BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF020L18

Length=356
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008222861.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           154   8e-42   Prunus mume [ume]
ref|XP_009373545.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           153   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_011084213.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           153   2e-41   Sesamum indicum [beniseed]
ref|XP_008380476.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           153   2e-41   Malus domestica [apple tree]
ref|XP_007223132.1|  hypothetical protein PRUPE_ppa005434mg             152   2e-41   Prunus persica
ref|XP_004247883.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           152   5e-41   Solanum lycopersicum
ref|XP_006360928.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      151   8e-41   Solanum tuberosum [potatoes]
ref|XP_009608204.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      149   4e-40   Nicotiana tomentosiformis
ref|XP_009768456.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      147   2e-39   Nicotiana sylvestris
ref|XP_010093344.1|  UDP-glucuronate 4-epimerase 6                      145   7e-39   Morus notabilis
ref|XP_004502237.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      145   7e-39   Cicer arietinum [garbanzo]
ref|XP_004297013.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           144   2e-38   Fragaria vesca subsp. vesca
ref|XP_010023657.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           143   6e-38   Eucalyptus grandis [rose gum]
gb|AFK49564.1|  unknown                                                 142   2e-37   Medicago truncatula
ref|XP_003601662.1|  UDP-D-glucuronic acid 4-epimerase                  142   2e-37   Medicago truncatula
ref|XP_004138968.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      141   4e-37   Cucumis sativus [cucumbers]
ref|XP_010274074.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      140   5e-37   Nelumbo nucifera [Indian lotus]
ref|XP_002265088.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           140   8e-37   Vitis vinifera
ref|XP_008457221.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           140   1e-36   Cucumis melo [Oriental melon]
emb|CAN83418.1|  hypothetical protein VITISV_041351                     139   1e-36   Vitis vinifera
ref|XP_006349916.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      139   2e-36   Solanum tuberosum [potatoes]
ref|XP_007163818.1|  hypothetical protein PHAVU_001G267000g             138   3e-36   Phaseolus vulgaris [French bean]
gb|AGV54436.1|  UDP-D-glucuronic acid 4-epimerase                       138   3e-36   Phaseolus vulgaris [French bean]
ref|XP_011003624.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      138   4e-36   Populus euphratica
gb|AHA84281.1|  UDP-glucuronate 4-epimerase 6                           138   5e-36   Phaseolus vulgaris [French bean]
dbj|BAE71216.1|  putative NAD dependent epimerase                       137   6e-36   Trifolium pratense [peavine clover]
ref|XP_009783247.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      137   8e-36   Nicotiana sylvestris
ref|XP_009616292.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      137   8e-36   Nicotiana tomentosiformis
ref|XP_002298679.1|  UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein     136   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010243459.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      135   5e-35   Nelumbo nucifera [Indian lotus]
gb|KJB28115.1|  hypothetical protein B456_005G028000                    132   3e-34   Gossypium raimondii
gb|ADB24770.1|  UDP-D-glucuronic acid 4-epimerase                       132   6e-34   Gossypium hirsutum [American cotton]
gb|KDP39331.1|  hypothetical protein JCGZ_01088                         132   6e-34   Jatropha curcas
ref|XP_006373087.1|  hypothetical protein POPTR_0017s08580g             132   9e-34   
ref|XP_011042175.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      131   2e-33   Populus euphratica
emb|CDP21869.1|  unnamed protein product                                130   3e-33   Coffea canephora [robusta coffee]
ref|XP_007034225.1|  UDP-D-glucuronate 4-epimerase 6                    130   4e-33   Theobroma cacao [chocolate]
ref|XP_006421024.1|  hypothetical protein CICLE_v10004881mg             129   8e-33   Citrus clementina [clementine]
ref|XP_006492536.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      129   8e-33   Citrus sinensis [apfelsine]
gb|KDO42082.1|  hypothetical protein CISIN_1g011841mg                   129   8e-33   Citrus sinensis [apfelsine]
ref|XP_003538527.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      125   2e-31   Glycine max [soybeans]
ref|XP_010906178.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      120   2e-29   Elaeis guineensis
ref|XP_010905148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      119   4e-29   Elaeis guineensis
ref|XP_008792930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      117   1e-28   Phoenix dactylifera
gb|ADB24769.1|  UDP-D-glucuronic acid 4-epimerase                       117   1e-28   Gossypium hirsutum [American cotton]
ref|XP_008794651.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    117   2e-28   Phoenix dactylifera
gb|KJB72008.1|  hypothetical protein B456_011G153500                    115   5e-28   Gossypium raimondii
ref|XP_009408344.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      113   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006848494.1|  hypothetical protein AMTR_s00013p00257170          112   1e-26   Amborella trichopoda
ref|XP_010673389.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           111   2e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_189024.1|  UDP-D-glucuronate 4-epimerase 6                       108   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAN60250.1|  unknown                                                 108   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532756.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           107   4e-25   Tarenaya hassleriana [spider flower]
ref|XP_006297629.1|  hypothetical protein CARUB_v10013650mg             107   7e-25   Capsella rubella
ref|XP_002883465.1|  hypothetical protein ARALYDRAFT_898926             107   7e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_009386871.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      107   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010527460.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    106   2e-24   Tarenaya hassleriana [spider flower]
gb|KFK39681.1|  hypothetical protein AALP_AA3G275400                    105   3e-24   Arabis alpina [alpine rockcress]
ref|XP_009106288.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           105   4e-24   Brassica rapa
ref|XP_006418833.1|  hypothetical protein EUTSA_v10002521mg             104   6e-24   Eutrema salsugineum [saltwater cress]
emb|CDY18087.1|  BnaA01g23480D                                          104   6e-24   Brassica napus [oilseed rape]
ref|XP_010488461.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           103   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009102574.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           103   1e-23   Brassica rapa
ref|XP_010421811.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      103   1e-23   Camelina sativa [gold-of-pleasure]
emb|CDY64583.1|  BnaCnng44170D                                          103   1e-23   Brassica napus [oilseed rape]
ref|XP_010468437.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      103   1e-23   Camelina sativa [gold-of-pleasure]
gb|EEC83914.1|  hypothetical protein OsI_29969                          100   8e-22   Oryza sativa Indica Group [Indian rice]
dbj|BAC75426.1|  putative type 1 capsule synthesis gene(CapI)         98.6    1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062295.1|  Os08g0526100                                     98.6    1e-21   
ref|XP_006365466.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    97.4    2e-21   Solanum tuberosum [potatoes]
emb|CDX77481.1|  BnaA07g06190D                                        97.1    4e-21   
gb|EAZ43405.1|  hypothetical protein OsJ_28010                        96.3    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009412723.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    95.1    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX92990.1|  BnaA03g37120D                                        94.7    3e-20   
ref|XP_009135867.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    94.7    3e-20   Brassica rapa
ref|NP_001147328.1|  protein capI                                     94.4    4e-20   Zea mays [maize]
emb|CDX85133.1|  BnaC07g07730D                                        93.2    9e-20   
emb|CDY53207.1|  BnaC03g74010D                                        90.9    6e-19   Brassica napus [oilseed rape]
dbj|BAJ86203.1|  predicted protein                                    90.9    1e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC84839.1|  hypothetical protein OsI_31939                        89.0    4e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_004957272.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    89.0    4e-18   Setaria italica
ref|NP_001063595.1|  Os09g0504000                                     89.0    4e-18   
gb|EMT02349.1|  UDP-glucuronate 4-epimerase 6                         87.8    2e-17   
ref|XP_002444715.1|  hypothetical protein SORBIDRAFT_07g026520        86.7    2e-17   Sorghum bicolor [broomcorn]
dbj|BAJ99315.1|  predicted protein                                    83.6    3e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002462620.1|  hypothetical protein SORBIDRAFT_02g029130        83.2    4e-16   Sorghum bicolor [broomcorn]
ref|XP_003532740.2|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    82.8    7e-16   Glycine max [soybeans]
ref|XP_004239852.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    80.5    3e-15   Solanum lycopersicum
ref|XP_004973970.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    80.5    5e-15   Setaria italica
ref|XP_009411848.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    80.1    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003578376.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    79.7    7e-15   Brachypodium distachyon [annual false brome]
ref|XP_002965131.1|  hypothetical protein SELMODRAFT_266836           79.7    8e-15   
ref|XP_002522810.1|  UDP-glucuronate 5-epimerase, putative            79.0    9e-15   
ref|XP_006660806.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    79.0    2e-14   Oryza brachyantha
ref|XP_002962217.1|  hypothetical protein SELMODRAFT_77268            78.6    2e-14   Selaginella moellendorffii
ref|XP_008664162.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    76.6    9e-14   Zea mays [maize]
ref|XP_003524930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...  75.9    1e-13   Glycine max [soybeans]
ref|XP_006580148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...  75.9    1e-13   
gb|ABK25339.1|  unknown                                               75.5    2e-13   Picea sitchensis
ref|XP_009593138.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         75.1    3e-13   Nicotiana tomentosiformis
ref|XP_003572425.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    75.1    4e-13   Brachypodium distachyon [annual false brome]
ref|XP_002320057.1|  UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein   74.3    6e-13   Populus trichocarpa [western balsam poplar]
ref|XP_009789635.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         73.6    1e-12   Nicotiana sylvestris
gb|EYU30447.1|  hypothetical protein MIMGU_mgv1a006641mg              73.2    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_009586623.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         72.8    2e-12   Nicotiana tomentosiformis
ref|XP_009800153.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         72.8    2e-12   Nicotiana sylvestris
ref|XP_007052086.1|  UDP-D-glucuronate 4-epimerase 3                  72.8    2e-12   
gb|KJB41101.1|  hypothetical protein B456_007G090500                  72.4    2e-12   Gossypium raimondii
ref|XP_006396209.1|  hypothetical protein EUTSA_v10028667mg           72.0    4e-12   Eutrema salsugineum [saltwater cress]
ref|XP_006345514.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    71.2    6e-12   Solanum tuberosum [potatoes]
ref|XP_009397005.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    71.2    6e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS60141.1|  hypothetical protein M569_14661                       71.2    7e-12   Genlisea aurea
gb|AFW61553.1|  NAD-dependent epimerase/dehydratase family protein    71.2    7e-12   
ref|NP_001150944.1|  NAD-dependent epimerase/dehydratase family p...  71.2    8e-12   Zea mays [maize]
ref|XP_008465609.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         70.9    9e-12   Cucumis melo [Oriental melon]
ref|XP_004162690.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    70.5    1e-11   
ref|XP_009399578.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         70.5    1e-11   
gb|EYU37123.1|  hypothetical protein MIMGU_mgv1a006776mg              70.5    1e-11   Erythranthe guttata [common monkey flower]
ref|XP_002309376.1|  hypothetical protein POPTR_0006s19240g           70.5    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_007218024.1|  hypothetical protein PRUPE_ppa005953mg           70.1    1e-11   Prunus persica
ref|XP_011079342.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         70.1    1e-11   Sesamum indicum [beniseed]
ref|NP_191922.1|  UDP-D-glucuronate 4-epimerase 3                     70.1    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011069826.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         69.7    2e-11   Sesamum indicum [beniseed]
ref|XP_006445275.1|  hypothetical protein CICLE_v10020187mg           69.7    2e-11   Citrus clementina [clementine]
ref|XP_008351675.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         69.7    2e-11   
ref|XP_009342752.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         69.7    3e-11   Pyrus x bretschneideri [bai li]
ref|XP_004144711.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    69.3    3e-11   Cucumis sativus [cucumbers]
ref|XP_003519171.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    69.3    3e-11   Glycine max [soybeans]
ref|XP_007154841.1|  hypothetical protein PHAVU_003G152300g           69.3    3e-11   Phaseolus vulgaris [French bean]
gb|ACN26174.1|  unknown                                               67.4    3e-11   Zea mays [maize]
gb|KEH16056.1|  UDP-D-glucuronate 4-epimerase                         68.9    4e-11   Medicago truncatula
gb|KFK30589.1|  hypothetical protein AALP_AA6G001300                  68.9    4e-11   Arabis alpina [alpine rockcress]
ref|XP_010909513.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  68.9    4e-11   Elaeis guineensis
ref|XP_003549520.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    68.9    5e-11   Glycine max [soybeans]
ref|XP_011010511.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    68.6    5e-11   Populus euphratica
gb|KEH32594.1|  UDP-D-glucuronate 4-epimerase                         68.6    5e-11   Medicago truncatula
ref|XP_008364369.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         68.6    5e-11   
ref|XP_006286788.1|  hypothetical protein CARUB_v10003353mg           68.6    5e-11   Capsella rubella
ref|XP_010914055.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         68.6    6e-11   Elaeis guineensis
ref|XP_001761984.1|  predicted protein                                68.6    6e-11   
emb|CDO97699.1|  unnamed protein product                              68.6    6e-11   Coffea canephora [robusta coffee]
emb|CDP21367.1|  unnamed protein product                              68.2    7e-11   Coffea canephora [robusta coffee]
ref|XP_009417460.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         68.6    7e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010433651.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    68.2    7e-11   Camelina sativa [gold-of-pleasure]
ref|XP_004513504.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    68.2    7e-11   Cicer arietinum [garbanzo]
ref|XP_004240046.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    68.2    7e-11   Solanum lycopersicum
emb|CDX86716.1|  BnaA09g21060D                                        68.2    8e-11   
ref|XP_004155787.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    68.2    8e-11   
ref|XP_004133919.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    68.2    9e-11   
emb|CDX94504.1|  BnaC09g23320D                                        67.8    1e-10   
ref|XP_002301280.2|  hypothetical protein POPTR_0002s14750g           67.8    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_001769370.1|  predicted protein                                67.8    1e-10   
ref|XP_010053904.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         67.8    1e-10   Eucalyptus grandis [rose gum]
ref|XP_010687680.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         67.8    1e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU34305.1|  hypothetical protein MIMGU_mgv1a006903mg              67.8    1e-10   Erythranthe guttata [common monkey flower]
ref|XP_009591830.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         67.8    1e-10   Nicotiana tomentosiformis
ref|XP_010523080.1|  PREDICTED: UDP-glucuronate 4-epimerase 3 iso...  67.8    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_009596624.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         67.8    1e-10   Nicotiana tomentosiformis
ref|XP_004229804.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         67.4    1e-10   Solanum lycopersicum
ref|NP_001142515.1|  hypothetical protein                             67.4    1e-10   Zea mays [maize]
ref|XP_004506538.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    67.4    1e-10   Cicer arietinum [garbanzo]
ref|XP_010047039.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         67.4    2e-10   Eucalyptus grandis [rose gum]
ref|XP_010525760.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         67.0    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_011018096.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         67.0    2e-10   Populus euphratica
ref|XP_002324510.1|  UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein   67.0    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010539945.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         67.0    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_002872971.1|  UDP-D-glucuronate 4-epimerase 2                  67.0    2e-10   Arabidopsis lyrata subsp. lyrata
ref|NP_171702.1|  UDP-D-glucuronate 4-epimerase 2                     67.0    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008438174.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         67.0    2e-10   Cucumis melo [Oriental melon]
gb|AAM61323.1|  nucleotide sugar epimerase, putative                  67.0    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008354844.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         67.0    2e-10   
