVSLGNF FF ILS++MIGIK+Q D RD+ HHGGW  K+I W LLV+ MFF+PN +I
Sbjct  77   AVLRVSLGNFLFFGILSLIMIGIKDQNDKRDSWHHGGWCAKIIIWALLVVLMFFLPNVVI  136

Query  530  SFYES  544
            S YE+
Sbjct  137  SIYET  141



>gb|KJB28193.1| hypothetical protein B456_005G040500 [Gossypium raimondii]
Length=410

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 97/123 (79%), Gaps = 2/123 (2%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             TV SGISR+SAR+AYCGLFGLSLIVSWILREV APL+E +PWI     T  + W++  A
Sbjct  17   STVASGISRKSARLAYCGLFGLSLIVSWILREVGAPLLEKLPWIKS--STQTKTWYQEQA  74

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LLVI MFF+PN +I+
Sbjct  75   VLRVSLGNFLFFAILALIMIGVKDQNDRRDSWHHGGWTAKMVIWILLVILMFFLPNVVIT  134

Query  533  FYE  541
             YE
Sbjct  135  VYE  137



>ref|XP_009129653.1| PREDICTED: probable serine incorporator [Brassica rapa]
Length=408

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 97/122 (80%), Gaps = 1/122 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGISR+SARIAYCGLFG SL+VSWILRE AAPL+E + WIN    +  +EW++  A
Sbjct  17   SSVASGISRKSARIAYCGLFGASLVVSWILRETAAPLLEKLSWINT-SDSYTKEWYQQQA  75

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPNE+IS
Sbjct  76   VLRVSFGNFLFFAIYALVMIGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNEIIS  135

Query  533  FY  538
             Y
Sbjct  136  IY  137



>ref|XP_002988580.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
 gb|EFJ10376.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
Length=371

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            + V  GISRRSARIAYCGLF LSL+++WILR+   P++E IPWIN F  TP++EWF T A
Sbjct  20   KGVAGGISRRSARIAYCGLFTLSLLLAWILRDFGYPVLEKIPWINSFAHTPNKEWFGTQA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF   +I+MIG+KNQ D RD+ HHGGWM K+I W  +++ MFF+PN L+ 
Sbjct  80   VLRVSLGNFLFFLAFAIVMIGVKNQSDQRDSWHHGGWMAKLILWLTVMVLMFFLPNGLVD  139

Query  533  FYES  544
             Y +
Sbjct  140  AYGA  143



>emb|CDY24707.1| BnaA05g31060D [Brassica napus]
Length=408

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 97/122 (80%), Gaps = 1/122 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGISR+SARIAYCGLFG SL+VSWILRE AAPL+E + WIN    +  +EW++  A
Sbjct  17   SSVASGISRKSARIAYCGLFGASLVVSWILRETAAPLLEKLSWINT-SDSYTKEWYQQQA  75

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPNE+IS
Sbjct  76   VLRVSFGNFLFFAIYALVMIGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNEIIS  135

Query  533  FY  538
             Y
Sbjct  136  IY  137



>ref|XP_002979274.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
 gb|EFJ19682.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
Length=376

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
            + V  GISRRSARIAYCGLF LSL+++WILR+   P++E IPWIN F  TP++EWF T A
Sbjct  20   KGVAGGISRRSARIAYCGLFTLSLLLAWILRDFGYPVLEKIPWINSFAHTPNKEWFGTQA  79

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF   +I+MIG+KNQ D RD+ HHGGWM K+I W  +++ MFF+PN L+ 
Sbjct  80   VLRVSLGNFLFFLAFAIVMIGVKNQSDQRDSWHHGGWMAKLILWLTVMVLMFFLPNGLVD  139

Query  533  FYES  544
             Y +
Sbjct  140  AYGA  143



>ref|NP_187268.2| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAZ23918.1| At3g06170 [Arabidopsis thaliana]
 gb|AEE74356.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=409

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGISR+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN    +  +EW++  A
Sbjct  18   SSVASGISRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWINT-SDSYTKEWYQQQA  76

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S
Sbjct  77   VLRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVS  136

Query  533  FYES  544
             Y +
Sbjct  137  LYGT  140



>emb|CDY05246.1| BnaC05g45570D [Brassica napus]
Length=408

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 96/122 (79%), Gaps = 1/122 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGISR+SARIAYCGLFG SL+VSWILRE AAPL+E  PWIN    +  +EW++  A
Sbjct  17   SSVASGISRKSARIAYCGLFGASLVVSWILRETAAPLLEKFPWINT-SDSYTKEWYQQQA  75

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN +IS
Sbjct  76   VLRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNVIIS  135

Query  533  FY  538
             Y
Sbjct  136  VY  137



>ref|XP_010103434.1| putative serine incorporator [Morus notabilis]
 gb|EXB95837.1| putative serine incorporator [Morus notabilis]
Length=409

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 100/123 (81%), Gaps = 1/123 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGIS++SARIAYCGLFG+SL+VSWILREV APL+E  PWI+   +T  +EW++  AV
Sbjct  18   SVASGISKKSARIAYCGLFGVSLVVSWILREVGAPLLEKFPWISK-SETHTKEWYQIQAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW+ K++ W +LV+ MFF+P+ +ISF
Sbjct  77   LRVSLGNFLFFAIFALIMIGVKDQNDRRDSWHHGGWIAKMVIWLVLVVLMFFIPDAVISF  136

Query  536  YES  544
            Y +
Sbjct  137  YGT  139



>ref|XP_002882452.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58711.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 96/122 (79%), Gaps = 1/122 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGI+R+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN    +  +EW++  A
Sbjct  18   SSVASGITRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWINT-SDSYSKEWYQQQA  76

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S
Sbjct  77   VLRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIAWFLLVVLMFFVPNVIVS  136

Query  533  FY  538
             Y
Sbjct  137  IY  138



>gb|AFK46909.1| unknown [Lotus japonicus]
Length=353

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  284  MENIPWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGW  463
            ME+IPWINHF  TP REWFETDAVLRVSLGNF FFTIL+++M+G+KNQKDPRD LHHGGW
Sbjct  1    MESIPWINHFKHTPSREWFETDAVLRVSLGNFLFFTILAVLMVGVKNQKDPRDGLHHGGW  60

Query  464  MMKVICWFLLVIFMFFVPNELISFYES  544
            MMK+ICWFLLVIFMFF+PNE+ISFYE+
Sbjct  61   MMKIICWFLLVIFMFFLPNEIISFYET  87



>ref|XP_002280143.1| PREDICTED: serine incorporator 3 [Vitis vinifera]
 emb|CBI26177.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGIS+RSAR+AYCGLFG SLIVSWILREVAAPL++ IPWI+   +T   EW++ +A
Sbjct  17   SSVASGISKRSARLAYCGLFGGSLIVSWILREVAAPLLKKIPWIST-SQTHSTEWYQQEA  75

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW+ K++ W LL+I MFFVPN +IS
Sbjct  76   VLRVSLGNFLFFAIFALIMIGVKDQNDRRDSWHHGGWVAKMVIWVLLIILMFFVPNVVIS  135

Query  533  FYES  544
             Y +
Sbjct  136  IYGT  139



>emb|CDO98987.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 97/122 (80%), Gaps = 1/122 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGIS++SAR+AYCGLFGLSLI+SWILREV APL+E  PWIN       +EWF+  A
Sbjct  17   SSVASGISKKSARLAYCGLFGLSLIISWILREVGAPLLEKFPWINT-SDDQSKEWFQIQA  75

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGW +K++ W LLVI MFF+PN +I+
Sbjct  76   VLRVSLGNFLFFGVLALLMIGVKDQNDRRDSWHHGGWTVKMVIWALLVILMFFIPNVVIT  135

Query  533  FY  538
             Y
Sbjct  136  IY  137



>gb|KDP40096.1| hypothetical protein JCGZ_02094 [Jatropha curcas]
Length=401

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 96/122 (79%), Gaps = 1/122 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGIS++SAR+ YCGLFGLSLIVSWILREV APL++ +PWIN    T   EWF+  A
Sbjct  7    SSVASGISKKSARLGYCGLFGLSLIVSWILREVGAPLLKKLPWINS-SDTHSEEWFQIQA  65

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+PN +IS
Sbjct  66   VLRVSLGNFLFFAIFALIMIGVKDQNDKRDSWHHGGWIAKMVIWLLLVVLMFFMPNVIIS  125

Query  533  FY  538
             Y
Sbjct  126  IY  127



>ref|XP_010693925.1| PREDICTED: serine incorporator 3 [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGI+ +SARIAYCGLFG SL+VSWILREVA+PL+E  PWIN+   T  +EW++T  V
Sbjct  18   SVASGITNKSARIAYCGLFGASLVVSWILREVASPLLEKFPWINNADHT--KEWYQTSTV  75

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGWM+K+I W LL++ MFF+PN ++  
Sbjct  76   LRVSLGNFLFFAVLALIMIGVKDQNDKRDSWHHGGWMVKMIIWILLIVLMFFMPNVVVDI  135

Query  536  Y  538
            Y
Sbjct  136  Y  136



>ref|XP_006407970.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49423.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=406

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGISR+SARIAYCGLFG SL+VSWILRE  APL+E  PWIN    T  +EW++  A
Sbjct  17   SSVASGISRKSARIAYCGLFGASLVVSWILRETGAPLLEKFPWINT-SDTYTKEWYQQQA  75

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVS GNF FF I +++M+G+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S
Sbjct  76   VLRVSFGNFLFFAIYALIMVGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNVVVS  135

Query  533  FY  538
             Y
Sbjct  136  IY  137



>ref|XP_008223013.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=411

 Score =   166 bits (421),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGISR+SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+   +T  + W++ DAV
Sbjct  18   SVASGISRKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWISS-SQTHTKGWYQIDAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLVI MFF+P+ +I+ 
Sbjct  77   LRVSLGNFLFFVTFALLMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVILMFFLPDIVITI  136

Query  536  Y  538
            Y
Sbjct  137  Y  137



>ref|XP_007034589.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
 gb|EOY05515.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
Length=410

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 98/124 (79%), Gaps = 2/124 (2%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGIS++SAR+AYCGLFGLSL+VSWILREVAAPL+E +PWIN    T    WF+  A
Sbjct  17   SSVASGISKKSARLAYCGLFGLSLVVSWILREVAAPLLEKLPWINT--STHTEAWFQQQA  74

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGN  FF IL+++MIG+K+Q D RD+ HHGGW+ K++ W LLVI MFF+PN +I+
Sbjct  75   VLRVSLGNCLFFAILALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLVILMFFLPNVVIT  134

Query  533  FYES  544
             Y +
Sbjct  135  VYGT  138



>ref|XP_006297798.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
 gb|EOA30696.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
Length=410

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGISR+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN    +   EW++  A
Sbjct  18   SSVASGISRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWINT-SDSYTTEWYQQQA  76

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S
Sbjct  77   VLRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVS  136

Query  533  FYES  544
             Y +
Sbjct  137  IYGT  140



>ref|XP_010938752.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=416

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  212  IAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTFFT  391
            +AYCG F LSLI++WILREVAAPL+E IPWIN F  TP +EWF+TDAVLRVSLG+F FF 
Sbjct  33   LAYCGFFALSLILAWILREVAAPLLEKIPWINTFTHTPSKEWFQTDAVLRVSLGSFLFFA  92

Query  392  ILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES  544
            I ++MMIG+K+Q D RD+ HHGGW+ K++ W +L++ MFF+PN +I+ YE+
Sbjct  93   IFALMMIGVKDQNDKRDSWHHGGWIAKIVIWVVLIVLMFFLPNIVITIYET  143



>ref|XP_010464184.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=409

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGI+R+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN    +  +EW++  AV
Sbjct  19   SVASGITRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWINT-SDSFTKEWYQQQAV  77

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV  MFFVPN ++S 
Sbjct  78   LRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVALMFFVPNVIVSI  137

Query  536  YES  544
            Y +
Sbjct  138  YGT  140



>ref|XP_007222705.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
 gb|EMJ23904.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
Length=411

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V +GISR+SAR+AYCGLFGLSLIVSWILREV APL++ IPWI+   +T  +EW++ +AV
Sbjct  18   SVAAGISRKSARLAYCGLFGLSLIVSWILREVGAPLLKKIPWISS-SQTHTKEWYQIEAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLVI MFF+P+ +I+ 
Sbjct  77   LRVSLGNFLFFVTFALIMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVILMFFLPDIVITI  136

Query  536  Y  538
            Y
Sbjct  137  Y  137



>ref|XP_010486107.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 97/123 (79%), Gaps = 1/123 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGI+R+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN    +  +EW++  +V
Sbjct  19   SVASGITRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWINT-SDSFTKEWYQQQSV  77

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S 
Sbjct  78   LRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVSI  137

Query  536  YES  544
            Y +
Sbjct  138  YGT  140



>ref|XP_010436570.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGI+R+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN    +  +EW++  AV
Sbjct  19   SVASGITRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWINT-SDSFTKEWYQQQAV  77

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV  MFFVPN ++S 
Sbjct  78   LRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVALMFFVPNVIVSI  137

Query  536  YES  544
            Y +
Sbjct  138  YGT  140



>ref|XP_008340909.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=409

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGIS RSAR+AYCGLFGLSLIVSWILREVAAPL++ IPWI+   +T  + W++T AV
Sbjct  18   SVASGISNRSARLAYCGLFGLSLIVSWILREVAAPLLKKIPWISS-SETHTKVWYQTQAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVS+GNF FFT  +++MIG+K+Q D RD+ HHGGW+ K++ W LLVI MFF+P+ +I+ 
Sbjct  77   LRVSMGNFLFFTAFALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLVILMFFMPDIVITI  136

Query  536  Y  538
            Y
Sbjct  137  Y  137



>ref|XP_010546829.1| PREDICTED: serine incorporator 3 isoform X1 [Tarenaya hassleriana]
Length=410

 Score =   164 bits (414),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGISR+SAR+AYCGLFG SL+VSWILRE AAPL++  PWIN       +EW++  AV
Sbjct  18   SVASGISRKSARLAYCGLFGASLVVSWILREFAAPLLKKFPWINT-SDAYTKEWYQQQAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVS GNF FF + +++MIG+K+Q D RD+ HHGGW++K+I WFLLV  MFFVPN ++S 
Sbjct  77   LRVSFGNFLFFALFALIMIGVKDQNDRRDSWHHGGWVVKMIVWFLLVTLMFFVPNVIVSI  136

Query  536  YES  544
            Y +
Sbjct  137  YGT  139



>ref|XP_010546830.1| PREDICTED: serine incorporator 3 isoform X2 [Tarenaya hassleriana]
Length=409

 Score =   164 bits (414),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGISR+SAR+AYCGLFG SL+VSWILRE AAPL++  PWIN       +EW++  AV
Sbjct  18   SVASGISRKSARLAYCGLFGASLVVSWILREFAAPLLKKFPWINT-SDAYTKEWYQQQAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVS GNF FF + +++MIG+K+Q D RD+ HHGGW++K+I WFLLV  MFFVPN ++S 
Sbjct  77   LRVSFGNFLFFALFALIMIGVKDQNDRRDSWHHGGWVVKMIVWFLLVTLMFFVPNVIVSI  136

Query  536  YES  544
            Y +
Sbjct  137  YGT  139



>ref|XP_010237604.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
 ref|XP_010237605.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=418

 Score =   164 bits (414),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +  S I+RRSAR+AYCGLF  SLI+S++LR+ AAPL+++IPWIN F +TP  EWF+ + V
Sbjct  21   SAASSITRRSARLAYCGLFAASLILSFLLRQFAAPLLQHIPWINTFDETPPEEWFQMNVV  80

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF I ++MMIG+K+Q D RD  HHGGW+ K+  W +L++ MFFVPN +I+ 
Sbjct  81   LRVSLGNFLFFGIFALMMIGVKDQNDRRDAWHHGGWIAKIAVWVVLIVLMFFVPNIVITV  140

Query  536  YE  541
            YE
Sbjct  141  YE  142



>ref|NP_001130812.1| uncharacterized protein LOC100191916 [Zea mays]
 gb|ACF79174.1| unknown [Zea mays]
 gb|ACF82535.1| unknown [Zea mays]
 gb|ACF85768.1| unknown [Zea mays]
 gb|ACG39558.1| serine incorporator 3 [Zea mays]
 tpg|DAA49275.1| TPA: Serine incorporator 3 isoform 1 [Zea mays]
 tpg|DAA49276.1| TPA: Serine incorporator 3 isoform 2 [Zea mays]
Length=415

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +2

Query  116  MWaasclasccaacacdacRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI  295
            MW ASCLAS CA C C+ C +  S +SRRSAR+AYCGLF  SLI+S++LR+ AAPL+++I
Sbjct  1    MWCASCLASACAGCTCNLCTSAASAVSRRSARLAYCGLFAASLILSFLLRQFAAPLLKHI  60

Query  296  PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV  475
            PWIN F +TP  EWF+ +AVLRVSLGNF FF I S++MIG+K+Q D RD  HHGGW+ K+
Sbjct  61   PWINAFDQTPPEEWFQMNAVLRVSLGNFLFFAIFSLVMIGVKDQNDRRDAWHHGGWIAKI  120

Query  476  ICWFLLVIFMFFVPNELISFYE  541
              W +L++ MF VPN +I+ YE
Sbjct  121  AVWAVLIVLMFCVPNIVITIYE  142



>ref|XP_002466928.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
 gb|EER93926.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
Length=415

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = +2

Query  116  MWaasclasccaacacdacRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI  295
            MW ASCLAS CA C C+ C +  S +SRRSAR+AYCGLF  SLI+S++LR+ AAPL+++I
Sbjct  1    MWCASCLASACAGCTCNLCASAASAVSRRSARLAYCGLFAASLILSFLLRQFAAPLLKHI  60

Query  296  PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV  475
            PWIN F +TP  EWF+ +AVLRVSLGNF FF   ++MMIG+K+Q D RD  HHGGW+ KV
Sbjct  61   PWINAFDQTPPEEWFQMNAVLRVSLGNFLFFATFALMMIGVKDQNDRRDAWHHGGWIAKV  120

Query  476  ICWFLLVIFMFFVPNELISFYE  541
              W +L++ MF VPN +I+ YE
Sbjct  121  AVWAVLIVLMFCVPNIVITIYE  142



>ref|XP_010322266.1| PREDICTED: serine incorporator 3 [Solanum lycopersicum]
Length=411

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SG++R SAR+AYCGLFG+SLIVSW++REVA+PL++N  WIN       +EWF+  AV
Sbjct  18   SVASGVTRSSARLAYCGLFGVSLIVSWVIREVASPLLKNFSWINT-SDNLSKEWFQAQAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF +L+++MIGIK+Q D RD LHHGGW+ K++ W LLV  MFF+PN +I+ 
Sbjct  77   LRVSLGNFLFFGVLALIMIGIKDQNDRRDCLHHGGWVAKLVIWVLLVALMFFLPNGVITI  136

Query  536  Y  538
            Y
Sbjct  137  Y  137



>ref|XP_006356686.1| PREDICTED: serine incorporator 3-like [Solanum tuberosum]
Length=409

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SG++R SAR+AYCGLFG+SLIVSW+LREVA+PL++N  WIN       +EWF+  AV
Sbjct  18   SVASGVTRSSARLAYCGLFGVSLIVSWVLREVASPLLKNFSWINT-SDNLSKEWFQAQAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF +L+++MIGIK+Q D RD+ HHGGW+ K++ W LLV  MFF+PN +I+ 
Sbjct  77   LRVSLGNFLFFGVLALIMIGIKDQNDRRDSWHHGGWVAKLVIWVLLVALMFFLPNGVITI  136

Query  536  Y  538
            Y
Sbjct  137  Y  137



>ref|XP_004982576.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=415

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +2

Query  116  MWaasclasccaacacdacRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI  295
            MW ASCLAS CA CAC+ C +  S +SRRSAR+AYCGLF  SLI+S++LR+ A PL+++I
Sbjct  1    MWCASCLASACAGCACNLCTSAASAVSRRSARLAYCGLFAASLILSFLLRQFATPLLKHI  60

Query  296  PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV  475
            PWIN F  TP  EWF+ +AVLRVSLGNF FF I +IMMIGIK+Q D RD  HHGGW+ K+
Sbjct  61   PWINAFEHTPPDEWFQMNAVLRVSLGNFLFFAIFAIMMIGIKDQNDRRDAWHHGGWVAKI  120

Query  476  ICWFLLVIFMFFVPNELISFYE  541
              W +L++ MF VPN + + YE
Sbjct  121  AVWAVLIVLMFCVPNIVTTIYE  142



>ref|XP_008458551.1| PREDICTED: serine incorporator 3 [Cucumis melo]
Length=411

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 93/122 (76%), Gaps = 2/122 (2%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V +GISR SAR+AYCGLFG+SL+VSWILRE  APLME +PWI    +   +EWF+  A
Sbjct  17   SSVAAGISRSSARLAYCGLFGVSLVVSWILREFGAPLMEKMPWIET--EGQPKEWFQMQA  74

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF IL+++MIG+K+Q D RD  HHGGWM K++ W L V+ MFF+PN + S
Sbjct  75   VLRVSLGNFLFFAILALIMIGVKDQNDRRDAWHHGGWMAKMVIWILFVVLMFFLPNVIFS  134

Query  533  FY  538
             Y
Sbjct  135  IY  136



>ref|XP_004150322.1| PREDICTED: serine incorporator 3-like [Cucumis sativus]
 gb|KGN47263.1| hypothetical protein Csa_6G238640 [Cucumis sativus]
Length=411

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 93/122 (76%), Gaps = 2/122 (2%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V +GISR SAR+AYCGLFG+SL+VSWILRE  AP+ME +PWI    +    EWF+  A
Sbjct  17   SSVAAGISRSSARLAYCGLFGVSLVVSWILREFGAPIMEKMPWIKT--EGQPEEWFQMQA  74

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF IL+++MIG+K+Q D RD  HHGGWM K++ W LLV+ MFF+PN + S
Sbjct  75   VLRVSLGNFLFFAILALIMIGVKDQNDRRDAWHHGGWMAKMVIWILLVVLMFFLPNVIFS  134

Query  533  FY  538
             Y
Sbjct  135  IY  136



>ref|XP_004169518.1| PREDICTED: LOW QUALITY PROTEIN: serine incorporator 3-like [Cucumis 
sativus]
Length=411

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 92/122 (75%), Gaps = 2/122 (2%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V +GISR SAR+AYCGLFG+SL+VSWILRE  AP+ME +PWI    +    EWF+  A
Sbjct  17   SSVAAGISRSSARLAYCGLFGVSLVVSWILREFGAPIMEKMPWIKT--EGQPEEWFQMQA  74

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF IL+++MIG+K+Q D RD  HHGGWM K++ W LLV+ MFF PN + S
Sbjct  75   VLRVSLGNFLFFAILALIMIGVKDQNDRRDAWHHGGWMAKMVIWILLVVLMFFXPNVIFS  134

Query  533  FY  538
             Y
Sbjct  135  IY  136



>ref|XP_011090806.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=411

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGI++RSARIAYCGLFG+SLIVSWILREVAAPL+++  WIN       +EWF+  AV
Sbjct  18   SVASGITKRSARIAYCGLFGVSLIVSWILREVAAPLLKHFSWINT-SDNLSKEWFQIQAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF IL+++MIG+K+Q D RD+ HH GW+ K++ W LL+I MFF+PN +I+ 
Sbjct  77   LRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHDGWIAKMLIWALLIILMFFLPNVIITV  136

Query  536  Y  538
            Y
Sbjct  137  Y  137



>ref|XP_009623079.1| PREDICTED: probable serine incorporator [Nicotiana tomentosiformis]
Length=408

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SG++R SAR+AYC LFG+SLIVSW+LREVA+PL++N  WIN       +EWF+  AV
Sbjct  18   SVASGVTRSSARLAYCALFGVSLIVSWVLREVASPLLKNFSWINT-SDNYSKEWFQAQAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGW+ K++ W LLV  MFF+PN +I+ 
Sbjct  77   LRVSLGNFLFFGLLALIMIGVKDQNDKRDSWHHGGWVAKLVIWMLLVALMFFLPNGVITV  136

Query  536  YE  541
            Y 
Sbjct  137  YS  138



>ref|XP_009799680.1| PREDICTED: probable serine incorporator [Nicotiana sylvestris]
Length=408

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SG++R SAR+AYC LFG+SLIVSW+LREVA+PL++N  WIN       +EWF+  AV
Sbjct  18   SVASGVTRSSARLAYCALFGVSLIVSWVLREVASPLLKNFSWINT-SDNYSKEWFQAQAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGW+ K++ W LLV  MFF+PN +I+ 
Sbjct  77   LRVSLGNFLFFGLLALIMIGVKDQNDKRDSWHHGGWVAKLVIWVLLVALMFFLPNGVITV  136

Query  536  YE  541
            Y 
Sbjct  137  YS  138



>gb|KCW60869.1| hypothetical protein EUGRSUZ_H03603 [Eucalyptus grandis]
Length=383

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 100/124 (81%), Gaps = 2/124 (2%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V  GIS+RSAR+AYCGLFGLSLIVSW+LREVAAPL+E I WIN    T  + WF+  A
Sbjct  17   SSVAGGISKRSARLAYCGLFGLSLIVSWVLREVAAPLLEKISWINTGSHT--KAWFQMQA  74

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF IL+++MIG+K+Q D RD++ HGGW+ K+I W LLV+ MFF+PNE+I+
Sbjct  75   VLRVSLGNFLFFGILALIMIGVKDQNDKRDSMQHGGWIAKMIIWLLLVVLMFFLPNEVIT  134

Query  533  FYES  544
             YE+
Sbjct  135  IYET  138



>ref|XP_010024424.1| PREDICTED: serine incorporator 3 [Eucalyptus grandis]
 gb|KCW60868.1| hypothetical protein EUGRSUZ_H03603 [Eucalyptus grandis]
Length=416

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 100/124 (81%), Gaps = 2/124 (2%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V  GIS+RSAR+AYCGLFGLSLIVSW+LREVAAPL+E I WIN    T  + WF+  A
Sbjct  17   SSVAGGISKRSARLAYCGLFGLSLIVSWVLREVAAPLLEKISWINTGSHT--KAWFQMQA  74

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF IL+++MIG+K+Q D RD++ HGGW+ K+I W LLV+ MFF+PNE+I+
Sbjct  75   VLRVSLGNFLFFGILALIMIGVKDQNDKRDSMQHGGWIAKMIIWLLLVVLMFFLPNEVIT  134

Query  533  FYES  544
             YE+
Sbjct  135  IYET  138



>ref|XP_002516786.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF45400.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=414

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGIS++SAR+AYCGLFGLSLIVSWILRE  APL+E +PWI     T  +EWF+  AV
Sbjct  21   SVASGISKKSARLAYCGLFGLSLIVSWILREFGAPLIEKLPWIKS-SVTHSKEWFQIQAV  79