ref|XP_010268405.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    67.0    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_008372097.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         66.6    2e-10   Malus domestica [apple tree]
ref|XP_006477270.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    66.6    2e-10   Citrus sinensis [apfelsine]
ref|XP_001767292.1|  predicted protein                                66.6    2e-10   
ref|XP_006350062.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    66.6    3e-10   Solanum tuberosum [potatoes]
ref|XP_007013947.1|  UDP-D-glucuronate 4-epimerase 1                  66.6    3e-10   
ref|XP_009786918.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    66.6    3e-10   Nicotiana sylvestris
ref|XP_009600710.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    66.6    3e-10   Nicotiana tomentosiformis
gb|KJB27036.1|  hypothetical protein B456_004G273500                  66.6    3e-10   Gossypium raimondii
ref|XP_009390535.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    66.6    3e-10   
gb|AFW85530.1|  hypothetical protein ZEAMMB73_797483                  66.2    3e-10   
gb|KJB27035.1|  hypothetical protein B456_004G273500                  66.6    3e-10   Gossypium raimondii
ref|XP_004251783.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    66.2    3e-10   Solanum lycopersicum
ref|XP_009784108.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    66.6    3e-10   Nicotiana sylvestris
ref|XP_006396783.1|  hypothetical protein EUTSA_v10028672mg           66.2    3e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010103125.1|  UDP-glucuronate 4-epimerase 1                    66.2    3e-10   Morus notabilis
gb|ACJ11754.1|  UDP-D-glucuronic acid 4-epimerase                     66.2    3e-10   Gossypium hirsutum [American cotton]
ref|XP_004248561.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    66.2    3e-10   Solanum lycopersicum
ref|XP_010278008.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         66.2    3e-10   Nelumbo nucifera [Indian lotus]
ref|XP_003605138.1|  UDP-glucuronate 4-epimerase                      66.2    3e-10   Medicago truncatula
ref|XP_009348282.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         66.2    4e-10   Pyrus x bretschneideri [bai li]
ref|NP_001048359.1|  Os02g0791500                                     66.2    4e-10   
gb|KDP38751.1|  hypothetical protein JCGZ_04104                       66.2    4e-10   Jatropha curcas
gb|KJB76605.1|  hypothetical protein B456_012G096800                  66.2    4e-10   Gossypium raimondii
ref|XP_006648037.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    66.2    4e-10   Oryza brachyantha
ref|XP_008223573.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         66.2    4e-10   Prunus mume [ume]
ref|XP_007222381.1|  hypothetical protein PRUPE_ppa006006mg           66.2    4e-10   Prunus persica
ref|XP_004954186.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    66.2    4e-10   Setaria italica
ref|XP_002452964.1|  hypothetical protein SORBIDRAFT_04g035630        66.2    4e-10   Sorghum bicolor [broomcorn]
gb|KDP28767.1|  hypothetical protein JCGZ_14538                       65.9    4e-10   Jatropha curcas
ref|XP_008781382.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    65.9    5e-10   Phoenix dactylifera
ref|XP_006287814.1|  hypothetical protein CARUB_v10001027mg           65.9    5e-10   Capsella rubella
ref|XP_006440401.1|  hypothetical protein CICLE_v10020257mg           65.9    5e-10   Citrus clementina [clementine]
ref|XP_011017483.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    65.5    6e-10   Populus euphratica
ref|XP_008649176.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    65.5    7e-10   Zea mays [maize]
ref|XP_006359203.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    65.5    7e-10   Solanum tuberosum [potatoes]
ref|XP_003564175.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    65.5    7e-10   Brachypodium distachyon [annual false brome]
gb|KDO62346.1|  hypothetical protein CISIN_1g043169mg                 65.5    7e-10   Citrus sinensis [apfelsine]
emb|CDP09891.1|  unnamed protein product                              65.5    7e-10   Coffea canephora [robusta coffee]
dbj|BAK06545.1|  predicted protein                                    65.5    7e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002437985.1|  hypothetical protein SORBIDRAFT_10g005920        65.5    8e-10   Sorghum bicolor [broomcorn]
ref|XP_002874760.1|  UDP-D-glucuronate 4-epimerase 5                  65.5    8e-10   
ref|NP_192962.1|  UDP-D-glucuronate 4-epimerase 5                     65.5    8e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002993206.1|  hypothetical protein SELMODRAFT_136684           65.5    8e-10   
ref|XP_002965479.1|  hypothetical protein SELMODRAFT_84174            65.5    8e-10   
ref|XP_006453511.1|  hypothetical protein CICLE_v10008355mg           65.1    8e-10   Citrus clementina [clementine]
dbj|BAD36515.1|  putative uridine diphosphate galacturonate 4-epi...  65.1    8e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99954.1|  hypothetical protein OsI_21957                        65.1    8e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_009114629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  65.1    8e-10   
gb|AAK93670.1|  putative nucleotide sugar epimerase                   65.1    8e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004507780.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    65.1    9e-10   Cicer arietinum [garbanzo]
ref|NP_001105911.1|  LOC732831                                        65.1    9e-10   Zea mays [maize]
ref|XP_006347877.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    65.1    9e-10   Solanum tuberosum [potatoes]
ref|XP_008677814.1|  PREDICTED: LOC732831 isoform X1                  65.1    9e-10   Zea mays [maize]
ref|XP_010661665.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    65.1    9e-10   Vitis vinifera
ref|XP_002892033.1|  UDP-D-glucuronate 4-epimerase 2                  65.1    9e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_011034154.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         64.7    1e-09   Populus euphratica
ref|XP_002281007.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    64.7    1e-09   Vitis vinifera
gb|ABR16292.1|  unknown                                               64.7    1e-09   Picea sitchensis
dbj|BAJ85817.1|  predicted protein                                    64.7    1e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008361335.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         64.7    1e-09   Malus domestica [apple tree]
emb|CDY04398.1|  BnaC02g28500D                                        64.7    1e-09   
ref|XP_002280967.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         64.7    1e-09   
ref|XP_009114630.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  64.7    1e-09   
gb|ADB24771.1|  UDP-D-glucuronic acid 4-epimerase                     64.7    1e-09   Gossypium hirsutum [American cotton]
ref|XP_004296420.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         64.7    1e-09   Fragaria vesca subsp. vesca
emb|CDX97356.1|  BnaA02g21470D                                        64.3    1e-09   
ref|XP_010422190.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  64.3    1e-09   Camelina sativa [gold-of-pleasure]
gb|KJB24820.1|  hypothetical protein B456_004G162700                  64.3    1e-09   Gossypium raimondii
ref|XP_009128629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    64.3    2e-09   Brassica rapa
ref|XP_008443815.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    64.3    2e-09   Cucumis melo [Oriental melon]
ref|XP_006845469.1|  hypothetical protein AMTR_s00019p00132110        64.3    2e-09   Amborella trichopoda
gb|KGN65261.1|  hypothetical protein Csa_1G277970                     64.3    2e-09   Cucumis sativus [cucumbers]
ref|XP_010264164.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         64.3    2e-09   Nelumbo nucifera [Indian lotus]
ref|XP_004966666.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    64.3    2e-09   Setaria italica
ref|XP_010692224.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         64.3    2e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006853046.1|  hypothetical protein AMTR_s00038p00035160        63.9    2e-09   Amborella trichopoda
ref|XP_010098924.1|  UDP-glucuronate 4-epimerase 3                    63.9    3e-09   Morus notabilis
gb|EPS72617.1|  hypothetical protein M569_02133                       63.9    3e-09   Genlisea aurea
ref|XP_010047879.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         63.5    3e-09   Eucalyptus grandis [rose gum]
ref|XP_010929207.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         63.5    3e-09   Elaeis guineensis
ref|XP_009409770.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    63.5    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001781238.1|  predicted protein                                63.5    3e-09   
ref|XP_010432987.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         63.5    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006282616.1|  hypothetical protein CARUB_v10004864mg           63.5    3e-09   Capsella rubella
gb|KFK29619.1|  hypothetical protein AALP_AA7G157500                  63.5    3e-09   Arabis alpina [alpine rockcress]
ref|XP_010447717.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    63.5    3e-09   Camelina sativa [gold-of-pleasure]
ref|NP_194773.1|  UDP-D-glucuronate 4-epimerase 1                     63.5    3e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CDY70926.1|  BnaCnng70410D                                        63.5    3e-09   Brassica napus [oilseed rape]
ref|XP_010438178.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         63.5    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_007134861.1|  hypothetical protein PHAVU_010G082300g           63.5    3e-09   Phaseolus vulgaris [French bean]
ref|XP_006412706.1|  hypothetical protein EUTSA_v10025193mg           63.5    3e-09   
ref|XP_008794398.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         63.5    3e-09   Phoenix dactylifera
emb|CDY39205.1|  BnaA03g50170D                                        63.5    3e-09   Brassica napus [oilseed rape]
emb|CDX72242.1|  BnaC07g42640D                                        63.5    3e-09   
ref|XP_009127808.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         63.5    3e-09   Brassica rapa
ref|XP_009137920.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    63.5    3e-09   Brassica rapa
ref|XP_010276827.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    63.5    3e-09   Nelumbo nucifera [Indian lotus]
ref|XP_009614886.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    63.5    4e-09   Nicotiana tomentosiformis
ref|XP_008660337.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    63.5    4e-09   Zea mays [maize]
ref|XP_009781950.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    63.2    4e-09   Nicotiana sylvestris
ref|XP_009380772.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    63.2    4e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011081125.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         63.2    4e-09   Sesamum indicum [beniseed]
ref|XP_003558346.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    63.2    4e-09   Brachypodium distachyon [annual false brome]
ref|XP_006343570.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    62.8    6e-09   Solanum tuberosum [potatoes]
gb|KFK42571.1|  hypothetical protein AALP_AA1G012900                  62.8    6e-09   Arabis alpina [alpine rockcress]
gb|KJB09908.1|  hypothetical protein B456_001G174300                  62.8    7e-09   Gossypium raimondii
ref|XP_008780407.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    61.2    8e-09   Phoenix dactylifera
ref|XP_011014804.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    62.4    8e-09   
ref|XP_011033905.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    62.4    9e-09   
emb|CAN73016.1|  hypothetical protein VITISV_004388                   62.0    9e-09   
ref|XP_003521958.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    62.0    1e-08   
ref|XP_009395225.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    62.0    1e-08   
ref|XP_003517038.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    62.0    1e-08   
ref|XP_003570280.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         62.0    1e-08   
ref|XP_008794557.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    62.0    1e-08   
ref|XP_002468173.1|  hypothetical protein SORBIDRAFT_01g041030        61.6    2e-08   
ref|XP_002509598.1|  UDP-glucuronate 5-epimerase, putative            61.6    2e-08   
ref|XP_009111519.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         61.2    2e-08   
emb|CDY63064.1|  BnaAnng18570D                                        61.2    2e-08   
ref|XP_010539138.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    61.2    2e-08   
ref|XP_004245716.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         61.2    2e-08   
ref|XP_006397710.1|  hypothetical protein EUTSA_v10001454mg           61.2    2e-08   
ref|XP_010424029.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    59.7    2e-08   
gb|KFK31963.1|  hypothetical protein AALP_AA6G182500                  60.5    3e-08   
ref|XP_010323223.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         60.5    3e-08   
ref|XP_006363737.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    60.5    4e-08   
ref|XP_011090565.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    60.1    4e-08   
emb|CDX95646.1|  BnaC03g25270D                                        60.1    5e-08   
emb|CDY67756.1|  BnaA03g56770D                                        60.1    5e-08   
ref|XP_009133725.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         60.1    5e-08   
gb|KDP25603.1|  hypothetical protein JCGZ_20759                       59.7    6e-08   
ref|XP_010413058.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    58.2    6e-08   
ref|XP_002528222.1|  UDP-glucuronate 5-epimerase, putative            59.7    7e-08   
ref|XP_010544649.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         59.3    8e-08   
ref|XP_007209167.1|  hypothetical protein PRUPE_ppa006148mg           59.3    8e-08   
ref|XP_002303529.2|  hypothetical protein POPTR_0003s11410g           59.3    9e-08   
ref|XP_010419541.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    59.3    9e-08   
ref|XP_010426564.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         59.3    9e-08   
ref|XP_001759693.1|  predicted protein                                58.9    1e-07   
ref|XP_011093361.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    58.5    1e-07   
ref|XP_006837081.1|  hypothetical protein AMTR_s00110p00097630        58.5    2e-07   
ref|XP_010506473.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    57.8    3e-07   
ref|XP_010508183.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    57.8    3e-07   
ref|XP_010506472.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         57.8    3e-07   
ref|XP_003635629.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    57.4    3e-07   
emb|CAN60968.1|  hypothetical protein VITISV_008097                   57.4    3e-07   
ref|XP_003635586.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    57.4    4e-07   
ref|XP_010055537.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    57.4    4e-07   
emb|CBI24539.3|  unnamed protein product                              56.6    4e-07   
ref|NP_182056.1|  UDP-D-glucuronate 4-epimerase 4                     57.4    4e-07   
ref|XP_002266529.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    57.0    5e-07   
ref|XP_006295696.1|  hypothetical protein CARUB_v10024814mg           57.0    5e-07   
ref|XP_002880171.1|  UDP-D-glucuronate 4-epimerase 4                  57.0    5e-07   
ref|XP_011029969.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    57.0    6e-07   
ref|XP_002318876.1|  hypothetical protein POPTR_0012s14480g           56.6    6e-07   
ref|XP_001751991.1|  predicted protein                                57.0    6e-07   
gb|KFK37325.1|  hypothetical protein AALP_AA4G242100                  56.6    8e-07   
ref|XP_008238641.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         56.6    8e-07   
ref|XP_001754001.1|  predicted protein                                55.8    1e-06   
ref|XP_004306933.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         55.8    1e-06   
ref|XP_011076316.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    55.1    2e-06   
ref|XP_001761086.1|  predicted protein                                55.1    2e-06   
ref|XP_004298689.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         55.1    3e-06   
ref|XP_008448903.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         54.7    3e-06   
ref|XP_004147978.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    54.7    3e-06   
gb|EYU30554.1|  hypothetical protein MIMGU_mgv1a006591mg              54.7    4e-06   
ref|XP_001777338.1|  predicted protein                                53.9    5e-06   
ref|XP_007221187.1|  hypothetical protein PRUPE_ppa021672mg           52.4    2e-05   
ref|XP_008234372.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    52.4    2e-05   
gb|KDO65412.1|  hypothetical protein CISIN_1g015113mg                 51.6    3e-05   
ref|XP_006490076.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    51.6    3e-05   
ref|XP_006421730.1|  hypothetical protein CICLE_v10005072mg           51.6    3e-05   
gb|KEH31675.1|  UDP-D-glucuronate 4-epimerase                         51.6    4e-05   
ref|XP_008653512.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    51.2    4e-05   
ref|XP_008376451.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  50.8    5e-05   
ref|XP_004985001.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    50.8    6e-05   
gb|KJB43946.1|  hypothetical protein B456_007G225300                  50.4    8e-05   
ref|XP_004515772.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    50.4    8e-05   
ref|XP_010676680.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         50.4    8e-05   
gb|KJB25649.1|  hypothetical protein B456_004G202200                  50.4    9e-05   
ref|XP_009781927.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    50.4    9e-05   
ref|XP_009370520.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    49.3    2e-04   
ref|XP_009372935.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    48.9    2e-04   
ref|NP_001049561.1|  Os03g0249500                                     48.9    2e-04   
gb|EPS73152.1|  hypothetical protein M569_01604                       48.5    3e-04   
ref|XP_010108144.1|  UDP-glucuronate 4-epimerase 3                    48.5    3e-04   
ref|XP_007039971.1|  UDP-D-glucuronate 4-epimerase 3                  48.5    3e-04   
ref|XP_003611251.1|  UDP-glucuronate 4-epimerase                      48.5    3e-04   
gb|EPS64795.1|  hypothetical protein M569_09984                       48.1    4e-04   
ref|XP_009621323.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    48.1    4e-04   
ref|XP_004234942.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    47.8    6e-04   
ref|XP_006365249.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    47.8    6e-04   
ref|XP_003533522.2|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  47.0    0.001   