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW+ K++ W LL++ MFF+PN +I+ 
Sbjct  80   LRVSLGNFLFFAIFALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLLVLMFFMPNVVIAI  139

Query  536  Y  538
            Y
Sbjct  140  Y  140



>ref|XP_006650244.1| PREDICTED: probable serine incorporator-like [Oryza brachyantha]
Length=417

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = +2

Query  116  MWaasclasccaacacdacRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI  295
            MW ASCLAS CA C C+ C +  S ISRRSAR+AYCGLF  SL++S++ R+ A PL++ I
Sbjct  1    MWCASCLASACAGCTCNLCASAASAISRRSARLAYCGLFAASLVLSFLTRQFATPLLKQI  60

Query  296  PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV  475
            PWIN F      EWF+ +AVLRVSLGNF FF I ++MMIG+K+Q D RD  HHGGW+ K+
Sbjct  61   PWINTFDYVQPDEWFQMNAVLRVSLGNFLFFAIFALMMIGVKDQNDQRDAWHHGGWIAKI  120

Query  476  ICWFLLVIFMFFVPNELISFYE  541
            + W +L + MF VPN +I+ YE
Sbjct  121  VVWAVLTVLMFCVPNIVITIYE  142



>gb|EPS68630.1| hypothetical protein M569_06136 [Genlisea aurea]
Length=410

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 91/121 (75%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGI+ RSARI YCGLFG SLIVSW+LREV  P++ ++ WIN     P +EWF+  AV
Sbjct  18   SVASGITNRSARIGYCGLFGASLIVSWVLREVGEPILRHLSWINTSDHLP-KEWFQVQAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF +L++ MIG+K+Q D RD+LH GGW+ K + W LL++ MFFVPN + + 
Sbjct  77   LRVSLGNFLFFAVLALTMIGVKHQNDKRDSLHRGGWIAKFLIWALLIVLMFFVPNAVTNI  136

Query  536  Y  538
            Y
Sbjct  137  Y  137



>gb|EYU43840.1| hypothetical protein MIMGU_mgv1a006662mg [Erythranthe guttata]
Length=436

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 93/121 (77%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGI++RSARI YCGLFG+SLIVSWILRE A P+++++ WIN       +EW++  AV
Sbjct  43   SVASGITKRSARIGYCGLFGVSLIVSWILREFAQPVLKHLSWINT-SDNLSKEWYQMQAV  101

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF IL+++MIGIK Q D RD  HH GW++K++ W  L+I MFF+PN +IS 
Sbjct  102  LRVSLGNFLFFAILAVIMIGIKYQNDKRDFFHHEGWIVKIVIWTTLIILMFFLPNAVISV  161

Query  536  Y  538
            Y
Sbjct  162  Y  162



>ref|XP_004486156.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=409

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 92/122 (75%), Gaps = 1/122 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGIS++SARI YC LFG SLI+SWILREV APL+E +PWI+    T  +EW++  A
Sbjct  17   SSVASGISQKSARIGYCFLFGASLIISWILREVGAPLLEKLPWIDS-SDTHTKEWYQVQA  75

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGW +K + W LL++  FF+P+ +  
Sbjct  76   VLRVSLGNFLFFVVLALIMIGVKDQNDRRDSWHHGGWTVKTVIWLLLIVLAFFIPDAVTL  135

Query  533  FY  538
             Y
Sbjct  136  AY  137



>gb|ACJ84561.1| unknown [Medicago truncatula]
 gb|AFK35204.1| unknown [Medicago truncatula]
 gb|KEH36756.1| TMS membrane protein/tumor differentially protein [Medicago truncatula]
Length=409

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 92/121 (76%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGIS++SARI YC LFG SLIVSWILREV APL+E IPWI+    T  +EW++  AV
Sbjct  18   SVASGISQKSARIGYCFLFGASLIVSWILREVGAPLLEKIPWIDS-SDTHTKEWYQVQAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            L VSLGN  FF +L+++MIG+K+Q D RD+ HHGGW +K++ W LL++  FF+P+ ++  
Sbjct  77   LHVSLGNCLFFVVLALIMIGVKDQNDKRDSWHHGGWTVKIVIWLLLIVLAFFIPDSIMLA  136

Query  536  Y  538
            Y
Sbjct  137  Y  137



>ref|XP_009365799.1| PREDICTED: probable serine incorporator isoform X1 [Pyrus x bretschneideri]
Length=411

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGIS +SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+   +T  +EW++T+AV
Sbjct  18   SVASGISSKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWISS-SETHTKEWYQTEAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVS+GNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P+ +I+ 
Sbjct  77   LRVSMGNFLFFAAFALVMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMPDIVITI  136

Query  536  Y  538
            Y
Sbjct  137  Y  137



>ref|XP_009365800.1| PREDICTED: probable serine incorporator isoform X2 [Pyrus x bretschneideri]
Length=409

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGIS +SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+   +T  +EW++T+AV
Sbjct  18   SVASGISSKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWISS-SETHTKEWYQTEAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVS+GNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P+ +I+ 
Sbjct  77   LRVSMGNFLFFAAFALVMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMPDIVITI  136

Query  536  Y  538
            Y
Sbjct  137  Y  137



>ref|XP_009342179.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=411

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGIS +SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+   +T  +EW++T+AV
Sbjct  18   SVASGISSKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWISS-SETHTKEWYQTEAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVS+GNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P+ +I+ 
Sbjct  77   LRVSMGNFLFFAAFALVMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMPDIVITI  136

Query  536  Y  538
            Y
Sbjct  137  Y  137



>ref|XP_008390818.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=411

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGIS +SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+   +T  +EW++T+AV
Sbjct  18   SVASGISSKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWISS-SETHTKEWYQTEAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVS+GNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P+ +I+ 
Sbjct  77   LRVSMGNFLFFAAFALIMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMPDIVITI  136

Query  536  Y  538
            Y
Sbjct  137  Y  137



>ref|XP_002312742.1| TMS membrane family protein [Populus trichocarpa]
 gb|EEE90109.1| TMS membrane family protein [Populus trichocarpa]
Length=417

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGIS RSAR+AYCGLFG SLI+SWILREVAAPL+E IPWI      P +EW++  AV
Sbjct  22   SVASGISNRSARLAYCGLFGTSLILSWILREVAAPLLEKIPWIKSSGTHP-KEWYQIQAV  80

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVS+GNF FF +L+++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P+ +IS 
Sbjct  81   LRVSMGNFLFFAVLALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLVVLMFFLPDSVISV  140

Query  536  Y  538
            Y
Sbjct  141  Y  141



>ref|XP_011010290.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=417

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +V SGIS RSAR+AYCGLFG SLI+SWILREVAAPL+E IPWI      P +EW++  AV
Sbjct  22   SVASGISNRSARLAYCGLFGASLILSWILREVAAPLLEKIPWIKSSGTHP-KEWYQIQAV  80

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVS+GNF FF IL+++MIG+K++ D RD+ HHGGW+ K++ W LLV+ MFF+P+ +IS 
Sbjct  81   LRVSMGNFLFFAILALIMIGVKDKNDRRDSWHHGGWIAKMVIWLLLVVLMFFLPDSVISV  140

Query  536  Y  538
            Y
Sbjct  141  Y  141



>gb|ABF97020.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=372

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +2

Query  116  MWaasclasccaacacdacRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI  295
            MW ASCLAS CA C C+ C + +S ISRRSAR+AYCGLF  SLI+S+++R+ A PL++ I
Sbjct  1    MWCASCLASACAGCTCNLCASALSAISRRSARLAYCGLFAASLILSFLMRQFATPLLKQI  60

Query  296  PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV  475
            PWIN F  T   EWF+ +AVLRVSLGNF FF I ++MMIG+K+Q D RD  HHGGW+ K+
Sbjct  61   PWINTFDYTQPDEWFQMNAVLRVSLGNFLFFAIFALMMIGVKDQNDRRDAWHHGGWIAKI  120

Query  476  ICWFLLVIFMFFVPNELISFYE  541
            + W +L++ MF VPN +I+ YE
Sbjct  121  VVWVVLIVLMFCVPNVVITIYE  142



>ref|NP_001050476.1| Os03g0454100 [Oryza sativa Japonica Group]
 gb|AAO73245.1| putative membrane protein [Oryza sativa Japonica Group]
 gb|ABF97019.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12390.1| Os03g0454100 [Oryza sativa Japonica Group]
 dbj|BAG90227.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75563.1| hypothetical protein OsI_12232 [Oryza sativa Indica Group]
 gb|EEE59340.1| hypothetical protein OsJ_11423 [Oryza sativa Japonica Group]
Length=417

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +2

Query  116  MWaasclasccaacacdacRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI  295
            MW ASCLAS CA C C+ C + +S ISRRSAR+AYCGLF  SLI+S+++R+ A PL++ I
Sbjct  1    MWCASCLASACAGCTCNLCASALSAISRRSARLAYCGLFAASLILSFLMRQFATPLLKQI  60

Query  296  PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV  475
            PWIN F  T   EWF+ +AVLRVSLGNF FF I ++MMIG+K+Q D RD  HHGGW+ K+
Sbjct  61   PWINTFDYTQPDEWFQMNAVLRVSLGNFLFFAIFALMMIGVKDQNDRRDAWHHGGWIAKI  120

Query  476  ICWFLLVIFMFFVPNELISFYE  541
            + W +L++ MF VPN +I+ YE
Sbjct  121  VVWVVLIVLMFCVPNVVITIYE  142



>ref|XP_006595390.1| PREDICTED: probable serine incorporator-like [Glycine max]
Length=375

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +  S IS++SARI YCGLFG+SL+VSWILREV APL+E  PWI     T   EW++  AV
Sbjct  18   STASCISQKSARIGYCGLFGVSLVVSWILREVGAPLLEKFPWIGGTSDTNTTEWYQAQAV  77

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LLV+  FF+P+ +I  
Sbjct  78   LRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHGGWTAKIVIWLLLVVLAFFLPDAIILV  137

Query  536  Y  538
            Y
Sbjct  138  Y  138



>dbj|BAJ86142.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99044.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = +2

Query  116  MWaasclasccaacacdacRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI  295
            MW ASCLAS CA CAC+ C +  + ++RRSAR+AYCGLF  SLI+S++LR+ AAPL+++I
Sbjct  1    MWCASCLASACAGCACNLCSSAAASVTRRSARLAYCGLFAASLILSFLLRQFAAPLLQHI  60

Query  296  PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV  475
            PWIN F  TP  EWF+ +AVLR+SLGNF FF I ++ MIG+K+Q D RD  HHGGW+ K 
Sbjct  61   PWINTFDHTPPEEWFQMNAVLRLSLGNFLFFAIFALTMIGVKDQNDRRDAWHHGGWIAKF  120

Query  476  ICWFLLVIFMFFVPNELISFYE  541
              W +LV+ MFFVPN ++S YE
Sbjct  121  AIWVVLVVLMFFVPNIVVSVYE  142



>ref|XP_004296950.1| PREDICTED: probable serine incorporator [Fragaria vesca subsp. 
vesca]
Length=409

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 97/122 (80%), Gaps = 1/122 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGIS +SAR+ YCGLFGLSL+V+WILREV APL+E IPWI+   +T  + W++T A
Sbjct  17   SSVASGISSKSARLGYCGLFGLSLVVTWILREVGAPLLEKIPWISS-SETHTKAWYQTQA  75

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            VLRVS+GNF FF IL+++MIG+K++ D RD  HHGGW+ K++ W LL+I MFF+P+ +I+
Sbjct  76   VLRVSMGNFLFFAILALIMIGVKDRNDRRDGWHHGGWIAKMVIWLLLIILMFFLPDIVIT  135

Query  533  FY  538
             Y
Sbjct  136  IY  137



>gb|KHN37564.1| Putative serine incorporator [Glycine soja]
Length=407

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            +  S IS++SARI YCGLFG+SL+VSWILREV APL+E  PWI     T   EW++  AV
Sbjct  18   STASCISQKSARIGYCGLFGVSLVVSWILREVGAPLLEKFPWIGGTSDTNTTEWYQAQAV  77

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LLV+  FF+P+ +I  
Sbjct  78   LRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHGGWTAKIVIWLLLVVLAFFLPDAIILV  137

Query  536  YE  541
            Y 
Sbjct  138  YA  139



>ref|XP_007147778.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
 gb|ESW19772.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
Length=409

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 91/121 (75%), Gaps = 1/121 (1%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV  355
            + VS IS++SARI YCGLFG SLIVSWILREV APL+E  PWI     T  ++W++  AV
Sbjct  18   STVSCISQKSARIGYCGLFGASLIVSWILREVGAPLLEKFPWIGS-SDTHTKDWYQVQAV  76

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LL++  FF+P+ +I  
Sbjct  77   LRVSLGNFLFFGILALLMIGVKDQNDRRDSWHHGGWPAKLVVWLLLLVLAFFLPDAIILV  136

Query  536  Y  538
            Y
Sbjct  137  Y  137



>gb|AFK34472.1| unknown [Lotus japonicus]
Length=256

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA  352
             +V SGIS++SARI YC LFG SL+VSWI RE+ APL+E IPWI+    T  +EW++  A
Sbjct  17   SSVASGISQKSARIGYCFLFGASLVVSWIFREIGAPLLEKIPWIDS-SDTHTKEWYQVQA  75

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGW  463
            VLRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW
Sbjct  76   VLRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHGGW  112



>ref|XP_006366267.1| PREDICTED: cell wall integrity and stress response component 
4-like isoform X2 [Solanum tuberosum]
Length=122

 Score =   117 bits (294),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 65/88 (74%), Gaps = 8/88 (9%)
 Frame = +2

Query  266  EVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDN  445
            EVAA LME I  IN FH T  REWFETDAVL+VSLGNF FFTIL+I+MIG+K+QKDPRD 
Sbjct  2    EVAAFLMEKIRGINSFHTTLSREWFETDAVLQVSLGNFLFFTILAILMIGVKSQKDPRDG  61

Query  446  LHHGGWMMK--------VICWFLLVIFM  505
            +HHGGWMMK          CW L ++ M
Sbjct  62   VHHGGWMMKSFVGASWLYCCWILCIVGM  89



>ref|XP_005651318.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
 gb|EIE26774.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
Length=429

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = +2

Query  197  RRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHF--HKTPDREWFETDAVLRVSL  370
            R+SAR+AYC LF L+++++WILR+ A P+++ +PWI H   H  P  +W+   AV RVS+
Sbjct  8    RKSARLAYCILFTLAMVLAWILRDFAKPIIDKLPWIIHAMGHGEPSAKWYGQQAVYRVSM  67

Query  371  GNFTFFTILSIMMIGIKNQKDPRDN-LHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            GNF FF ++S+ M+G+K + D RD  L HGGW +KV  W L  I  FF P   ++ Y
Sbjct  68   GNFIFFGLMSLAMVGVKYKSDKRDQYLQHGGWFLKVALWLLFNILPFFFPVSFVNGY  124



>tpg|DAA49274.1| TPA: hypothetical protein ZEAMMB73_017777 [Zea mays]
Length=359

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  284  MENIPWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGW  463
            M  I  IN F +TP  EWF+ +AVLRVSLGNF FF I S++MIG+K+Q D RD  HHGGW
Sbjct  1    MYCIAGINAFDQTPPEEWFQMNAVLRVSLGNFLFFAIFSLVMIGVKDQNDRRDAWHHGGW  60

Query  464  MMKVICWFLLVIFMFFVPNELISFYE  541
            + K+  W +L++ MF VPN +I+ YE
Sbjct  61   IAKIAVWAVLIVLMFCVPNIVITIYE  86



>ref|XP_011397622.1| putative serine incorporator [Auxenochlorella protothecoides]
 gb|KFM24734.1| putative serine incorporator [Auxenochlorella protothecoides]
Length=435

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 75/118 (64%), Gaps = 4/118 (3%)
 Frame = +2

Query  200  RSARIAYCGLFGLSLIVSWILREVAAPLMENIPWI-NHFHKT--PDREWFETDAVLRVSL  370
            RSAR+A+  LF LS+I++WILR+ A PL+  IPWI   F+K   P  EWF   AV R+SL
Sbjct  33   RSARLAWSFLFTLSMILAWILRDFAKPLLMKIPWIVKSFNKGSMPSDEWFGAQAVYRISL  92

Query  371  GNFTFFTILSIMMIGIKNQKDPRD-NLHHGGWMMKVICWFLLVIFMFFVPNELISFYE  541
            GN   F  L+++M+G+K   D RD  LHHG W++K   W + ++  F +P  +I+ Y 
Sbjct  93   GNLLLFGSLALVMMGVKRTSDRRDTQLHHGSWLIKAALWTVCILLPFLLPPSVINAYS  150



>ref|XP_002506090.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67348.1| predicted protein [Micromonas sp. RCC299]
Length=433

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 70/119 (59%), Gaps = 2/119 (2%)
 Frame = +2

Query  191  ISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHK-TPDREWFETDAVLRVS  367
            +S  SAR  Y  +FGL + ++ ++R+ A P+M  IPWI       P  EWF   AV RVS
Sbjct  28   VSSISARAVYTVIFGLGMGIAVVMRDYAKPMMMEIPWIGVVPGMQPSDEWFGQSAVYRVS  87

Query  368  LGNFTFFTILSIMMIGIKNQKDPRD-NLHHGGWMMKVICWFLLVIFMFFVPNELISFYE  541
            LGNF FF  LS M++  K + DPRD ++HHG W +K+  W L VI  F +P+  I  Y 
Sbjct  88   LGNFMFFGGLSAMLVDCKTRSDPRDRHIHHGSWTLKLAAWALCVIVPFLLPDGFIDAYA  146



>gb|KIZ05916.1| putative serine incorporator [Monoraphidium neglectum]
Length=447

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 73/124 (59%), Gaps = 3/124 (2%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHK--TPDREWFETD  349
            TV     RRSAR+AY  LF L++++SW  R++A PL+E IPWI        P  +WF   
Sbjct  25   TVTRETMRRSARLAYSFLFFLAILISWAGRDLAKPLIEKIPWIMRAATGFEPSDKWFGQQ  84

Query  350  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDN-LHHGGWMMKVICWFLLVIFMFFVPNEL  526
            AV R+S+G+F FF  +S+ ++G++ + D R   LH G W  K+  W + +   FF PN L
Sbjct  85   AVYRISMGSFLFFGTMSLALLGVRTKGDKRGAYLHQGNWAAKLAAWLVFIALPFFFPNGL  144

Query  527  ISFY  538
            +  Y
Sbjct  145  VVAY  148



>ref|XP_001696805.1| hypothetical protein CHLREDRAFT_192111 [Chlamydomonas reinhardtii]
 gb|EDP00913.1| predicted protein [Chlamydomonas reinhardtii]
Length=211

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = +2

Query  191  ISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWI-NHFHKTPDREWFETDAVLRVS  367
            + R SAR+A+  LF L++I++W+LR+ A P++E IPWI     +    +WF   AV RVS
Sbjct  30   VLRHSARVAWSVLFFLAMILAWVLRDFATPILEKIPWIVKDVTQVDMDKWFGQQAVYRVS  89

Query  368  LGNFTFFTILSIMMIGIKNQKDPRDN-LHHGGWMMKVICWFLLVIFMFFVPNELISFYE  541
            +GNF FF  +S+ ++G+K + D RD  LHHG  + K+  W L     F  PNE+++ Y 
Sbjct  90   MGNFLFFGCMSLALLGVKQRGDKRDAYLHHGHPLAKLGLWLLFTCLPFLFPNEVLNVYS  148



>gb|KCW70853.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=316

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  404  MMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES  544
            MMIG+KNQ+DPRD +HHGGWMMK+ICW LLVIFMFF+PNE+ISFYES
Sbjct  1    MMIGVKNQRDPRDGIHHGGWMMKIICWCLLVIFMFFLPNEIISFYES  47



>ref|XP_006850791.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
 gb|ERN12372.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
Length=339

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  350  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  529
            AVLRVSLGNF FFTI +++MIG+K+Q D RD+ HHGGW+ K+I W LLVI MFF+PN + 
Sbjct  3    AVLRVSLGNFLFFTIFALIMIGVKDQNDRRDSWHHGGWITKIIVWSLLVILMFFLPNAVF  62

Query  530  SFY  538
            + Y
Sbjct  63   NMY  65



>ref|XP_005850950.1| hypothetical protein CHLNCDRAFT_48549 [Chlorella variabilis]
 gb|EFN58848.1| hypothetical protein CHLNCDRAFT_48549 [Chlorella variabilis]
Length=367

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 71/122 (58%), Gaps = 7/122 (6%)
 Frame = +2

Query  197  RRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWI-NHF--HKTPDREWFETDAVLRVS  367
            R SAR A+  LF  SL+ +WI R+  + L++ +PWI  HF   + P   WF   AV R+S
Sbjct  29   RSSARAAWSILFTFSLVGAWIARDFGSALLKKLPWILRHFGGGEMPSDAWFGQQAVYRIS  88

Query  368  LGNF---TFFTILSIMMIGIKNQKDPRD-NLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LGNF     F  L+++M G++++ D RD +LHHG W++K   W L     FF+P  ++  
Sbjct  89   LGNFVSGVLFGALAVVMAGVQHKSDRRDRSLHHGHWLLKAGLWALCNALPFFLPVGVVGA  148

Query  536  YE  541
            Y 
Sbjct  149  YS  150



>ref|XP_008673654.1| PREDICTED: uncharacterized protein LOC100191916 isoform X1 [Zea 
mays]
Length=339

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  347  DAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNEL  526
            +AVLRVSLGNF FF I S++MIG+K+Q D RD  HHGGW+ K+  W +L++ MF VPN +
Sbjct  2    NAVLRVSLGNFLFFAIFSLVMIGVKDQNDRRDAWHHGGWIAKIAVWAVLIVLMFCVPNIV  61

Query  527  ISFYE  541
            I+ YE
Sbjct  62   ITIYE  66



>ref|XP_003062471.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53290.1| predicted protein [Micromonas pusilla CCMP1545]
Length=442

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 68/121 (56%), Gaps = 8/121 (7%)
 Frame = +2

Query  179  VVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVL  358
            V   +++ SAR  Y  +F +S  +++++R+ A PL++ IPWI               AV 
Sbjct  21   VGDAVAKTSARALYVVMFAISTALAFVMRDCAQPLLKRIPWIARLATM-------NYAVY  73

Query  359  RVSLGNFTFFTILSIMMIGIKNQKDPRD-NLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            R+SLGNF FF  ++  ++G+K + D RD +LHHG W++K   W L  +  FF  N ++  
Sbjct  74   RISLGNFIFFGAMACALVGVKRRSDARDVHLHHGSWVLKFTAWALCNVLPFFASNGVVGA  133

Query  536  Y  538
            Y
Sbjct  134  Y  134



>ref|XP_002956760.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
 gb|EFJ42217.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
Length=415

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 71/117 (61%), Gaps = 2/117 (2%)
 Frame = +2

Query  197  RRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE-WFETDAVLRVSLG  373
            R SAR+A+  LF L++IV+WILR+ A P+++ IPWI       D + WF   AV RVS+G
Sbjct  32   RHSARVAWSVLFFLAMIVAWILRDFATPILQKIPWIVKDVTAVDMDKWFGQQAVYRVSMG  91

Query  374  NFTFFTILSIMMIGIKNQKDPRDN-LHHGGWMMKVICWFLLVIFMFFVPNELISFYE  541
            NF FF  +S+  IG+K + D RD  LHH   ++K+  W L     F  PN +++ Y 
Sbjct  92   NFLFFACMSLATIGVKFRGDKRDRYLHHAHPLLKLALWLLFTALPFLFPNGVLNAYS  148



>ref|XP_004302121.1| PREDICTED: serine incorporator 3-like [Fragaria vesca subsp. 
vesca]
Length=246

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = +2

Query  407  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIF-MFFVPNELISFYES  544
            MIG+K QKDPRD++HHGGWMMKV CWFLLV+F ++FVPN  ISFYE+
Sbjct  1    MIGVKRQKDPRDSIHHGGWMMKVTCWFLLVLFSLYFVPNGFISFYET  47



>gb|EMS53525.1| putative serine incorporator [Triticum urartu]
Length=316

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  407  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES  544
            M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++SFYES
Sbjct  1    MAGIKDQKDPRDKVHHGGWMAKIFCWVVIVFLMFFVPNGVVSFYES  46



>gb|AAF30310.1|AC018907_10 hypothetical protein [Arabidopsis thaliana]
Length=315

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  407  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES  544
            MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S Y +
Sbjct  1    MIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVSLYGT  46



>gb|KHN33071.1| hypothetical protein glysoja_010062 [Glycine soja]
Length=119

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = +2

Query  215  AYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTFFTI  394
            + CGLFG+SL+VSWILREV APL+E  PWI     T   EW++  AVL  SLG    F  
Sbjct  18   STCGLFGVSLVVSWILREVGAPLLEKFPWIGGTSDTYTTEWYQAQAVL--SLGVAACFVP  75

Query  395  LSIMMIGIKNQ  427
                +  + NQ
Sbjct  76   HQCEIHALPNQ  86



>ref|XP_002965853.1| hypothetical protein SELMODRAFT_83891 [Selaginella moellendorffii]
 ref|XP_002983103.1| hypothetical protein SELMODRAFT_117651 [Selaginella moellendorffii]
 gb|EFJ15912.1| hypothetical protein SELMODRAFT_117651 [Selaginella moellendorffii]
 gb|EFJ33273.1| hypothetical protein SELMODRAFT_83891 [Selaginella moellendorffii]
Length=365

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 61/112 (54%), Gaps = 2/112 (2%)
 Frame = +2

Query  203  SARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFT  382
            +AR  Y  +F L+ +V+W++R+ +   + ++ ++       D     ++ VLRVSLG F 
Sbjct  2    NARYIYAIIFLLTTVVAWMIRDYSHDALASLHYLKGCQGGHDC--LGSEGVLRVSLGCFV  59

Query  383  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            FF  + +  +G     DPRD  H G W +K + W ++++  FF+P+  I  Y
Sbjct  60   FFFTMYLTTVGTSKPDDPRDAWHSGWWPIKSLFWIIVMVLPFFIPSAFIQMY  111



>ref|XP_006407969.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49422.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=313

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  407  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            M+G+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S Y
Sbjct  1    MVGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNVVVSIY  44



>ref|XP_001416509.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94802.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=393

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 54/103 (52%), Gaps = 3/103 (3%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAP-LMENIPWINHFHKTPDREWFETDAVLRVSLGNFT  382
            AR  +  +F  ++ + W LR+  +   +E + WI   +      WF+T AV R S    T
Sbjct  7    ARATHAAMFACAVALKWALRDYGSETALERLSWIGA-NGRASAAWFKTQAVYRASCATST  65

Query  383  FFTILSIMMIGIKNQKDPRDN-LHHGGWMMKVICWFLLVIFMF  508
            FF  +S  +IG K++ D RD  LH G WM+KV+ +  L  F F
Sbjct  66   FFFAMSAALIGTKDRSDFRDKALHRGNWMLKVLAFVALHAFFF  108