>ref|XP_008222861.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Prunus mume]
Length=440

 Score =   154 bits (388),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 6/122 (5%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LIFFFTINYPPL+E  GGG   
Sbjct  9    KTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLIFFFTINYPPLSEHMGGGAHH  68

Query  181  ALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  348
             +HTT H+ L++ F     GG AWEKQV+ S+TP+R NGMSVLVTGAAGFVG+HCSLALK
Sbjct  69   -VHTT-HNFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFVGTHCSLALK  126

Query  349  KR  354
            KR
Sbjct  127  KR  128



>ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri]
Length=465

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 101/122 (83%), Gaps = 6/122 (5%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LI FFT+NYPPL++  GGG   
Sbjct  13   KTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLILFFTLNYPPLSDHVGGGANH  72

Query  181  ALHTTGHSLLAATFSGGA----AWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  348
             +HTT H+ L++ F GG     AWEKQV+ SATPRR NGMSVLVTGAAGFVGSHCSLALK
Sbjct  73   -VHTT-HNFLSSAFYGGGVGGTAWEKQVRKSATPRRPNGMSVLVTGAAGFVGSHCSLALK  130

Query  349  KR  354
            KR
Sbjct  131  KR  132



>ref|XP_011084213.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Sesamum indicum]
Length=459

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 97/118 (82%), Gaps = 4/118 (3%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSYIRRVNS+KL+ ASSKLLFR TL+VALILIFFFT+NYPPL+ +       
Sbjct  17   KTTKLERYNSYIRRVNSTKLLQASSKLLFRVTLLVALILIFFFTLNYPPLSSAD----NH  72