>ref|XP_001753882.1| predicted protein [Physcomitrella patens]
 gb|EDQ81204.1| predicted protein [Physcomitrella patens]
Length=361

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = +2

Query  203  SARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFT  382
            +AR  Y  LF LS I++WI+R+ +        ++     + D     +D VLR+S G F 
Sbjct  2    AARYMYGLLFLLSNILAWIVRDYSLKKYHLFHYLKGCRSSLDC--VGSDGVLRLSFGCFM  59

Query  383  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            FF+ + +  +G  + KDPRD+ H G W +K + W  L++  F +P   I+ Y
Sbjct  60   FFSFMFLTTVGTSSTKDPRDSWHSGWWPIKTLGWAALMVMPFLIPPHYIAIY  111



>emb|CAN71158.1| hypothetical protein VITISV_036762 [Vitis vinifera]
Length=309

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  407  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES  544
            MIG+K+Q D RD+ HHGGW+ K++ W LL+I MFFVPN +IS Y +
Sbjct  1    MIGVKDQNDRRDSWHHGGWVAKMVIWVLLIILMFFVPNVVISIYGT  46



>ref|XP_011091387.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=419

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 59/111 (53%), Gaps = 1/111 (1%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR AY  +F L+ I++W+ R+    ++  +P+ +      +RE + T  VLRVSLG F F
Sbjct  48   ARYAYGVIFLLTNIIAWLFRDYGERILPVLPY-SRACGAEERECYHTMGVLRVSLGCFIF  106

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F ++ +M    +   + R+  H G W +K I   +  +  FF+P + I  Y
Sbjct  107  FFLMFVMTCNTRKLHEVRNAWHSGWWALKFILLLISFVIPFFIPTDYIQLY  157



>ref|XP_002515588.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47037.1| conserved hypothetical protein [Ricinus communis]
Length=398

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 53/111 (48%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR AY  +F  + +++W  R+     +  +  +       D      + VLRVSLG F F
Sbjct  34   ARFAYALIFLSANLLAWAARDYGHGALSEMERLRVCAGKSDC--LGAEGVLRVSLGCFVF  91

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F I+ +  +G     DPRD+ H G W  K++ W  L I  F VP+  I  Y
Sbjct  92   FMIMFLSTVGTSKFHDPRDSWHSGWWGPKIVLWIALTIMTFLVPSAFIRLY  142



>ref|XP_010249828.1| PREDICTED: probable serine incorporator [Nelumbo nucifera]
Length=397

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 56/111 (50%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F L+ +++W +R+     +  +  +        R    T+ VLRVSLG F F
Sbjct  33   ARYVYGLIFLLTNLLAWAVRDYGQSALTEMERLKGCKG--GRYCLGTEGVLRVSLGCFIF  90

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            +  + +   G +   +  D+ H G W  K++ W  L++  FFVPN LI FY
Sbjct  91   YFTMFLSTAGTRKLNERSDSWHSGWWSAKILVWIALLVLPFFVPNALIQFY  141



>gb|KDP32305.1| hypothetical protein JCGZ_13230 [Jatropha curcas]
Length=400

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 51/111 (46%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F  + +++W  R+     +  +  +       D      + VLRVSLG F F
Sbjct  36   ARYVYALIFLFANLLAWAARDYGHGALSEMERLRVCAGKSDC--LGAEGVLRVSLGCFIF  93

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F I+ +  +G     DPRD  H G W  K++ W  L +  F +P+  I  Y
Sbjct  94   FIIMFVSTVGTSKFYDPRDAWHSGWWSAKIVMWIALTVLTFLIPSAFIQLY  144



>ref|XP_010527190.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010527191.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010527192.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010527194.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
Length=405

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 58/118 (49%), Gaps = 2/118 (2%)
 Frame = +2

Query  185  SGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRV  364
            +G +   AR  Y  +F ++ +++W++R+     M  +    +      R     + VLRV
Sbjct  32   NGCNPWMARYVYGLIFLIANLLAWVVRDYGQGAMTEMRKFKNCKG--GRNCLGAEGVLRV  89

Query  365  SLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            SLG F F+ I+ +  +G K     RD  H G W  K++ WF L I  F +P+ +I  Y
Sbjct  90   SLGCFMFYFIMFLSTVGTKKMHSSRDRWHSGWWSAKLVMWFGLTIIPFLMPSSIIQLY  147



>ref|XP_006414928.1| hypothetical protein EUTSA_v10025402mg [Eutrema salsugineum]
 gb|ESQ56381.1| hypothetical protein EUTSA_v10025402mg [Eutrema salsugineum]
Length=394

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 56/112 (50%), Gaps = 4/112 (4%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPD-REWFETDAVLRVSLGNFT  382
            AR  Y  +F L+ +++W +R+     +  +     F    D R    T+ VLRVSLG F 
Sbjct  33   ARYVYGLMFLLANLLAWTVRDYGRGALTEM---RKFKNCKDGRNCLGTEGVLRVSLGCFL  89

Query  383  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F+ I+ +  +G       RD  H G W+ K++ W  L IF F +P+ +I  Y
Sbjct  90   FYFIMFLSTVGTSKTHSSRDKWHSGWWVAKLLMWPGLTIFPFLLPSSIIELY  141



>ref|XP_008337449.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=398

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 56/111 (50%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W +R+  + L+  +  +   H   D      + VLRVSLG F F
Sbjct  35   ARYVYGFMFLIANLMAWAVRDYGSSLLTEMERLKGCHGVKDC--LGAEGVLRVSLGCFLF  92

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            +  + +  +G     +PRD+   G W  K++ W   +I  F +P ++I  Y
Sbjct  93   YFTMFLSTVGTSKLNEPRDSWQSGWWSAKIVMWVSFIIIPFVLPAKIIQLY  143



>ref|XP_010915041.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=400

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 53/111 (48%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  LF L+ +++W +R+     +     +   H    R     + VLR+S G F+F
Sbjct  38   ARYVYAILFLLASLLAWAIRDYGRSAISEFRRLKSCHGA--RYCLGAEGVLRISFGCFSF  95

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F ++ +   G K   DPR++ H   W +K+I W   +   FF+P   I  Y
Sbjct  96   FFVMFLSTAGTKKLDDPRNSWHSEWWPVKIIMWMGFMAVPFFIPTAFIQLY  146



>ref|XP_002966499.1| hypothetical protein SELMODRAFT_85365 [Selaginella moellendorffii]
 gb|EFJ32526.1| hypothetical protein SELMODRAFT_85365 [Selaginella moellendorffii]
Length=414

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 58/119 (49%), Gaps = 4/119 (3%)
 Frame = +2

Query  185  SGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPD-REWFETDAVLR  361
            +G ++   R  Y  +F  + +++W++R+ +    E    + HF           ++ VLR
Sbjct  10   AGANQMPTRYIYAIIFLFTNLIAWVVRDYSR---EAFSTLRHFQGCYGVHTCLASEGVLR  66

Query  362  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            +S G F FF I+ +  +G       RD  H G W +K + W LL+I  FFVP  +I  Y
Sbjct  67   LSFGCFVFFAIMFVTTVGTSRIGGLRDGWHCGWWPLKFLLWILLMILPFFVPPAIIKVY  125



>ref|XP_009352478.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=398

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 56/111 (50%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR AY  +F ++ +++W +R+  + ++  +  +   H   D      + VLRVSLG F F
Sbjct  35   ARYAYGFMFLIANLMAWAVRDYGSSVLTEMERLKGCHGVKDC--LGAEGVLRVSLGCFLF  92

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            +  + +  IG     +PRD    G W  K++ W   +I  F +P ++I  Y
Sbjct  93   YFTMFLSTIGTSKLNEPRDLWQSGWWSAKIVMWVSFIIIPFVLPAKIIQLY  143



>ref|XP_002982341.1| hypothetical protein SELMODRAFT_179397 [Selaginella moellendorffii]
 gb|EFJ16586.1| hypothetical protein SELMODRAFT_179397 [Selaginella moellendorffii]
Length=382

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 57/119 (48%), Gaps = 4/119 (3%)
 Frame = +2

Query  185  SGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPD-REWFETDAVLR  361
            +G ++   R  Y  +F  + +++W++R+ +      +    HF           ++ VLR
Sbjct  10   AGANQMPTRYIYAIIFLFTNLIAWVVRDYSREAFRTL---RHFQGCYGVHTCLASEGVLR  66

Query  362  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            +S G F FF I+ +  +G       RD  H G W +K + W LL+I  FFVP  +I  Y
Sbjct  67   LSFGCFVFFAIMFVTTVGTSRIGGLRDGWHCGWWPLKFLLWILLMILPFFVPPAIIKVY  125



>gb|EYU43805.1| hypothetical protein MIMGU_mgv1a018435mg [Erythranthe guttata]
Length=415

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 58/112 (52%), Gaps = 1/112 (1%)
 Frame = +2

Query  203  SARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFT  382
             AR AY  +F L+ +++W+ R+    ++  +P+ +      +RE + T  VLRVSLG F 
Sbjct  43   QARFAYGVIFLLTNVIAWLFRDYGERILPMLPY-SKACGAEERECYHTMGVLRVSLGCFI  101

Query  383  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            FF ++ I         + R+  H G W +K +   +  +  FF+P++ I  Y
Sbjct  102  FFFLMFITTCHTGKLYNVRNAWHSGWWALKFVLLLVSFVIPFFIPSDYIQLY  153



>ref|XP_010047746.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010047747.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010047748.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010047749.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
Length=412

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 56/111 (50%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F +  +++W+ R+     ++ +  +   H   D     T+ VLRVSLG FTF
Sbjct  48   ARYLYALMFLVCNLLAWVSRDYGYGALKEMERLEGCHGAQDC--LGTEGVLRVSLGCFTF  105

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            + I+ +  +     ++PR+  H G W +K +    L+I  F VP+  I  Y
Sbjct  106  YLIMFLSTVCTSKLQEPRNAWHSGWWSVKTVLLITLIIVPFLVPSAFIRIY  156



>ref|XP_868873.1| hypothetical protein AN9491.2 [Aspergillus nidulans FGSC A4]
 gb|EAA66772.1| hypothetical protein AN9491.2 [Aspergillus nidulans FGSC A4]
Length=839

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/122 (29%), Positives = 58/122 (48%), Gaps = 19/122 (16%)
 Frame = +2

Query  203  SARIAYCGLFGLSLIVSWILREVAAPLMENIPW----INHFH------KTPDREWFETDA  352
            + RIAY  +  ++ IVSWI+           PW    + H        K   +E +   A
Sbjct  409  ATRIAYAFILLINSIVSWIML---------TPWALKKLQHLTLDYMEIKCDGKECYGWVA  459

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            V R++ G   F  +L++ ++G+++ KD R  L +G W  K++ W L V+  FF+P     
Sbjct  460  VHRINFGLGLFHLVLALFLLGVRSSKDGRAALQNGFWGPKIVLWLLFVVMSFFIPEAFFF  519

Query  533  FY  538
             Y
Sbjct  520  VY  521



>ref|XP_009381145.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=410

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 55/111 (50%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W +R+     +  +  +   H    R     + VLR+S G F F
Sbjct  46   ARFIYAIIFLVTCLLAWTIRDYGRNALSELERLKGCHGA--RYCLGAEGVLRISFGCFLF  103

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F ++ +  +G K  +D R+  H   W  K+I W   ++  FFVP+  I FY
Sbjct  104  FFVMFLSTVGTKKLEDSRNFWHSEWWPAKIIIWIGFMVVPFFVPSAFIQFY  154



>ref|XP_004994555.1| hypothetical protein PTSG_04461 [Salpingoeca rosetta]
 gb|EGD72732.1| hypothetical protein PTSG_04461 [Salpingoeca rosetta]
Length=433

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 57/114 (50%), Gaps = 6/114 (5%)
 Frame = +2

Query  194  SRRSARIAYCGLFGLSLIVSWIL--REVAAPLMENIPWINHFHK---TPDREWFETDAVL  358
            S    R+ Y  L  LS +  WI    +V++ L +   ++ H  K     DR W E   V 
Sbjct  25   SATMTRVGYALLLLLSAVCGWIFLNPKVSSDLQKMDKYVGHICKGNENCDRRWGEL-GVY  83

Query  359  RVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN  520
            RV      F  ++++++IG+K+ +DPR  +H G W +K++    L    FF+PN
Sbjct  84   RVLTATAVFHALMALILIGVKSSRDPRAAIHKGFWPVKLLLLIALATGAFFIPN  137



>gb|EPS58143.1| hypothetical protein M569_16673, partial [Genlisea aurea]
Length=176

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 58/111 (52%), Gaps = 5/111 (5%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W+ R+    ++   P+ +    +  +E ++T  VLR+S G F F
Sbjct  31   ARYVYGSIFFIANVIAWLFRDYGHKILPVFPY-SKACGSEGQECYDTMGVLRLSFGCFIF  89

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F+I+ +     +N +D R   H G W  K    F L++  F VP  + SFY
Sbjct  90   FSIMFLTTCFTRNLRDRRSGWHSGCWSGK----FFLLLLSFTVPFFVPSFY  136



>ref|XP_009408948.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408949.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=406

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 55/111 (50%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W +R+     +  +  +   H    R     + VLRVS G F F
Sbjct  42   ARFVYALIFLVTCLLAWTVRDYGRNALSELERLKGCHGA--RYCLGAEGVLRVSFGCFLF  99

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F ++ +  +G K  +D R+  H   W  K+I W + ++  FF+P+  I  Y
Sbjct  100  FFVMFLSTMGTKKLEDSRNLWHSEWWPAKIIIWIVFMVVPFFIPSAFIQLY  150



>ref|XP_010656351.1| PREDICTED: serine incorporator 3 isoform X3 [Vitis vinifera]
Length=311

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 54/111 (49%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W +R+     +  +  +        R+    + VLRVSLG FTF
Sbjct  33   ARYVYGLMFLITNLLAWAVRDYGRGALTEMERLQGCKGV--RDCLGAEGVLRVSLGCFTF  90

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            + I+ +   G      PR+  H G W  K+I W  L++  F VP+  I  Y
Sbjct  91   YFIMFLSTAGTSKLHKPRELWHSGWWSAKIILWVALMMLPFLVPSAFIQLY  141



>ref|XP_006842248.1| hypothetical protein AMTR_s00078p00195500 [Amborella trichopoda]
 gb|ERN03923.1| hypothetical protein AMTR_s00078p00195500 [Amborella trichopoda]
Length=422

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 56/114 (49%), Gaps = 4/114 (4%)
 Frame = +2

Query  200  RSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPD-REWFETDAVLRVSLGN  376
            R AR  Y  +F L  +++WI+R+     ++       F +    R    T+ VLRVSLG 
Sbjct  56   RIARYVYGFMFLLMNVLAWIVRDYGHAFLDEF---KRFEECEGGRYCLGTEGVLRVSLGG  112

Query  377  FTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F FF ++ +  +G     + R+  H G W++K    F+L    F +PN LI  Y
Sbjct  113  FIFFFVMFVSTVGTSKLSERRNTWHSGWWLVKTGAAFVLTPLPFLLPNVLIRAY  166



>emb|CAN70494.1| hypothetical protein VITISV_041932 [Vitis vinifera]
Length=397

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 54/111 (49%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W +R+     +  +  +        R+    + VLRVSLG FTF
Sbjct  33   ARYVYGLMFLITNLLAWAVRDYGRGALTEMERLQGCKGV--RDCLGAEGVLRVSLGCFTF  90

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            + I+ +   G      PR+  H G W  K+I W  L++  F VP+  I  Y
Sbjct  91   YFIMFLSTAGTSKLHKPRELWHSGWWSAKIILWVALMMLPFLVPSAFIQLY  141



>ref|XP_010656344.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656345.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656346.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656347.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656348.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656349.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 emb|CBI28099.3| unnamed protein product [Vitis vinifera]
Length=397

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 54/111 (49%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W +R+     +  +  +        R+    + VLRVSLG FTF
Sbjct  33   ARYVYGLMFLITNLLAWAVRDYGRGALTEMERLQGCKGV--RDCLGAEGVLRVSLGCFTF  90

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            + I+ +   G      PR+  H G W  K+I W  L++  F VP+  I  Y
Sbjct  91   YFIMFLSTAGTSKLHKPRELWHSGWWSAKIILWVALMMLPFLVPSAFIQLY  141



>ref|XP_009336915.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009336916.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=398

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 54/111 (49%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W +R+  + ++  +  +   H   D      + VLRVSLG F F
Sbjct  35   ARYVYGFMFLIANLMAWGVRDYGSNVLTEMERLKGCHGVKDC--LGAEGVLRVSLGCFLF  92

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            +  + +   G     +PRD+   G W  K++ W   +I  F +P  +I  Y
Sbjct  93   YITMFLSTAGTSKLNEPRDSWQSGWWSAKIVMWISFIIIPFLLPATIIQLY  143



>emb|CDY39551.1| BnaC07g07190D [Brassica napus]
Length=411

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (48%), Gaps = 4/119 (3%)
 Frame = +2

Query  185  SGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE-WFETDAVLR  361
            +G +   AR  Y  +F ++ +++W  R+     +  +     F    + E    T+ VLR
Sbjct  32   NGCNPWMARYVYGLIFLIANLLAWAARDYGRRALNKV---TKFKNCKEGENCLGTEGVLR  88

Query  362  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            VSLG F F+ ++ +  +G      PRD  H G W  K+I W  L I  F +P+ +I  Y
Sbjct  89   VSLGCFLFYFVMFLSTLGTSKTHSPRDKWHSGWWSAKLIMWPALTIIPFLLPSTIILLY  147



>gb|EEH05886.1| DNA mismatch repair protein pms1 [Histoplasma capsulatum G186AR]
Length=1515

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 1/109 (1%)
 Frame = +2

Query  194  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  370
            S  + RIAY  +   + I+SWI L   A   +E++ +          + +   AV R++ 
Sbjct  43   SSMATRIAYAVILLFNSILSWIMLTRWALSKLEHLTFDFLPISCEGEKCYGWVAVHRINF  102

Query  371  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  517
                F  IL+++++G+++ KD R  L +G W  K+I W LLV+  FF+P
Sbjct  103  ALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIP  151



>gb|EGC49614.1| DNA mismatch repair protein [Histoplasma capsulatum H88]
Length=1515

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 1/109 (1%)
 Frame = +2

Query  194  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  370
            S  + RIAY  +   + I+SWI L   A   +E++ +          + +   AV R++ 
Sbjct  43   SSMATRIAYAVILLFNSILSWIMLTRWALSKLEHLTFDFLPISCEGEKCYGWVAVHRINF  102

Query  371  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  517
                F  IL+++++G+++ KD R  L +G W  K+I W LLV+  FF+P
Sbjct  103  ALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIP  151



>gb|EER41787.1| DNA mismatch repair protein [Histoplasma capsulatum H143]
Length=1515

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 1/109 (1%)
 Frame = +2

Query  194  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  370
            S  + RIAY  +   + I+SWI L   A   +E++ +          + +   AV R++ 
Sbjct  43   SSMATRIAYAVILLFNSILSWIMLTRWALSKLEHLTFDFLPISCEGEKCYGWVAVHRINF  102

Query  371  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  517
                F  IL+++++G+++ KD R  L +G W  K+I W LLV+  FF+P
Sbjct  103  ALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIP  151



>ref|XP_007013229.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 2 [Theobroma cacao]
 gb|EOY30848.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 2 [Theobroma cacao]
Length=398

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 55/114 (48%), Gaps = 8/114 (7%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAA---PLMENIPWINHFHKTPDREWFETDAVLRVSLGN  376
            AR  Y  +F +S +++W +R+      P ME +      +    R     + VLRVSLG 
Sbjct  34   ARYVYALIFLVSNLLAWAVRDYGRNTFPEMEKLK-----NCQGGRGCLGAEGVLRVSLGC  88

Query  377  FTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F F+ ++ +   G K + + RD+ H G W  K+  W  L +  F VP  +I  Y
Sbjct  89   FAFYFVMFLSTAGTKRKYNCRDSWHSGWWSAKIGLWIALTVTSFLVPTFIIQIY  142



>ref|XP_007202140.1| hypothetical protein PRUPE_ppa006940mg [Prunus persica]
 gb|EMJ03339.1| hypothetical protein PRUPE_ppa006940mg [Prunus persica]
Length=389

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (47%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W +R+    ++  +  +   H   D        VLRVSL  F F
Sbjct  26   ARYVYGFMFLIANLLAWAVRDYGGNVLTEMERLKGCHGVKDC--LGAQGVLRVSLACFMF  83

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            +  + +   G    K+PRD+   G W  K++ W   +I  F +P  +I  Y
Sbjct  84   YFTMFLSTAGASKLKEPRDSWQSGWWSAKIVLWVTFIIIPFLLPAAIIQLY  134



>ref|XP_008024685.1| hypothetical protein SETTUDRAFT_168930 [Setosphaeria turcica 
Et28A]
 gb|EOA87823.1| hypothetical protein SETTUDRAFT_168930 [Setosphaeria turcica 
Et28A]
Length=488

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 58/108 (54%), Gaps = 1/108 (1%)
 Frame = +2

Query  203  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  379
            + RIAY  +  ++ IVSWI L + A   + ++       K    E +   AV R++    
Sbjct  47   ATRIAYALILLVNSIVSWIMLTDWAMKKLSHLTLDYVDIKCLGEECYGYVAVQRINFALG  106

Query  380  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  523
             F  ++++M+IG++  KDPR  + +G W+ K+  W  +++  FF+PN 
Sbjct  107  FFHVLMALMLIGVQTSKDPRATIQNGFWLPKIFGWIAMIVLTFFIPNS  154



>dbj|BAJ93223.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=398

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 60/121 (50%), Gaps = 13/121 (11%)
 Frame = +2

Query  197  RRS--ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTP-----DREWFETDAV  355
            RRS  AR  Y  +F  + +++W +R+  A L+  +      H  P     D + F +  V
Sbjct  21   RRSLRARYVYGLIFFATNLLAWFIRDYGAKLLGGL------HHIPVCGAGDSKCFRSGGV  74

Query  356  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  535
            LRVSLG F FF ++     G +  +  R++ H G W++K + +   ++  F +PN  I  
Sbjct  75   LRVSLGCFIFFWLMFATTFGTRKLQGVRNSWHSGCWVLKFLVYVASIVTPFIIPNIFIQL  134

Query  536  Y  538
            Y
Sbjct  135  Y  135



>ref|XP_007013228.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY30847.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
Length=408

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 55/114 (48%), Gaps = 8/114 (7%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAA---PLMENIPWINHFHKTPDREWFETDAVLRVSLGN  376
            AR  Y  +F +S +++W +R+      P ME +      +    R     + VLRVSLG 
Sbjct  34   ARYVYALIFLVSNLLAWAVRDYGRNTFPEMEKLK-----NCQGGRGCLGAEGVLRVSLGC  88

Query  377  FTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F F+ ++ +   G K + + RD+ H G W  K+  W  L +  F VP  +I  Y
Sbjct  89   FAFYFVMFLSTAGTKRKYNCRDSWHSGWWSAKIGLWIALTVTSFLVPTFIIQIY  142



>gb|KGQ04935.1| Membrane protein TMS1 [Beauveria bassiana D1-5]
Length=470

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 65/129 (50%), Gaps = 11/129 (9%)
 Frame = +2

Query  173  RTVVSGISRRS--ARIAYCGLFGLSLIVSWILR-----EVAAPLMENIPWINHFHKTPDR  331
            +T  + +S RS   RIAY  +  ++ IV+WI+      E    LM +   IN     P+ 
Sbjct  27   KTNTANLSTRSVATRIAYALILLVNSIVAWIMLTPWAIEKLQHLMLDYVKIN----CPNG  82

Query  332  EWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFF  511
            E +   AV R++     F  IL+ ++ G+ + KDPR  + +G W  KVI W   V+  F 
Sbjct  83   ECYGWLAVHRINFALGVFHLILAGLLFGVASSKDPRAAIQNGYWGPKVIAWVAFVVMSFL  142

Query  512  VPNELISFY  538
            +P+E   F+
Sbjct  143  IPDEFFMFW  151



>ref|XP_007152808.1| hypothetical protein PHAVU_004G161400g [Phaseolus vulgaris]
 gb|ESW24802.1| hypothetical protein PHAVU_004G161400g [Phaseolus vulgaris]
Length=400

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W  R+  + L               ++    D VLRVS+G F F
Sbjct  34   ARYVYALIFLVANLLAWAARDELSSLTALTQLKGVKGCKVGKDCLGADGVLRVSMGCFLF  93

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            + I+     G    K+ RD  H G W++K +   L+ IF F +P++LI  Y
Sbjct  94   YMIMFWSTAGTSKLKEGRDEWHSGWWLVKTVLLILVTIFPFLLPSKLIELY  144



>ref|NP_001053258.1| Os04g0506300 [Oryza sativa Japonica Group]
 dbj|BAF15172.1| Os04g0506300 [Oryza sativa Japonica Group]
 dbj|BAG88784.1| unnamed protein product [Oryza sativa Japonica Group]
Length=404

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 57/112 (51%), Gaps = 11/112 (10%)
 Frame = +2

Query  218  YCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTP-----DREWFETDAVLRVSLGNFT  382
            Y  +F  + +++W +R+  A L+  +      H  P     D + F++  VLRVSLG F 
Sbjct  31   YGLIFFATNLLAWFVRDYGAKLLRGL------HHVPVCGAGDSKCFQSGGVLRVSLGCFI  84

Query  383  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            FF ++     G +   + R++ H G W++K + + + +I  F VPN  I  Y
Sbjct  85   FFWVMFATTFGTRKLHEVRNSWHSGCWILKFLVYAVSIIIPFIVPNIFIQLY  136



>gb|KDO54165.1| hypothetical protein CISIN_1g0159802mg [Citrus sinensis]
Length=307

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (48%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W++R+ ++  +  +  + +              VLRVSLG F F
Sbjct  33   ARYVYALIFLVANLLAWVVRDYSSAALTEMEKLKNCQG--GHHCLGAQGVLRVSLGCFVF  90

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            + I+ ++  G       RD  H G W  K++ W  L I  F +P+  I  Y
Sbjct  91   YIIMFLLTAGTSKLHGTRDLWHSGWWSAKIVLWIALTIIPFLLPSSFIQLY  141



>ref|NP_189089.3| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAL36053.1| AT3g24470/MXP5_4 [Arabidopsis thaliana]
 gb|AAQ89613.1| At3g24470/MXP5_4 [Arabidopsis thaliana]
 gb|AEE76900.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=409

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 4/119 (3%)
 Frame = +2

Query  185  SGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE-WFETDAVLR  361
            +G +   AR  Y  +F ++ +++W  R+     +  +     F      E    TD VLR
Sbjct  33   NGCNPWMARYVYGLIFLIANLLAWAARDYGRGALRKV---TRFKNCKGGENCLGTDGVLR  89