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             +H+T H L +A +  GAAWEKQV+ SATPRR NG SVLVTGAAGFVGSHCSLALKKR
Sbjct  73   HIHSTNHFLASAFYGSGAAWEKQVRHSATPRRPNGFSVLVTGAAGFVGSHCSLALKKR  130



>ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Malus domestica]
Length=465

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 101/122 (83%), Gaps = 6/122 (5%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LI FFT+NYPPL++  GGG   
Sbjct  13   KTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLILFFTLNYPPLSDHVGGGANH  72

Query  181  ALHTTGHSLLAATFSGGA----AWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  348
             +HTT H+ L++ F GG     AWEKQV+ SATPRR NGMSVLVTGAAGFVGSHCSLALK
Sbjct  73   -VHTT-HNFLSSAFYGGGVGGTAWEKQVRKSATPRRPNGMSVLVTGAAGFVGSHCSLALK  130

Query  349  KR  354
            KR
Sbjct  131  KR  132



>ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
 gb|EMJ24331.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
Length=461

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 102/122 (84%), Gaps = 6/122 (5%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LIFFFTINYPPL++  GGG   
Sbjct  9    KTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLIFFFTINYPPLSDHMGGGAHH  68

Query  181  ALHTTGHSLLAATFSGGA----AWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  348
             +HTT H+ L++ F GG     AWEKQV+ S+TP+R NGMSVLVTGAAGFVG+HCSLALK
Sbjct  69   -VHTT-HNFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFVGTHCSLALK  126

Query  349  KR  354
            KR
Sbjct  127  KR  128



>ref|XP_004247883.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Solanum lycopersicum]
Length=452

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 101/119 (85%), Gaps = 3/119 (3%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSYIRRVNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPL  +S      
Sbjct  13   KTTKLERYNSYIRRVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPL--TSEKSFNN  70

Query  181  ALHTTGHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             +HTT H+LL+ A + GGA+WEKQV+ S+TP R NG+SVLVTGAAGFVGSHCSLALKKR
Sbjct  71   NIHTTTHNLLSSAIYGGGASWEKQVRHSSTPHRPNGLSVLVTGAAGFVGSHCSLALKKR  129



>ref|XP_006360928.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=448

 Score =   151 bits (381),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 102/119 (86%), Gaps = 3/119 (3%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPL  +S      
Sbjct  9    KTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPL--TSEKTFNN  66

Query  181  ALHTTGHSLLAAT-FSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             +HTT H+LL++T + GGA+WEKQV+ S+TP R NG+SVLVTGAAGFVGSHCSLALKKR
Sbjct  67   NIHTTTHNLLSSTIYGGGASWEKQVRHSSTPHRPNGLSVLVTGAAGFVGSHCSLALKKR  125



>ref|XP_009608204.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=450

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 99/119 (83%), Gaps = 2/119 (2%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPLA S       
Sbjct  9    KTTKLERYNSYIRKVNSTKLIAASSKLLFRITLLVALLLIFFFTINYPPLA-SDNTNSHN  67

Query  181  ALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             +HTT H+LL++ F  GGA+WEKQV+ SATP R NG SVLVTGAAGFVGSH SLALKKR
Sbjct  68   NIHTTTHNLLSSAFYGGGASWEKQVRRSATPSRPNGFSVLVTGAAGFVGSHSSLALKKR  126



>ref|XP_009768456.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=450

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 99/119 (83%), Gaps = 2/119 (2%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPLA S       
Sbjct  9    KTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPLA-SDNPNSHN  67

Query  181  ALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             +HTT H+L+++ F  GGA+WEKQV+ S+TP R NG SVLVTGAAGFVGSH SLALKKR
Sbjct  68   NIHTTTHNLISSAFYGGGASWEKQVRRSSTPSRPNGFSVLVTGAAGFVGSHSSLALKKR  126



>ref|XP_010093344.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
 gb|EXB53916.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
Length=454

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 97/121 (80%), Gaps = 5/121 (4%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG-GGRR  177
            K  KLERYNSYIRRVNS+KL+ ASSKLLFRATL++AL+LI FFT+NYPPL+ SS      
Sbjct  9    KTMKLERYNSYIRRVNSTKLLNASSKLLFRATLLIALVLILFFTLNYPPLSSSSDTPNTH  68

Query  178  RALHTTGHSLLAATF--SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  351
             + H   H+ L++ F   GGA WEKQV+ SATPRRQNG SVLVTGAAGFVGSHCSLALKK
Sbjct  69   HSFHH--HNFLSSAFYGGGGATWEKQVRHSATPRRQNGFSVLVTGAAGFVGSHCSLALKK  126

Query  352  R  354
            R
Sbjct  127  R  127



>ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cicer arietinum]
Length=451

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 97/119 (82%), Gaps = 7/119 (6%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++ALIL+F FT NYPPL+E++      
Sbjct  9    KTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALILVFLFTFNYPPLSETA----NH  64

Query  181  ALHTTGHS-LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             LHT  HS  LA+ F GG AWE+QV+ SATPRR NG SVLVTGAAGFVGSHCSLALKKR
Sbjct  65   HLHT--HSNFLASAFGGGGAWERQVRHSATPRRPNGFSVLVTGAAGFVGSHCSLALKKR  121



>ref|XP_004297013.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 97/122 (80%), Gaps = 6/122 (5%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSY+RRVNS+KLI ASSKLLFR TL+VAL+LIFFFT+NYPPL+ SS      
Sbjct  11   KTIKLERYNSYLRRVNSTKLINASSKLLFRVTLLVALVLIFFFTLNYPPLSSSSDQNGSH  70

Query  181  ALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  348
             LH T  + L++ F     GG AWEKQV+ S+TP+R NGMSVLVTGAAGF+GSHCSLALK
Sbjct  71   RLHNT--NFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFIGSHCSLALK  128

Query  349  KR  354
            KR
Sbjct  129  KR  130



>ref|XP_010023657.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Eucalyptus grandis]
 gb|KCW59958.1| hypothetical protein EUGRSUZ_H02683 [Eucalyptus grandis]
Length=459

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 98/120 (82%), Gaps = 6/120 (5%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSYIRRVNS+KL+ ASSKLLFRATL++AL L+ FFT+NYPPL+ SS      
Sbjct  9    KTAKLERYNSYIRRVNSTKLLNASSKLLFRATLLIALALVLFFTLNYPPLSSSSTSDH--  66

Query  181  ALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            A H    S L++TFS  GGAAWEKQV+ S+TPRR NG SVLVTGAAGFVGSHCSLALKKR
Sbjct  67   APHR--RSFLSSTFSSAGGAAWEKQVRHSSTPRRPNGFSVLVTGAAGFVGSHCSLALKKR  124



>gb|AFK49564.1| unknown [Medicago truncatula]
Length=447

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 94/118 (80%), Gaps = 5/118 (4%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++S+      
Sbjct  9    KTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSDSTN----H  64

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              HT  H L +A F GG AWE+ V+ SA PRR NG +VLVTGAAGFVGSHCSLALKKR
Sbjct  65   HFHTHSHFLTSA-FGGGGAWERHVRHSAIPRRPNGFTVLVTGAAGFVGSHCSLALKKR  121



>ref|XP_003601662.1| UDP-D-glucuronic acid 4-epimerase [Medicago truncatula]
 gb|AES71913.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=447

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 94/118 (80%), Gaps = 5/118 (4%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++S+      
Sbjct  9    KTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSDSTN----H  64

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              HT  H L +A F GG AWE+ V+ SA PRR NG +VLVTGAAGFVGSHCSLALKKR
Sbjct  65   HFHTHSHFLTSA-FGGGGAWERHVRHSAIPRRPNGFTVLVTGAAGFVGSHCSLALKKR  121



>ref|XP_004138968.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 ref|XP_004166629.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 gb|KGN61492.1| hypothetical protein Csa_2G146400 [Cucumis sativus]
Length=463

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 98/122 (80%), Gaps = 5/122 (4%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSY+R+VNS+KLI ASSKLLFRATL+VAL+L+F FT+NYPPL+ S  G    
Sbjct  12   KTLKLERYNSYLRKVNSTKLINASSKLLFRATLLVALVLVFIFTLNYPPLS-SENGSSGN  70

Query  181  ALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  348
             LHT  + L +A +     GGAAWEKQV+ S+TPRR NGMSVLVTGAAGFVGSHCS+ALK
Sbjct  71   HLHTHRNFLSSAFYGGSDQGGAAWEKQVRHSSTPRRLNGMSVLVTGAAGFVGSHCSMALK  130

Query  349  KR  354
            KR
Sbjct  131  KR  132



>ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=456

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 95/118 (81%), Gaps = 2/118 (2%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSY+RRVNS+KL+AASSKLLFR TL+VALILIFFFT+N+PPL  SS      
Sbjct  9    KTTKLERYNSYLRRVNSTKLLAASSKLLFRVTLLVALILIFFFTLNHPPL--SSDSPNHV  66

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             LH   + L +A +  GA WEKQV+ S+TPRR NG SVLVTGAAGFVG+HCSLALKKR
Sbjct  67   PLHHHQNFLASAFYGNGATWEKQVRHSSTPRRSNGFSVLVTGAAGFVGTHCSLALKKR  124



>ref|XP_002265088.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Vitis vinifera]
Length=451

 Score =   140 bits (353),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 98/120 (82%), Gaps = 9/120 (8%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSYIRRVNS+KL+AASSKLLFRATL+VAL+LIFFFT+NYPPL+++       
Sbjct  9    KTTKLERYNSYIRRVNSTKLMAASSKLLFRATLLVALVLIFFFTLNYPPLSDNPH-----  63

Query  181  ALHTTGH-SLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              H   H + L++ F G GA+WEKQV+ S+TPRR NG SVLVTGA GFVG+HCSLALKKR
Sbjct  64   --HVLTHQNFLSSAFYGSGASWEKQVRHSSTPRRPNGFSVLVTGAGGFVGTHCSLALKKR  121



>ref|XP_008457221.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis melo]
Length=453

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 100/123 (81%), Gaps = 7/123 (6%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL-AESSGGGRR  177
            K  KLERYNSY+R+VNS+KL+ ASSKLLFRATL+VAL+L+F FT+NYPPL AE++  G  
Sbjct  12   KTLKLERYNSYLRKVNSTKLLNASSKLLFRATLLVALVLVFIFTLNYPPLSAENASPGNH  71

Query  178  RALHTTGHSLLAATFSG----GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  345
              LHT  + L +A + G    GAAWEKQV+ S+TPRR NGMSVLVTGAAGFVGSHCS+AL
Sbjct  72   --LHTHRNFLSSAFYGGSDHGGAAWEKQVRHSSTPRRLNGMSVLVTGAAGFVGSHCSMAL  129

Query  346  KKR  354
            KKR
Sbjct  130  KKR  132



>emb|CAN83418.1| hypothetical protein VITISV_041351 [Vitis vinifera]
Length=459

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 98/120 (82%), Gaps = 9/120 (8%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSYIRRVNS+KL+AASSKLLFRATL+VAL+LIFFFT+NYPPL+++       
Sbjct  9    KTTKLERYNSYIRRVNSTKLMAASSKLLFRATLLVALVLIFFFTLNYPPLSDNPH-----  63

Query  181  ALHTTGH-SLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              H   H + L++ F G GA+WEKQV+ S+TPRR NG SVLVTGA GFVG+HCSLALKKR
Sbjct  64   --HVLTHQNFLSSAFYGSGASWEKQVRHSSTPRRPNGFSVLVTGAGGFVGTHCSLALKKR  121



>ref|XP_006349916.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=454

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL--AESSGGGR  174
            K  KLERYNSYIRR+NS+KLI ASSKLLFR TL+VALILIFFF INYPP   +E+S    
Sbjct  10   KEMKLERYNSYIRRLNSTKLIVASSKLLFRVTLLVALILIFFFIINYPPFTSSENSNPHH  69

Query  175  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
                 TT + L ++ + GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHCS+ALKKR
Sbjct  70   HNIHTTTHNLLSSSFYGGGAAWEKQVRHSSTPRRVNGLSVLVTGAAGFVGSHCSMALKKR  129



>ref|XP_007163818.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
 gb|ESW35812.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
Length=437

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 96/118 (81%), Gaps = 8/118 (7%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+     R
Sbjct  5    KSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST----HR  60

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+R
Sbjct  61   HLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKRR  114



>gb|AGV54436.1| UDP-D-glucuronic acid 4-epimerase [Phaseolus vulgaris]
Length=437

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 96/118 (81%), Gaps = 8/118 (7%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+     R
Sbjct  5    KSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST----HR  60

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+R
Sbjct  61   HLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKRR  114



>ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 98/122 (80%), Gaps = 8/122 (7%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFT+NYPPL+++       
Sbjct  9    KTIKLERYNSYLRRLHSTKVLNASSKLLFRATLLIALVLILFFTLNYPPLSDNI----PN  64

Query  181  ALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  348
              H   H+ L+  F    +GGAAWEKQV+ S+TP+R+NG+SVLVTGAAGFVGSHCSLALK
Sbjct  65   HAHPPHHNFLSTAFFTSSAGGAAWEKQVRHSSTPKRRNGLSVLVTGAAGFVGSHCSLALK  124

Query  349  KR  354
            KR
Sbjct  125  KR  126



>gb|AHA84281.1| UDP-glucuronate 4-epimerase 6 [Phaseolus vulgaris]
Length=444

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 96/118 (81%), Gaps = 8/118 (7%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+     R
Sbjct  5    KSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST----HR  60

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+R
Sbjct  61   HLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKRR  114



>dbj|BAE71216.1| putative NAD dependent epimerase [Trifolium pratense]
Length=451

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 93/118 (79%), Gaps = 5/118 (4%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++++      
Sbjct  9    KTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSDTT-----S  63

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
                T    L + F GG AWE+QV+ SATPRR NG +VLVTGAAGFVGSHCSLALKKR
Sbjct  64   HHFHTHSHFLTSAFGGGGAWERQVRHSATPRRPNGFTVLVTGAAGFVGSHCSLALKKR  121



>ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=453

 Score =   137 bits (346),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 99/116 (85%), Gaps = 3/116 (3%)
 Frame = +1

Query  10   KLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRRALH  189
            KLERYNSYIRRVNSSKLIAASSKLLFR TL+VAL+LIFFFTINY PL  SS       +H
Sbjct  12   KLERYNSYIRRVNSSKLIAASSKLLFRVTLLVALLLIFFFTINYHPL--SSENTSHHHIH  69

Query  190  TTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            TT H+LL++ F  GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHCS+ALKKR
Sbjct  70   TTTHNLLSSAFYGGGAAWEKQVRHSSTPRRANGLSVLVTGAAGFVGSHCSMALKKR  125



>ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=453

 Score =   137 bits (346),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 99/116 (85%), Gaps = 3/116 (3%)
 Frame = +1

Query  10   KLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRRALH  189
            KLERYNSYIRRVNSSKLIAASSKLLFR TL+VAL+LIFFFTINY PL  +S       +H
Sbjct  12   KLERYNSYIRRVNSSKLIAASSKLLFRVTLLVALLLIFFFTINYHPL--NSENTPHHHIH  69

Query  190  TTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            TT HSLL++ F  GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHCS+ALKKR
Sbjct  70   TTTHSLLSSAFYGGGAAWEKQVRHSSTPRRANGLSVLVTGAAGFVGSHCSMALKKR  125



>ref|XP_002298679.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
 gb|ABK93061.1| unknown [Populus trichocarpa]
 gb|EEE83484.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
Length=457

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 97/123 (79%), Gaps = 9/123 (7%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFT+NYPPL+++       
Sbjct  9    KTIKLERYNSYLRRLHSTKVLNASSKLLFRATLLIALVLILFFTLNYPPLSDNIPNHA--  66

Query  181  ALHTTGHSLLAATF-----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  345
              H   H+ L+  F      GGAAWEKQV+ S+TP+R+NG+SVLVTGAAGFVGSHCSLAL
Sbjct  67   --HLHHHNFLSTAFFTSSAGGGAAWEKQVRHSSTPKRRNGLSVLVTGAAGFVGSHCSLAL  124

Query  346  KKR  354
            KKR
Sbjct  125  KKR  127



>ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=455

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 94/119 (79%), Gaps = 5/119 (4%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSY+RRVNS+K +AASSKLLFR TL+VALILIFFFT+NYPPL+++       
Sbjct  9    KTTKLERYNSYLRRVNSTKFLAASSKLLFRVTLLVALILIFFFTLNYPPLSDNP----HH  64

Query  181  ALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
                   + +A+ F G GA WEK+V+ S+TPRR NG SVLVTGAAGFVG+HC+LALKKR
Sbjct  65   VHLHHHQNFIASAFYGNGATWEKKVRHSSTPRRPNGFSVLVTGAAGFVGTHCALALKKR  123



>gb|KJB28115.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=409

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 94/121 (78%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSYIR+V+S+KL+ ASSK LFR TL++AL+LI FFTINYPPL++++      
Sbjct  7    KPMKLERYNSYIRKVHSTKLLNASSKFLFRVTLLIALVLILFFTINYPPLSDNTHSAPHH  66

Query  181  ALHTT--GHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  351
                +    SL + ++  GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHCSLALKK
Sbjct  67   HHRHSFLSTSLFSGSSLVGGAAWEKQVRHSSTPRRVNGFSVLVTGAAGFIGSHCSLALKK  126

Query  352  R  354
            R
Sbjct  127  R  127



>gb|ADB24770.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB28114.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=453

 Score =   132 bits (332),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 94/121 (78%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSYIR+V+S+KL+ ASSK LFR TL++AL+LI FFTINYPPL++++      
Sbjct  7    KPMKLERYNSYIRKVHSTKLLNASSKFLFRVTLLIALVLILFFTINYPPLSDNTHSAPHH  66

Query  181  ALHTT--GHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  351
                +    SL + ++  GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHCSLALKK
Sbjct  67   HHRHSFLSTSLFSGSSLVGGAAWEKQVRHSSTPRRVNGFSVLVTGAAGFIGSHCSLALKK  126

Query  352  R  354
            R
Sbjct  127  R  127



>gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas]
Length=458

 Score =   132 bits (332),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 96/124 (77%), Gaps = 9/124 (7%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFTINYPPL+++      +
Sbjct  9    KTIKLERYNSYLRRIHSTKVLNASSKLLFRATLLIALVLILFFTINYPPLSDNP---HHQ  65

Query  181  ALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLA  342
              H   H+ L+  F       GG+AWEKQV+ SATPRR NG SVLVTGAAGFVGSHCSLA
Sbjct  66   NHHIHHHNFLSTAFFARSSSVGGSAWEKQVRHSATPRRPNGFSVLVTGAAGFVGSHCSLA  125

Query  343  LKKR  354
            LKKR
Sbjct  126  LKKR  129



>ref|XP_006373087.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
 gb|ERP50884.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
Length=462

 Score =   132 bits (331),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSY+RR++S+K++ ASSKL+FR TL++AL+LI FFT+NYPPL++ +      
Sbjct  9    KTLKLERYNSYLRRLHSTKVLNASSKLIFRVTLLIALVLILFFTLNYPPLSDKNPNHAHL  68

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              H    + L  + +GG AWEKQV+ S+TP++ NG+SVLVTGAAGFVGSHCS+ALKKR
Sbjct  69   HHHNFLSAALFTSSAGGDAWEKQVRHSSTPKKPNGLSVLVTGAAGFVGSHCSIALKKR  126



>ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
 ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYN+Y+RR++S+K++ ASSKL+FR TL++AL+LI FFT+NYPPL++ +      
Sbjct  9    KTLKLERYNNYLRRLHSTKVLNASSKLIFRVTLLIALVLILFFTLNYPPLSDKNPNHAHL  68

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              H    + L  + +GG AWEKQV+ S+TP++ NG+SVLVTGAAGFVGSHCS+ALKKR
Sbjct  69   HHHNFLSAALFTSSAGGDAWEKQVRHSSTPKKPNGLSVLVTGAAGFVGSHCSIALKKR  126



>emb|CDP21869.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 99/119 (83%), Gaps = 6/119 (5%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LI FFT+NYPPL+E+       
Sbjct  11   KTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLILFFTLNYPPLSENP-----H  65

Query  181  ALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             +H T H+L ++ F G GA WEK+V+ SATPRR NG+SVLVTGAAGFVGSHCSLALKKR
Sbjct  66   HIHHTTHNLFSSAFYGSGAGWEKKVRHSATPRRPNGLSVLVTGAAGFVGSHCSLALKKR  124



>ref|XP_007034225.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
 gb|EOY05151.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
Length=453

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSY+R+++S+KL+ ASSKLLFR TL++AL+LI FFTINYPPL+++       
Sbjct  9    KTVKLERYNSYLRKLHSTKLLNASSKLLFRVTLLIALVLILFFTINYPPLSDNPHHVPPH  68

Query  181  ALHTTGHSL-LAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              H +  S  L +   GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHCSLALKKR
Sbjct  69   QHHHSFLSTSLFSISPGGAAWEKQVRHSSTPRRPNGFSVLVTGAAGFIGSHCSLALKKR  127



>ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
 gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
Length=476

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 101/133 (76%), Gaps = 15/133 (11%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++++G     
Sbjct  9    KTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSDNTGESGDN  68

Query  172  ------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMSVLVTGAAG  315
                    R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+VLVTGAAG
Sbjct  69   NSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMTVLVTGAAG  128

Query  316  FVGSHCSLALKKR  354
            FVGSHCSLALKKR
Sbjct  129  FVGSHCSLALKKR  141



>ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis]
 gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=476

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 101/133 (76%), Gaps = 15/133 (11%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++++G     
Sbjct  9    KTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSDNTGESGDN  68

Query  172  ------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMSVLVTGAAG  315
                    R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+VLVTGAAG
Sbjct  69   NSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMTVLVTGAAG  128

Query  316  FVGSHCSLALKKR  354
            FVGSHCSLALKKR
Sbjct  129  FVGSHCSLALKKR  141



>gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=469

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 101/133 (76%), Gaps = 15/133 (11%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++++G     
Sbjct  9    KTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSDNTGESGDN  68