Query  362  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            VSLG F F+ ++ +  +G       RD  H G W +K+I W  L I  F +P+ +I  Y
Sbjct  90   VSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWFVKLIMWPALTIIPFLLPSSIIHLY  148



>ref|XP_006451100.1| hypothetical protein CICLE_v10008536mg [Citrus clementina]
 ref|XP_006475712.1| PREDICTED: probable serine incorporator-like isoform X1 [Citrus 
sinensis]
 ref|XP_006475713.1| PREDICTED: probable serine incorporator-like isoform X2 [Citrus 
sinensis]
 gb|ESR64340.1| hypothetical protein CICLE_v10008536mg [Citrus clementina]
 gb|KDO54163.1| hypothetical protein CISIN_1g0159802mg [Citrus sinensis]
Length=397

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (48%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W++R+ ++  +  +  + +              VLRVSLG F F
Sbjct  33   ARYVYALIFLVANLLAWVVRDYSSAALTEMEKLKNCQG--GHHCLGAQGVLRVSLGCFVF  90

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            + I+ ++  G       RD  H G W  K++ W  L I  F +P+  I  Y
Sbjct  91   YIIMFLLTAGTSKLHGTRDLWHSGWWSAKIVLWIALTIIPFLLPSSFIQLY  141



>gb|EJU04752.1| TMS membrane protein [Dacryopinax sp. DJM-731 SS1]
Length=493

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 62/118 (53%), Gaps = 5/118 (4%)
 Frame = +2

Query  194  SRRSARIAYCGLFGLSLIVSWILR-EVAAPLMENIPWINHFHKTPDRE--WFETDAVLRV  364
            S  + R+ +  +F L+ I++WI++ +    L+E   W   + K   +E   +   AV R+
Sbjct  45   SSIATRVGFALIFCLNSILAWIMKTDFMIRLIEK--WSYDYIKMECKEGKCYGVLAVHRI  102

Query  365  SLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
                  F  IL  ++IG+ N +D R  + +G W  KV+ W LL++  FF+PNE   F+
Sbjct  103  CFALSLFHFILGALLIGVNNTRDKRSAIQNGFWGPKVLLWILLIVASFFIPNEFFMFW  160



>ref|XP_010488550.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010488551.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010488552.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010488553.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=413

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 54/111 (49%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W  R+     +  +    +     +     T+ VLRVSLG F F
Sbjct  40   ARYVYGLIFLIANLLAWAARDYGRRALRKVTIFKNCKGGENC--LGTEGVLRVSLGCFLF  97

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            + ++ +  +G       RD  H G W  K+I W  L I  F +P+ +I+FY
Sbjct  98   YFVMFLSTLGTSKTHSSRDRWHSGWWFAKLILWPALTIIPFLLPSSIINFY  148



>ref|XP_010435285.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=394

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 37/69 (54%), Gaps = 0/69 (0%)
 Frame = +2

Query  332  EWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFF  511
            E   T+ VLRVS G F F+ I+ +  +G       RD  H G W  K+  W  LVIF F 
Sbjct  73   ECLGTEGVLRVSFGCFLFYFIMFLSTVGTSKMHSSRDKWHSGWWFAKLFMWLGLVIFPFL  132

Query  512  VPNELISFY  538
            +P+ +I FY
Sbjct  133  LPSSIIQFY  141



>ref|XP_007709253.1| hypothetical protein COCCADRAFT_88158 [Bipolaris zeicola 26-R-13]
 gb|EUC36480.1| hypothetical protein COCCADRAFT_88158 [Bipolaris zeicola 26-R-13]
Length=488

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 58/108 (54%), Gaps = 1/108 (1%)
 Frame = +2

Query  203  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  379
            + RIAY  +  ++ IVSWI L + A   + ++       K    + +   AV R++    
Sbjct  47   ATRIAYALILLVNSIVSWIMLTDWAMKKLAHLTLDYVDIKCLGEQCYGYVAVQRINFALG  106

Query  380  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  523
             F  I+++M+IG++  KDPR  + +G W+ K+  W  +++  FFVPN 
Sbjct  107  FFHVIMALMLIGVQTSKDPRATIQNGFWLPKIFGWIGMIVLTFFVPNS  154



>ref|XP_002885648.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61907.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=409

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 52/112 (46%), Gaps = 4/112 (4%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE-WFETDAVLRVSLGNFT  382
            AR  Y  +F ++ +++W  R+     +  +     F      E    TD VLRVSLG F 
Sbjct  40   ARYVYGLIFLIANLLAWAARDYGRGALRKV---TKFKNCKGGENCLGTDGVLRVSLGCFL  96

Query  383  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ +I  Y
Sbjct  97   FYFVMFLSTLGTSKTHSSRDRWHSGWWFAKLILWPALTIIPFLLPSSIIHLY  148



>emb|CDY43689.1| BnaC08g46960D [Brassica napus]
Length=400

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 54/112 (48%), Gaps = 4/112 (4%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDR-EWFETDAVLRVSLGNFT  382
            AR  Y  +F L  +++W++R+     +  +     F    D      T+ VLRVSLG F 
Sbjct  33   ARYVYGLMFLLVNLLAWVVRDYGRGALTEM---KKFKNCKDGLNCLGTEGVLRVSLGCFL  89

Query  383  FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F+ I+ +  +        RD  H G W  K++ W  L+IF F +P+ +I  Y
Sbjct  90   FYFIMFLSTVATSKTHSSRDKWHSGWWFAKLLMWPGLIIFPFLLPSSIIDLY  141



>gb|KIX04087.1| hypothetical protein Z518_07640 [Rhinocladiella mackenziei CBS 
650.93]
Length=481

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = +2

Query  194  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  370
            S  + RIAY  +  ++ IV+WI L   A   +E++       K    E +   AV R++ 
Sbjct  45   SSIATRIAYAMILLVNSIVAWIMLTPWAIRKLEHLTLDYMTFKCGSSECYGYFAVQRINF  104

Query  371  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
                F  ILSI+++G+K+ KD R  L +G W  K++ W   ++  FF+P     F+
Sbjct  105  ALALFHFILSILLVGVKSTKDGRSGLQNGFWGPKILVWLAFIVLSFFIPEGFFLFW  160



>ref|XP_003620496.1| Serine incorporator [Medicago truncatula]
 gb|AES76714.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=402

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F  + +++W  R+  + +               ++      VLRVS+G F F
Sbjct  36   ARYVYGLIFLAANMLAWATRDELSSISALTELKGFKACKVGKDCLGAHGVLRVSMGCFLF  95

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F ++           +PRD  H G W  K++ W +L IF F +P+ELI  Y
Sbjct  96   FMMMFWSTTRTSKLNEPRDRWHSGWWATKIVLWIILTIFTFLLPSELIDLY  146



>ref|XP_008242601.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=389

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (47%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W +R+    ++  +  +   H   D        VLRVSL  F F
Sbjct  26   ARYVYGFMFLIANLLAWAVRDYGRNVLTEMERLKGCHGVKDC--LGAQGVLRVSLACFMF  83

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            +  + +   G    K+PRD+   G W  K++ W   +I  F +P  +I  Y
Sbjct  84   YFTMFLSTAGASKLKEPRDSWQSGWWSAKIVLWVTFIIIPFLLPAAIIQLY  134



>ref|XP_008362934.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=392

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (48%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W +R+    ++  +  +   H   D      + VLRVSLG F F
Sbjct  35   ARYVYGFMFLIANLMAWGVRDYGRNVLTEMERLKGCHGVKDC--LGAEGVLRVSLGCFLF  92

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            +  + +   G     +PRD+   G W  K++ W   +I  F +P  +I  Y
Sbjct  93   YITMFLSTAGTSKLNEPRDSWQSGWWSAKIVMWISFIIIPFLLPATIIQLY  143



>ref|XP_007687418.1| hypothetical protein COCMIDRAFT_93798 [Bipolaris oryzae ATCC 
44560]
 gb|EUC46052.1| hypothetical protein COCMIDRAFT_93798 [Bipolaris oryzae ATCC 
44560]
Length=488

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 58/108 (54%), Gaps = 1/108 (1%)
 Frame = +2

Query  203  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  379
            + RIAY  +  ++ IVSWI L + A   + ++       K    + +   AV R++    
Sbjct  47   ATRIAYALILLINSIVSWIMLTDWAMKKLAHLTLDYVDIKCLGEQCYGYVAVQRINFALG  106

Query  380  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  523
             F  I+++M+IG++  KDPR  + +G W+ K+  W  +++  FF+PN 
Sbjct  107  FFHVIMALMLIGVQTSKDPRATIQNGFWLPKIFGWIGMIVLTFFIPNS  154



>ref|XP_009107689.1| PREDICTED: probable serine incorporator [Brassica rapa]
 ref|XP_009107690.1| PREDICTED: probable serine incorporator [Brassica rapa]
 ref|XP_009107691.1| PREDICTED: probable serine incorporator [Brassica rapa]
Length=394

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (48%), Gaps = 4/119 (3%)
 Frame = +2

Query  185  SGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDR-EWFETDAVLR  361
            +G +   AR  Y  +F L  +++W++R+     +  +     F    D      T+ VLR
Sbjct  26   NGYNPWMARYLYGLMFLLVNLLAWVVRDYGRGALTEM---KKFKNCKDGLNCLGTEGVLR  82

Query  362  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            VSLG F F+ I+ +  +        RD  H G W  K++ W  L+IF F +P+ +I  Y
Sbjct  83   VSLGCFLFYFIMFLSTVATSKTHSSRDKWHSGWWFAKLLMWPGLIIFPFLLPSSIIDLY  141



>gb|KIL67495.1| hypothetical protein M378DRAFT_258687 [Amanita muscaria Koide 
BX008]
Length=501

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 63/118 (53%), Gaps = 5/118 (4%)
 Frame = +2

Query  194  SRRSARIAYCGLFGLSLIVSWILR-EVAAPLMENIPWINHFHKTPDRE--WFETDAVLRV  364
            S  + R+ +  +F L+ I++WI++ ++   L++   W   + K   +E   +   AV RV
Sbjct  44   SSIATRVGFAIIFSLNSILAWIMKTDLVIKLVQK--WSLDYIKMDCKEGKCYGVLAVHRV  101

Query  365  SLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
                  F  ILS ++IG+K+ +D R  + +G W  KV+ W +LV   FF+PN    F+
Sbjct  102  CFALALFHLILSSLLIGVKDTRDKRSAIQNGWWGPKVLLWIILVAISFFIPNGFFMFW  159



>ref|XP_007701878.1| hypothetical protein COCSADRAFT_121304 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD62533.1| hypothetical protein COCSADRAFT_121304 [Bipolaris sorokiniana 
ND90Pr]
Length=488

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 58/108 (54%), Gaps = 1/108 (1%)
 Frame = +2

Query  203  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  379
            + RIAY  +  ++ IVSWI L + A   + ++       K    + +   AV R++    
Sbjct  47   ATRIAYALILLINSIVSWIMLTDWAMKKLAHLTLDYVDIKCLGEQCYGYVAVQRINFALG  106

Query  380  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  523
             F  I+++M+IG++  KDPR  + +G W+ K+  W  +++  FF+PN 
Sbjct  107  FFHVIMALMLIGVQTSKDPRATIQNGFWLPKIFGWVGMIVLTFFIPNS  154



>gb|KIV97946.1| hypothetical protein PV10_01642 [Exophiala mesophila]
Length=484

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 60/116 (52%), Gaps = 1/116 (1%)
 Frame = +2

Query  194  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSL  370
            S  + RIAY  L   + I++WI L   A   +E++       K    + +   AV R++ 
Sbjct  45   SSIATRIAYAVLLVFNSILAWISLTPWAVRKLEHLTLDYMTFKCGSSDCYGYFAVQRINF  104

Query  371  GNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
                F  ILS+++IG+++ KD R  L +G W  K++ W +LV+  FF+P     F+
Sbjct  105  ALGLFHLILSVLLIGVRSTKDTRAGLQNGFWGPKILFWIVLVVLSFFIPEGFFLFW  160



>gb|EUN26863.1| hypothetical protein COCVIDRAFT_99736 [Bipolaris victoriae FI3]
Length=488

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 58/108 (54%), Gaps = 1/108 (1%)
 Frame = +2

Query  203  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  379
            + RIAY  +  ++ IVSWI L + A   + ++       K    + +   AV R++    
Sbjct  47   ATRIAYALILLVNSIVSWIMLTDWAMKKLAHLTLDYVDIKCLGEQCYGYVAVQRINFALG  106

Query  380  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  523
             F  I+++M+IG++  KDPR  + +G W+ K+  W  +++  FF+PN 
Sbjct  107  FFHVIMALMLIGVQTSKDPRATIQNGFWLPKIFGWIGMIVLTFFIPNS  154



>gb|KIJ14234.1| hypothetical protein PAXINDRAFT_163421 [Paxillus involutus ATCC 
200175]
Length=491

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 60/118 (51%), Gaps = 5/118 (4%)
 Frame = +2

Query  194  SRRSARIAYCGLFGLSLIVSWILREVAAPLMENI-PWINHFHKTPDRE--WFETDAVLRV  364
            S  + R+ +  +F L+ +++W+++   A  M  I  W   + K    E   +   AV RV
Sbjct  44   SSIATRVGFAIIFILNSLLAWLMKTSFA--MRKIEQWSYDYIKMDCEEGKCYGVLAVHRV  101

Query  365  SLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
                  F  ILS+ +IG+K   D R  + +G W  KV+ WFLLV+  FF+PN    F+
Sbjct  102  CFALSLFHAILSVSLIGVKESMDKRAAIQNGWWGPKVLLWFLLVVITFFIPNGFFIFW  159