Query  172  ------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMSVLVTGAAG  315
                    R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+VLVTGAAG
Sbjct  69   NSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMTVLVTGAAG  128

Query  316  FVGSHCSLALKKR  354
            FVGSHCSLALKKR
Sbjct  129  FVGSHCSLALKKR  141



>ref|XP_003538527.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=462

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 92/118 (78%), Gaps = 4/118 (3%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K+ KLERYNSYIRR+NS+KL+ ASSKLLFRAT++VALIL+F FT NYPPLA         
Sbjct  25   KSIKLERYNSYIRRLNSTKLLNASSKLLFRATILVALILVFLFTFNYPPLAPDF----TS  80

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              H   HS   ++ S  A+WEKQV+ S+TPRR NG++VLVTGAAGFVGSHCSLALKKR
Sbjct  81   HRHLHSHSHFLSSSSSFASWEKQVRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKKR  138



>ref|XP_010906178.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=467

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSY+RRVN++KL+A +S LLFRATL+ A++LI  FT++YPPL          
Sbjct  9    KTTKLERYNSYLRRVNTTKLLATTSNLLFRATLLTAVVLILLFTLHYPPLLAGHHLSPTS  68

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            A          ++  GGAAWE+ V+ SATPR   G+SVLVTGAAGFVG+HCSLALKKR
Sbjct  69   AHSHRSLLSSPSSSYGGAAWERNVRRSATPRHPGGLSVLVTGAAGFVGTHCSLALKKR  126



>ref|XP_010905148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=463

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 89/123 (72%), Gaps = 13/123 (11%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSY+RRVNS+KL+AASS +LFRATL+ A++LI  FT++YPPL          
Sbjct  9    KTTKLERYNSYLRRVNSTKLLAASSNILFRATLLTAVVLILLFTLHYPPLLAGH------  62

Query  181  ALHTTGHS-----LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  345
              H   HS       +++  GGAAWE++V+ SATP R  G+ VLVTGAAGFVG+HCSLAL
Sbjct  63   --HPPAHSHRSLLSPSSSSYGGAAWEREVRRSATPHRPGGLFVLVTGAAGFVGTHCSLAL  120

Query  346  KKR  354
            KKR
Sbjct  121  KKR  123



>ref|XP_008792930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Phoenix dactylifera]
Length=464

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 88/128 (69%), Gaps = 23/128 (18%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSY+RRVNS+KL+AAS   LFRATL+ A++LI  FT++YPPL          
Sbjct  9    KTTKLERYNSYLRRVNSTKLLAASWNFLFRATLLTAIVLILLFTLHYPPL----------  58

Query  181  ALHTTGHSLLAAT----------FSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  330
                 GH L AA+            GG+AWE+ V+ SATPRR  GM+VLVTGAAGFVG+H
Sbjct  59   ---LAGHHLSAASAHSHRSLLSSSYGGSAWERDVRRSATPRRHGGMTVLVTGAAGFVGTH  115

Query  331  CSLALKKR  354
            CSLALKKR
Sbjct  116  CSLALKKR  123



>gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=454

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 93/120 (78%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYN+Y+R+++S+KLI ASSKLLFRATL++ALILI FFTINYPPL+++       
Sbjct  9    KTLKLERYNNYLRKIHSTKLITASSKLLFRATLLIALILILFFTINYPPLSDTPHHVPPH  68

Query  181  ALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
                    L  + FS  GGAAWEKQV+ S+TPRR NG SVLVTGAAGFVGSHCSLALKKR
Sbjct  69   HRLHHHSLLSTSLFSAGGGAAWEKQVRLSSTPRRTNGFSVLVTGAAGFVGSHCSLALKKR  128



>ref|XP_008794651.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Phoenix dactylifera]
Length=468

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLERYNSYIRRVNS+KL+AAS+ LLFRATL+ A++LI  FT++YPPL          
Sbjct  9    KTTKLERYNSYIRRVNSTKLLAASTNLLFRATLLTAVVLILLFTLHYPPLLAGHHPSAAS  68

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            A H+    L + +  GGA WE++V+ SATPRR+ G+SVLVTGAAGFVG+HCSLALK R
Sbjct  69   A-HSHRSLLSSYSSYGGATWEREVRRSATPRRRGGLSVLVTGAAGFVGTHCSLALKXR  125



>gb|KJB72008.1| hypothetical protein B456_011G153500 [Gossypium raimondii]
Length=454

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYN+Y+R+++S+KLI ASSKLLFRATL++ALILI FFTINYPPL+++       
Sbjct  9    KTLKLERYNNYLRKIHSTKLITASSKLLFRATLLIALILILFFTINYPPLSDTPHHVPPH  68

Query  181  ALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
                    L  + FS  GGAAWEKQV+ S+TPRR NG SVLVTGA GFVGSHCSLALKKR
Sbjct  69   HRLHHHSLLSTSLFSAGGGAAWEKQVRLSSTPRRTNGFSVLVTGAGGFVGSHCSLALKKR  128



>ref|XP_009408344.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 95/119 (80%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K +KLER N+Y+RRVNS+K+I+ASS+LLFRA+++  + LI  FT++YPPL   S      
Sbjct  9    KTAKLERCNNYLRRVNSAKIISASSRLLFRASILATVALILLFTLHYPPLLLLSHYSANA  68

Query  181  ALHTTGHSLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            A  ++  SLL++  + GGAAWE++V+SSATPRR +G++VLVTGAAGFVG+HCSLALKKR
Sbjct  69   AARSSHRSLLSSDVTYGGAAWEREVRSSATPRRPSGLTVLVTGAAGFVGTHCSLALKKR  127



>ref|XP_006848494.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
 gb|ERN10075.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
Length=446

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 86/116 (74%), Gaps = 8/116 (7%)
 Frame = +1

Query  10   KLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTI-NYPPLAESSGGGRRRAL  186
            KLERYNSYIR++NSSK +AASSKLLFRA++++AL L+FF T+ +YP          RR L
Sbjct  9    KLERYNSYIRKMNSSKALAASSKLLFRASILIALFLVFFLTLTSYPTEV-------RRRL  61

Query  187  HTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             +T     A+   GG  WEKQV+ S+TPRR NG SVLVTGAAGFVGSH SLALKKR
Sbjct  62   SSTSSFGAASARWGGPLWEKQVRHSSTPRRPNGFSVLVTGAAGFVGSHSSLALKKR  117



>ref|XP_010673389.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 94/118 (80%), Gaps = 2/118 (2%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K++KLERYNSY+RRVN++KL+AASSKLLFRATL+VAL+L+FFFT+NYP     +      
Sbjct  9    KSTKLERYNSYLRRVNNTKLLAASSKLLFRATLLVALLLVFFFTLNYP--ITGNDAQNNA  66

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            ++HTT     +  +  GA WEKQV+ S+TPRR NG S+LVTGAAGFVG+HCS+ALKKR
Sbjct  67   SIHTTSRFFSSGFYGSGATWEKQVRQSSTPRRPNGFSILVTGAAGFVGTHCSIALKKR  124



>ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 sp|Q9LIS3.1|GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6; AltName: Full=UDP-glucuronic 
acid epimerase 6; Short=AtUGlcAE2 [Arabidopsis 
thaliana]
 gb|AAK44025.1|AF370210_1 putative NAD dependent epimerase [Arabidopsis thaliana]
 dbj|BAB03000.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07003.1| AT3g23820/F14O13_1 [Arabidopsis thaliana]
 gb|AAL32703.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM91705.1| putative NAD dependent epimerase [Arabidopsis thaliana]
 emb|CAI53858.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|AEE76818.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 gb|AFI41201.1| UDP-D-glucuronate 4-epimerase 6, partial [Arabidopsis thaliana]
Length=460

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 97/124 (78%), Gaps = 6/124 (5%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S       
Sbjct  11   KTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLIFAINYPPLSDSRAAAAHH  70

Query  172  -RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLA  342
              RR+  +TG   S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSHCSLA
Sbjct  71   LHRRSFLSTGLFSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHCSLA  130

Query  343  LKKR  354
            L+KR
Sbjct  131  LRKR  134



>gb|AAN60250.1| unknown [Arabidopsis thaliana]
Length=460

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 96/124 (77%), Gaps = 6/124 (5%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K++ ASSK LFRATL+VAL+L+  F INYPPL++S       
Sbjct  11   KTVKLERYNSYLRKIHSTKVLNASSKXLFRATLLVALVLVLIFAINYPPLSDSRAAAAHH  70

Query  172  -RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLA  342
              RR+  +TG   S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSHCSLA
Sbjct  71   LHRRSFLSTGLFSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHCSLA  130

Query  343  LKKR  354
            L+KR
Sbjct  131  LRKR  134



>ref|XP_010532756.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Tarenaya hassleriana]
Length=458

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 95/122 (78%), Gaps = 5/122 (4%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++SSK+I ASSKLLFRATL+VAL+L+  F +NYPPL+ SS      
Sbjct  11   KTVKLERYNSYLRKIHSSKIINASSKLLFRATLLVALLLVLVFAVNYPPLSFSSSSDNHR  70

Query  172  -RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  348
              RR+  +TG    +++  GGAAWEK+V+ S+ PRR NG SVLVTGAAGFVGSHCS+ALK
Sbjct  71   LHRRSFLSTG-IFSSSSLGGGAAWEKRVRLSSAPRRPNGFSVLVTGAAGFVGSHCSIALK  129

Query  349  KR  354
            KR
Sbjct  130  KR  131



>ref|XP_006297629.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
 gb|EOA30527.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
Length=462

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 97/126 (77%), Gaps = 8/126 (6%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S       
Sbjct  11   KTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAAAHH  70

Query  172  -RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  336
              RR+  +TG     S  +++  GGAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS
Sbjct  71   LHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCS  130

Query  337  LALKKR  354
            L L+KR
Sbjct  131  LYLRKR  136



>ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59724.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 97/125 (78%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S       
Sbjct  11   KTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAAAHH  70

Query  172  -RRRALHTTG---HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  339
              RR+  +TG    S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSHCSL
Sbjct  71   LHRRSFLSTGLFSSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHCSL  130

Query  340  ALKKR  354
            AL+KR
Sbjct  131  ALRKR  135



>ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 92/121 (76%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KNSKLERYNSYI-RRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRR  177
            K+ KLER+  Y+ RR+NS+K+IAASS LLFRA+++  ++LI  FT++YPPL     G   
Sbjct  9    KSFKLERHGGYLLRRINSTKVIAASSHLLFRASILATVVLILLFTLHYPPLLLYHSGAAA  68

Query  178  RALHTTGH-SLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  351
             +   + H SLL++  + GGAAWE++V+ SATPR  +G++VLVTGAAGFVG+HCSLALKK
Sbjct  69   SSAAHSNHRSLLSSAVTYGGAAWEREVRRSATPRSPSGLTVLVTGAAGFVGTHCSLALKK  128

Query  352  R  354
            R
Sbjct  129  R  129



>ref|XP_010527460.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Tarenaya hassleriana]
Length=460

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 91/124 (73%), Gaps = 6/124 (5%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K+I ASSKLLFRATL++AL+L+  FT+NYPPL+ S+  G   
Sbjct  11   KTVKLERYNSYLRKIHSTKVINASSKLLFRATLLIALVLVLIFTLNYPPLSSSTDAGGHR  70

Query  172  -RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLA  342
              RR+  +TG   S  AA+  GG AWEK+       +  NG SVLVTGAAGFVGSHCS+A
Sbjct  71   VHRRSFLSTGIFSSSDAASLGGGPAWEKRXXXXXNXQYPNGFSVLVTGAAGFVGSHCSIA  130

Query  343  LKKR  354
            LKKR
Sbjct  131  LKKR  134



>gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina]
Length=458

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 94/122 (77%), Gaps = 4/122 (3%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S       
Sbjct  11   KTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAAAHH  70

Query  172  -RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  348
              RR+  +TG    +++   GAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSH SLAL+
Sbjct  71   LHRRSFLSTGIFSSSSSLGEGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHASLALR  130

Query  349  KR  354
            KR
Sbjct  131  KR  132



>ref|XP_009106288.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=460

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 96/123 (78%), Gaps = 5/123 (4%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S       
Sbjct  12   KTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSAASHH  71

Query  172  -RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  345
              RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS+AL
Sbjct  72   LHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCSIAL  131

Query  346  KKR  354
            +KR
Sbjct  132  RKR  134



>ref|XP_006418833.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
 gb|ESQ37269.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
Length=461

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 97/125 (78%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S       
Sbjct  11   KTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALLLVLLFAINYPPLSDSRAAAAHH  70

Query  172  -RRRALHTTG---HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  339
              RR+  +TG    S  +++ S GAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSHCS+
Sbjct  71   LHRRSFLSTGLFSSSSSSSSASLGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHCSI  130

Query  340  ALKKR  354
            ALKKR
Sbjct  131  ALKKR  135



>emb|CDY18087.1| BnaA01g23480D [Brassica napus]
Length=460

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 96/123 (78%), Gaps = 5/123 (4%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S       
Sbjct  12   KTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSPASHH  71

Query  172  -RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  345
              RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS+AL
Sbjct  72   LHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCSIAL  131

Query  346  KKR  354
            +KR
Sbjct  132  RKR  134



>ref|XP_010488461.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Camelina sativa]
Length=462

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 95/126 (75%), Gaps = 8/126 (6%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S       
Sbjct  11   KTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAAAHH  70

Query  172  -RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  336
              RR+  +TG     S  +++  GGAAWEK+V+ S+T +R  G+SVLVTGAAGFVGSHCS
Sbjct  71   LHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTGAAGFVGSHCS  130

Query  337  LALKKR  354
            L L+KR
Sbjct  131  LYLRKR  136



>ref|XP_009102574.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=454

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S    RR 
Sbjct  11   KTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHLHRRS  70

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             L T   S  +++   GAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL+KR
Sbjct  71   FLSTGLFSSSSSSLGEGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRKR  128



>ref|XP_010421811.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=372

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 95/128 (74%), Gaps = 10/128 (8%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S       
Sbjct  11   KTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAAAHH  70

Query  172  -RRRALHTTG------HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  330
              RR+  +TG       S  +++  GGAAWEK+V+ S+T +R  G+SVLVTGAAGFVGSH
Sbjct  71   LHRRSFLSTGLFSSSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTGAAGFVGSH  130

Query  331  CSLALKKR  354
            CSL L+KR
Sbjct  131  CSLYLRKR  138



>emb|CDY64583.1| BnaCnng44170D [Brassica napus]
Length=460

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 96/123 (78%), Gaps = 5/123 (4%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYN+Y+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S       
Sbjct  12   KTVKLERYNNYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSAASHH  71

Query  172  -RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  345
              RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS+AL
Sbjct  72   LHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCSIAL  131

Query  346  KKR  354
            +KR
Sbjct  132  RKR  134



>ref|XP_010468437.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=456

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 95/126 (75%), Gaps = 8/126 (6%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S       
Sbjct  11   KTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAAAHH  70

Query  172  -RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  336
              RR+  +TG     S  +++  GGAAWEK+V+ S+T +R  G+SVLVTGAAGFVGSHCS
Sbjct  71   LHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTGAAGFVGSHCS  130

Query  337  LALKKR  354
            L L+KR
Sbjct  131  LYLRKR  136



>gb|EEC83914.1| hypothetical protein OsI_29969 [Oryza sativa Indica Group]
Length=565

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 80/121 (66%), Gaps = 13/121 (11%)
 Frame = +1

Query  31   YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRA  183
            YI R+    L++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA
Sbjct  113  YIDRIGEKTLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRA  172

Query  184  LHTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  351
               + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ 
Sbjct  173  ASRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRA  232

Query  352  R  354
            R
Sbjct  233  R  233



>dbj|BAC75426.1| putative type 1 capsule synthesis gene(CapI) [Oryza sativa Japonica 
Group]
Length=477

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 82/120 (68%), Gaps = 13/120 (11%)
 Frame = +1

Query  34   IRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRAL  186
            +RRV S KL++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA 
Sbjct  26   VRRVASGKLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAA  85

Query  187  HTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ R
Sbjct  86   SRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRAR  145



>ref|NP_001062295.1| Os08g0526100 [Oryza sativa Japonica Group]
 gb|ABC59070.1| UDP-glucuronic acid 4-epimerase isoform 3 [Oryza sativa Japonica 
Group]
 dbj|BAF24209.1| Os08g0526100 [Oryza sativa Japonica Group]
Length=478

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 82/120 (68%), Gaps = 13/120 (11%)
 Frame = +1

Query  34   IRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRAL  186
            +RRV S KL++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA 
Sbjct  27   VRRVASGKLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAA  86

Query  187  HTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ R
Sbjct  87   SRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRAR  146



>ref|XP_006365466.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=434

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 82/119 (69%), Gaps = 10/119 (8%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskl-iaasskllFRATLMVALILIFFFTINYPPLAESSGGGRR  177
            K++KL+RYN+YIR+VNSS   IAASSKLL+R T+++  +LI  F INY     ++     
Sbjct  11   KSTKLDRYNTYIRKVNSSTKFIAASSKLLYRITILIFALLICSFIINYFLFVSNNSNQHG  70

Query  178  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            R L +         F GGA WEK+V+ S+ P++ NG  VLVTGAAGFVGSHC+LALKKR
Sbjct  71   RRLFS---------FGGGAGWEKKVRHSSIPKKINGKVVLVTGAAGFVGSHCALALKKR  120



>emb|CDX77481.1| BnaA07g06190D [Brassica napus]
Length=453

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 94/118 (80%), Gaps = 1/118 (1%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S     RR
Sbjct  11   KTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHL-HRR  69

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +  +TG    +++   GAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL+KR
Sbjct  70   SFLSTGLFSSSSSLGEGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRKR  127



>gb|EAZ43405.1| hypothetical protein OsJ_28010 [Oryza sativa Japonica Group]
Length=623

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 68/103 (66%), Gaps = 13/103 (13%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPL---------AESSGGGRRRALHTTGH-SLL---AATFS  225
            FRAT++  L L+  FT++YP L         A ++  G+ RA   + H SLL   AA   
Sbjct  189  FRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAASRSSHRSLLGSSAAVAY  248

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ R
Sbjct  249  GGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRAR  291



>ref|XP_009412723.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    KNSKLERYNSYI-RRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRR  177
            K+SKLERYNSY+ RRV+S+KLIAASS LLFRAT++ ALILIF F ++YPPL  SS     
Sbjct  10   KSSKLERYNSYLLRRVSSAKLIAASSHLLFRATILAALILIFLFLLHYPPLLLSSSHYSS  69

Query  178  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             + H+   SLL++   GG  WE+ V+ SA PRR +G+SVLVTGAAGFVG+HCSLALK+R
Sbjct  70   SSPHSNHRSLLSSGSYGGGYWERDVRRSAAPRRPDGLSVLVTGAAGFVGTHCSLALKRR  128



>emb|CDX92990.1| BnaA03g37120D [Brassica napus]
Length=456

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 94/122 (77%), Gaps = 7/122 (6%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F  NY PL++S       
Sbjct  12   KTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLLLLFAFNYHPLSDSRAAASHH  71

Query  172  -RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  348
              RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL+
Sbjct  72   LHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALR  128

Query  349  KR  354
            KR
Sbjct  129  KR  130



>ref|XP_009135867.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brassica rapa]
Length=456

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 94/122 (77%), Gaps = 7/122 (6%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F  NY PL++S       
Sbjct  12   KTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLLLLFAFNYHPLSDSRAAASHH  71

Query  172  -RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  348
              RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL+
Sbjct  72   LHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALR  128

Query  349  KR  354
            KR
Sbjct  129  KR  130



>ref|NP_001147328.1| protein capI [Zea mays]
 gb|ACG26819.1| protein capI [Zea mays]
 tpg|DAA62203.1| TPA: protein capI [Zea mays]
Length=487

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 86/135 (64%), Gaps = 20/135 (15%)
 Frame = +1

Query  1    KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS--  162
            K  KLERY S     +RR  S+KL++ASS LLFRAT++  L L+F FT++YP L   S  
Sbjct  14   KGMKLERYASGGALLLRRATSAKLVSASSHLLFRATVLATLALVFLFTLHYPSLLSRSFH  73

Query  163  ----------GGGRRRALHTTGHSLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGA  309
                       G R  A H    SLL ++ S GGAAWEK+V+ SA P R  G+SVLVTGA
Sbjct  74   LSAGGGGGADDGARSSASH---RSLLMSSASYGGAAWEKEVRRSARPSRDGGISVLVTGA  130

Query  310  AGFVGSHCSLALKKR  354
            AGFVG+HCSLAL+ R
Sbjct  131  AGFVGTHCSLALRAR  145



>emb|CDX85133.1| BnaC07g07730D [Brassica napus]
Length=456

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S    RR 
Sbjct  11   KTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHLHRRS  70

Query  181  ALHTT--GHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             L T     S  +++  GGAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL+KR
Sbjct  71   FLSTGLFSSSSASSSLGGGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRKR  130



>emb|CDY53207.1| BnaC03g74010D [Brassica napus]
Length=455

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 93/122 (76%), Gaps = 7/122 (6%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG---  171
            K  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL L+  F  NY PL++S       
Sbjct  11   KTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALFLLLLFAFNYHPLSDSRAAASHH  70

Query  172  -RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  348
              RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL+
Sbjct  71   LHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALR  127

Query  349  KR  354
            KR
Sbjct  128  KR  129



>dbj|BAJ86203.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 81/128 (63%), Gaps = 10/128 (8%)
 Frame = +1

Query  1    KNSKLERYNS-----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS-  162
            K  KLERY S      +RR  SSK++AASS LLFRAT++  L L+  F ++YP L   S 
Sbjct  19   KGVKLERYASGGGALLMRRAGSSKIVAASSHLLFRATVLATLALVCLFAVHYPTLLSRSF  78