>gb|EMD93772.1| hypothetical protein COCHEDRAFT_1132482 [Bipolaris maydis C5]
 gb|ENH99934.1| hypothetical protein COCC4DRAFT_207119 [Bipolaris maydis ATCC 
48331]
Length=488

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 58/108 (54%), Gaps = 1/108 (1%)
 Frame = +2

Query  203  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  379
            + RIAY  +  ++ IVSWI L + A   + ++       K    + +   AV R++    
Sbjct  47   ATRIAYALILLVNSIVSWIMLTDWAMKKLAHLTLDYVDIKCLGEQCYGYVAVQRINFALG  106

Query  380  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  523
             F  I+++M+IG++  KDPR  + +G W+ K+  W  +++  FF+PN 
Sbjct  107  FFHVIMALMLIGVQTSKDPRATIQNGFWLPKIFGWIGMIVLTFFIPNS  154



>ref|XP_008793444.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=386

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 51/111 (46%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  LF L+ +++W +R+     +     +   H    R     + VLR+S G F F
Sbjct  38   ARYVYAILFLLASLLAWAIRDYGRSAISAFRRLKACHGA--RYCLGAEGVLRISFGCFLF  95

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F ++ +   G K   D R++ H   W  K+I W   ++  FF+P   I  Y
Sbjct  96   FFVMFLSTAGTKKLDDRRNSWHSEWWPAKIIMWMGFMVVPFFIPTAFIQLY  146



>emb|CDX94813.1| BnaC03g43750D [Brassica napus]
Length=410

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 4/119 (3%)
 Frame = +2

Query  185  SGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE-WFETDAVLR  361
            +G +   AR AY  +F ++ +++W  R+     +  +     F      E    T+ VLR
Sbjct  33   NGCNPWMARYAYGLIFLIANLLAWAARDYGQRALTEV---TKFKNCKGGENCLGTEGVLR  89

Query  362  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            VSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ +I  Y
Sbjct  90   VSLGCFLFYFVMFLSTLGTSKTHSSRDKWHSGWWSAKLIMWPALTIIPFLLPSTIIRLY  148



>ref|NP_001131274.1| uncharacterized protein LOC100192587 [Zea mays]
 gb|ACF79609.1| unknown [Zea mays]
Length=347

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 53/111 (48%), Gaps = 1/111 (1%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F ++ +++W LR+  +  +  +  +    +   R     + VLRVSLG F F
Sbjct  54   ARYLYALIFLVTNLLAWTLRDYGSSAIAGLQRLK-VCQGARRHCLGAEGVLRVSLGCFVF  112

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F ++ +  +  +   D R++ H   W  K++ W  L    F  P+ L+  Y
Sbjct  113  FVVMFLSTVHTRKLHDCRNSWHSDWWPAKIVLWLALTAVAFLAPSPLVQLY  163



>ref|XP_002841809.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ86000.1| unnamed protein product [Tuber melanosporum]
Length=481

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 60/111 (54%), Gaps = 3/111 (3%)
 Frame = +2

Query  194  SRRSARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTP-DREWFETDAVLRVS  367
            S  + RIAY  LF L+ I+SWI L   A   +E++  +++F  T    + +   AV R+ 
Sbjct  43   SSTATRIAYALLFLLNSIISWIMLSPWAIKKLEHLT-LDYFPITCLGEQCYGFVAVHRIQ  101

Query  368  LGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN  520
                 F  +L+ +++G+K+ K  R  + +G W  K+I W LL++  F VP 
Sbjct  102  FALGVFHAVLAAILVGVKSSKGGRAAIQNGYWGPKIIAWLLLIVLTFLVPE  152



>ref|XP_008081744.1| hypothetical protein GLAREA_12772 [Glarea lozoyensis ATCC 20868]
 gb|EPE31469.1| hypothetical protein GLAREA_12772 [Glarea lozoyensis ATCC 20868]
Length=479

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 59/122 (48%), Gaps = 19/122 (16%)
 Frame = +2

Query  203  SARIAYCGLFGLSLIVSWILREVAAPLMENIPW-INHFHK---------TPDREWFETDA  352
            + RIAY  +  ++ I+SWI+           PW IN   K          PD E +   A
Sbjct  46   ATRIAYALILLVNSILSWIMLT---------PWAINKLQKLTLDYMTIRCPDGECYGWVA  96

Query  353  VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS  532
            V R++     F  I++ +++G+ + K+PR  + +G W  K+I W  L++  FF+P     
Sbjct  97   VHRINFALGIFHLIMAGLLLGVNSSKNPRAAIQNGFWGPKIIAWLALIVVSFFIPEAFFM  156

Query  533  FY  538
            F+
Sbjct  157  FW  158



>gb|KJB54128.1| hypothetical protein B456_009G023600 [Gossypium raimondii]
Length=310

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 55/114 (48%), Gaps = 8/114 (7%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREV---AAPLMENIPWINHFHKTPDREWFETDAVLRVSLGN  376
            AR AY  +F +S +++W +R+    A P ME +      +    R     + VLRVSLG 
Sbjct  34   ARYAYALIFLVSNLLAWAVRDYGHNAFPEMEKLK-----NCQGGRGCLGAEGVLRVSLGC  88

Query  377  FTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F F+ ++ +   G     + RD+ H G W  K+  W  L +  F VP  ++  Y
Sbjct  89   FAFYFVMFLSTAGNSRMYNCRDSWHSGWWSAKIGLWIALTVTSFLVPTFIVQIY  142



>ref|XP_002863245.1| hypothetical protein ARALYDRAFT_497050 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39504.1| hypothetical protein ARALYDRAFT_497050 [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 37/69 (54%), Gaps = 0/69 (0%)
 Frame = +2

Query  332  EWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFF  511
            E   T+ VLRVSLG F F+ I+ +  +G    +  RD  H G W  K+  W  L IF F 
Sbjct  73   ECLGTEGVLRVSLGCFLFYFIMFLSTVGTSKTQSSRDKWHSGWWFAKLFMWLGLTIFPFL  132

Query  512  VPNELISFY  538
            +P+ +I  Y
Sbjct  133  LPSSIIQLY  141



>gb|KHG16194.1| Serine incorporator 3 [Gossypium arboreum]
Length=400

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 55/114 (48%), Gaps = 8/114 (7%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREV---AAPLMENIPWINHFHKTPDREWFETDAVLRVSLGN  376
            AR AY  +F +S +++W +R+    A P ME +      +    R     + VLRVSLG 
Sbjct  34   ARYAYALIFLVSNLLAWAVRDYGHNAFPEMEKLK-----NCQGGRGCLGAEGVLRVSLGC  88

Query  377  FTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F F+ ++ +   G     + RD+ H G W  K+  W  L +  F VP  ++  Y
Sbjct  89   FAFYFVMFLSTAGNSRMYNCRDSWHSGWWSAKIGLWIALTVTSFLVPTFIVQIY  142



>gb|AGG38116.1| maternal effect embryo arrest 55-3 protein [Dimocarpus longan]
Length=152

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 51/111 (46%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F  + +++W +R+     +  +  + +     D      + VLRVSLG F F
Sbjct  33   ARYVYGLIFLAANLLAWAVRDYGRGALTEMERLKNCKGGHDC--LGAEGVLRVSLGCFVF  90

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            + ++     G     + RD+ H G W  K++ W  L +  F +P+  I  Y
Sbjct  91   YFLMFFSTAGTSKLYESRDSWHSGWWSAKIVLWIALTVIPFLIPSSFIQIY  141



>ref|XP_003660386.1| hypothetical protein MYCTH_2298645 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO55141.1| hypothetical protein MYCTH_2298645 [Myceliophthora thermophila 
ATCC 42464]
Length=487

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 61/113 (54%), Gaps = 1/113 (1%)
 Frame = +2

Query  203  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  379
            + RI Y  +  ++ I+SWI L + A   ++++       K  D + +   AV R++    
Sbjct  46   ATRIGYALILLINSILSWIMLTKWAIEKLQHLMLDYVKIKCGDGDCYGWLAVHRINFALG  105

Query  380  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
             F  +L+ +M+G+++ KDPR  + +G W  K+I W  L++  FF+P+    F+
Sbjct  106  VFHLVLAGLMLGVRSSKDPRAAIQNGFWGPKIIAWLALIVLTFFIPDTFFQFW  158



>gb|EMF14941.1| TMS membrane protein/tumor differentially expressed protein [Sphaerulina 
musiva SO2202]
Length=487

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 58/114 (51%), Gaps = 4/114 (4%)
 Frame = +2

Query  203  SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  379
            + RIAY  +  L+ ++SW+ L E A   ++NI            E F   AV R++    
Sbjct  46   ATRIAYAAILLLNSLLSWVMLTEWAVKKLQNILLDYVVVDCFGHECFGFAAVHRINFALG  105

Query  380  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYE  541
             F  +L++++IG+   KD R  L +G W  K++ W  L++  F +PN    F+E
Sbjct  106  LFHFVLAVLLIGVNTSKDTRAALQNGFWGPKIVIWLGLIVLSFLIPNR---FFE  156



>ref|XP_004346817.1| hypothetical protein CAOG_05132 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94498.1| hypothetical protein CAOG_005132 [Capsaspora owczarzaki ATCC 
30864]
Length=438

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 61/127 (48%), Gaps = 5/127 (4%)
 Frame = +2

Query  176  TVVSGISRRS--ARIAYCGLFGLSLIVSWILREVAA--PLMENIP-WINHFHKTPDREWF  340
            T   G+  RS   R+ Y  +F  + I +WIL    A   +    P +++      D   +
Sbjct  21   TSCCGLVSRSVGTRVTYAIMFLTASIAAWILSSSWAEDKMQSTAPSYLDFGCNDNDPSCY  80

Query  341  ETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN  520
             T AV RV LG   F T ++++M G+ +  DPR ++ +  W +K+  W   +I  FF+P 
Sbjct  81   GTVAVYRVCLGLVLFHTFMALIMYGVSSSSDPRASIQNSWWPLKLALWLGSIIGCFFIPG  140

Query  521  ELISFYE  541
              I  ++
Sbjct  141  SNIEQFQ  147



>ref|XP_002994401.1| hypothetical protein SELMODRAFT_449363 [Selaginella moellendorffii]
 gb|EFJ04535.1| hypothetical protein SELMODRAFT_449363 [Selaginella moellendorffii]
Length=386

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 55/113 (49%), Gaps = 2/113 (2%)
 Frame = +2

Query  200  RSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF  379
             +AR  Y  +F L+ +++W++R+ +   +  + ++             ++ VLR+S G F
Sbjct  26   SAARYIYGIIFMLTTLIAWVVRDYSHRALSELHYLEG--CLGGHNCLGSEGVLRISFGCF  83

Query  380  TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
             FF ++ +  +G       RD  H+G W  K + W +L++  F VP   I  Y
Sbjct  84   VFFLVMFVTTVGTTRLYGARDAWHNGWWPAKGVMWVILMVLPFLVPPSFIHIY  136



>ref|XP_007160349.1| hypothetical protein PHAVU_002G314300g [Phaseolus vulgaris]
 ref|XP_007160350.1| hypothetical protein PHAVU_002G314300g [Phaseolus vulgaris]
 gb|ESW32343.1| hypothetical protein PHAVU_002G314300g [Phaseolus vulgaris]
 gb|ESW32344.1| hypothetical protein PHAVU_002G314300g [Phaseolus vulgaris]
Length=398

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 53/111 (48%), Gaps = 2/111 (2%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF  385
            AR  Y  +F +S +++W  R+     +  +  +   +   D    + + VLRVSLG F F
Sbjct  34   ARYVYALVFLVSNLLAWAARDYGRGALTEMKRLKGCNGGKDC--LDAEGVLRVSLGCFIF  91

Query  386  FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F I+ +         + RD  H G W +K+  W ++ I  F +P+E I  Y
Sbjct  92   FIIMFLSTARTSKLNNVRDTWHSGWWSVKIALWVVMTIIPFLLPSEFIQIY  142



>gb|KJB54130.1| hypothetical protein B456_009G023600 [Gossypium raimondii]
Length=400

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 55/114 (48%), Gaps = 8/114 (7%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREV---AAPLMENIPWINHFHKTPDREWFETDAVLRVSLGN  376
            AR AY  +F +S +++W +R+    A P ME +      +    R     + VLRVSLG 
Sbjct  34   ARYAYALIFLVSNLLAWAVRDYGHNAFPEMEKLK-----NCQGGRGCLGAEGVLRVSLGC  88

Query  377  FTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            F F+ ++ +   G     + RD+ H G W  K+  W  L +  F VP  ++  Y
Sbjct  89   FAFYFVMFLSTAGNSRMYNCRDSWHSGWWSAKIGLWIALTVTSFLVPTFIVQIY  142



>ref|XP_009135894.1| PREDICTED: probable serine incorporator isoform X1 [Brassica 
rapa]
 ref|XP_009135895.1| PREDICTED: probable serine incorporator isoform X1 [Brassica 
rapa]
 ref|XP_009135896.1| PREDICTED: probable serine incorporator isoform X1 [Brassica 
rapa]
Length=412

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 4/119 (3%)
 Frame = +2

Query  185  SGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE-WFETDAVLR  361
            +G +   AR AY  +F ++ +++W  R+     +  +     F      E    T+ VLR
Sbjct  33   NGCNPWMARYAYGMIFLIANLLAWAARDYGQRALTEV---TKFKNCKGGENCLGTEGVLR  89

Query  362  VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  538
            VSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ +I  Y
Sbjct  90   VSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWSAKLIMWPSLTIIPFLLPSTIIRLY  148



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490