Query  163  --GGGRRRALHTTGHSLLAATFSG--GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  330
                       T+ H  L  + S   GAAWE++V+ SATPRR  GMSVLVTGAAGFVG+H
Sbjct  79   RLSAASSPPRPTSRHRNLLGSSSAYAGAAWEREVRRSATPRRDGGMSVLVTGAAGFVGAH  138

Query  331  CSLALKKR  354
            C+LAL+ R
Sbjct  139  CALALRAR  146



>gb|EEC84839.1| hypothetical protein OsI_31939 [Oryza sativa Indica Group]
Length=498

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 85/141 (60%), Gaps = 23/141 (16%)
 Frame = +1

Query  1    KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  162
            K  KLERY S       +RR  S K+++ASS LLFRAT++  + L+F FT +YP L   S
Sbjct  8    KGMKLERYASSAGAMLLLRRAASGKVVSASSHLLFRATVLATMALVFLFTFHYPSLLSRS  67

Query  163  --------GGGRRRALHTTGHSLL---------AATFSGGAAWEKQVQSSATPRRQNGMS  291
                     G    A H +  SLL         AA+  GGAAWEK+V+ SA PR+  G++
Sbjct  68   FTLSSGAGAGEGGAAAHASHRSLLMSSSSASASAASVYGGAAWEKEVRRSAKPRKDGGIA  127

Query  292  VLVTGAAGFVGSHCSLALKKR  354
            VLVTGAAGFVG+HCSLAL+ R
Sbjct  128  VLVTGAAGFVGTHCSLALRAR  148



>ref|XP_004957272.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Setaria italica]
Length=488

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 82/140 (59%), Gaps = 29/140 (21%)
 Frame = +1

Query  1    KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  168
            K  KLERY S     +RR  S+K+++ASS LLFRAT++  L L+F FT++YP L      
Sbjct  14   KGMKLERYASGGALMLRRATSAKIVSASSHLLFRATVLATLALVFLFTLHYPSLL-----  68

Query  169  GRRRALHTTG--------HSLLAATFS----------GGAAWEKQVQSSATPRRQNGMSV  294
               R+ H +         HS    +            GGAAWEK+++ SA P R  G+SV
Sbjct  69   --FRSFHLSAGGGGPGGAHSASHRSLLMSSSSTSASYGGAAWEKEMRQSARPSRDGGISV  126

Query  295  LVTGAAGFVGSHCSLALKKR  354
            LVTGAAGFVG+HCSLALK R
Sbjct  127  LVTGAAGFVGTHCSLALKAR  146



>ref|NP_001063595.1| Os09g0504000 [Oryza sativa Japonica Group]
 dbj|BAF25509.1| Os09g0504000 [Oryza sativa Japonica Group]
 gb|EEE70003.1| hypothetical protein OsJ_29922 [Oryza sativa Japonica Group]
Length=498

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 85/141 (60%), Gaps = 23/141 (16%)
 Frame = +1

Query  1    KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  162
            K  KLERY S       +RR  S K+++ASS LLFRAT++  + L+F FT +YP L   S
Sbjct  8    KGMKLERYASGAGAMLLLRRAASGKVVSASSHLLFRATVLATMALVFLFTFHYPSLLSRS  67

Query  163  --------GGGRRRALHTTGHSLL---------AATFSGGAAWEKQVQSSATPRRQNGMS  291
                     G    A H +  SLL         AA+  GGAAWEK+V+ SA PR+  G++
Sbjct  68   FTLSSGAGAGEGGAAAHASHRSLLMSSSSASASAASVYGGAAWEKEVRRSAKPRKDGGIA  127

Query  292  VLVTGAAGFVGSHCSLALKKR  354
            VLVTGAAGFVG+HCSLAL+ R
Sbjct  128  VLVTGAAGFVGTHCSLALRAR  148



>gb|EMT02349.1| UDP-glucuronate 4-epimerase 6 [Aegilops tauschii]
Length=705

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 81/139 (58%), Gaps = 24/139 (17%)
 Frame = +1

Query  1    KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS--  162
            K  KLERY S     +RRV S K ++ASS LLFRAT++  L L+F F ++YP L   S  
Sbjct  8    KGVKLERYASGGALLLRRVASGKFVSASSHLLFRATVLATLALVFLFALHYPSLLSRSFS  67

Query  163  -----------GGGRRRALHTTGHSLLAATFS----GGAAWEKQVQSSATPRRQNGMSVL  297
                       G  R  A H    SLLA+T +    G   W+K+++ SA P R  G+SVL
Sbjct  68   LASDGSSSSVPGASRSHASH---RSLLASTSAAATYGSERWQKEIRRSAKPGRDGGLSVL  124

Query  298  VTGAAGFVGSHCSLALKKR  354
            VTGA GFVG+HCSLALK R
Sbjct  125  VTGAGGFVGAHCSLALKAR  143



>ref|XP_002444715.1| hypothetical protein SORBIDRAFT_07g026520 [Sorghum bicolor]
 gb|EES14210.1| hypothetical protein SORBIDRAFT_07g026520 [Sorghum bicolor]
Length=479

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 13/131 (10%)
 Frame = +1

Query  1    KNSKLERYNSYIRRV-NsskliaasskllFRATLMVALILIFFFTINYPPL---------  150
            K  KLER+   +RR   +  L++ASS LLFRAT++  L L+  F ++YP L         
Sbjct  11   KGVKLERHAVLLRRAAGAKHLVSASSHLLFRATVLATLALVVLFAVHYPSLLSHSFTLSA  70

Query  151  --AESSGGGRRRALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  321
              A  S   R R  H +     A++  G GAAWE++V+ SATPRR   +SVLVTGAAGFV
Sbjct  71   APASPSSTPRSRHSHRSLLGSGASSSYGRGAAWEREVRRSATPRRDGALSVLVTGAAGFV  130

Query  322  GSHCSLALKKR  354
            G+HCSLAL+ R
Sbjct  131  GAHCSLALRAR  141



>dbj|BAJ99315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 78/128 (61%), Gaps = 10/128 (8%)
 Frame = +1

Query  1    KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  168
            K  KLERY S     +RRV S K ++ASS LLFRAT++  L L+F F ++YP L   S  
Sbjct  8    KGVKLERYASGSALLLRRVASGKFVSASSHLLFRATVLATLALVFLFALHYPSLLSRSFS  67

Query  169  GRR------RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  330
                     R+  +   S  AA   GG  W+K+++ SA PRR  G+SVLVTGA GFVG+H
Sbjct  68   LASSSSVPPRSHRSLLASSSAAATYGGERWQKEIRRSAKPRRDGGLSVLVTGAGGFVGAH  127

Query  331  CSLALKKR  354
            CSLALK R
Sbjct  128  CSLALKAR  135



>ref|XP_002462620.1| hypothetical protein SORBIDRAFT_02g029130 [Sorghum bicolor]
 gb|EER99141.1| hypothetical protein SORBIDRAFT_02g029130 [Sorghum bicolor]
Length=494

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 84/137 (61%), Gaps = 19/137 (14%)
 Frame = +1

Query  1    KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS--  162
            K  KLERY S     +RR  S+KL++ASS LLFRAT++  L L+F FT++YP L   S  
Sbjct  14   KGMKLERYASGGALLLRRATSAKLVSASSHLLFRATVLATLALVFLFTLHYPSLLSRSFH  73

Query  163  ------GGGRRRALHTTG---HSLL----AATFSGGAAWEKQVQSSATPRRQNGMSVLVT  303
                          H+T     SLL    A+   GGAAWEK+V+ SA P R  G+SVLVT
Sbjct  74   LSAGAGDDSAGGGAHSTSASHRSLLMSSSASASYGGAAWEKEVRRSARPSRDGGISVLVT  133

Query  304  GAAGFVGSHCSLALKKR  354
            GAAGFVG+HCSLALK R
Sbjct  134  GAAGFVGTHCSLALKAR  150



>ref|XP_003532740.2| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=493

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 68/118 (58%), Gaps = 30/118 (25%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRR  180
            K  KL RYNSY+RR+NS           F+      ++L+  +T+               
Sbjct  81   KTIKLMRYNSYLRRLNS-----------FKLLKTSFILLLLLYTL---------------  114

Query  181  ALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
               +T H LL++ F G  AWE QV+ SA PRR +GMSVLVTGAAGFVGSHCSL+LKKR
Sbjct  115  ---STHHLLLSSAFHG-PAWENQVRHSALPRRPHGMSVLVTGAAGFVGSHCSLSLKKR  168



>ref|XP_004239852.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum lycopersicum]
Length=433

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 51/119 (43%), Positives = 71/119 (60%), Gaps = 11/119 (9%)
 Frame = +1

Query  1    KNSKLERYNSYIRRVNsskliaasskllFRA-TLMVALILIFFFTINYPPLAESSGGGRR  177
            K+ KL+R N+YI +VNSS  +  +   LF    ++++ +LI  F +N+     +      
Sbjct  11   KSIKLDR-NTYIHKVNSSTKLIVAFIKLFYCIAILISALLIGLFILNHILFISTDSNQHG  69

Query  178  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            R L +         F GGA WEK+V+ S+ P++ NG  VLVTGAAGFVGSHC LALKKR
Sbjct  70   RRLFS---------FGGGAGWEKKVRHSSIPKKINGKVVLVTGAAGFVGSHCGLALKKR  119



>ref|XP_004973970.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Setaria italica]
Length=485

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 63/105 (60%), Gaps = 15/105 (14%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESS--------------GGGRRRALHTTGHSLLAATF  222
            FRAT++  L L+  F ++YP L   S              G        ++  SLL +  
Sbjct  44   FRATVLATLALVVLFAVHYPSLLSRSFTLSSASPSSSSSSGSSSSPRSRSSHRSLLGSGA  103

Query  223  S-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            S GGAAWE++V+ SATPRR  G+SVLVTGAAGFVG+HCSLAL+ R
Sbjct  104  SYGGAAWEREVRRSATPRRDGGLSVLVTGAAGFVGAHCSLALRGR  148



>ref|XP_009411848.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 93/121 (77%), Gaps = 4/121 (3%)
 Frame = +1

Query  1    KNSKLERYNSYIRR-VNsskliaasskllFRATLMVALILIFFFTINYPPL--AESSGGG  171
            K SKLERYNSY+RR V+S+KLIAASS +LFRATL+ AL+LIF F ++ PPL  + S    
Sbjct  9    KASKLERYNSYLRRRVSSAKLIAASSYILFRATLLAALLLIFLFLLHSPPLLFSGSHYYS  68

Query  172  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  351
               + H +  S  +A + GGAAWE+ V+ SATPRR +G+SVLVTGAAGFVG+HCSLALK+
Sbjct  69   SSHSNHRSLLSSSSAAY-GGAAWEQDVRRSATPRRADGLSVLVTGAAGFVGTHCSLALKR  127

Query  352  R  354
            R
Sbjct  128  R  128



>ref|XP_003578376.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brachypodium distachyon]
Length=485

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 85/142 (60%), Gaps = 26/142 (18%)
 Frame = +1

Query  1    KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYP--------  144
            K  KLERY S     +RRV S KL++ASS LLFRAT++  + L+F FT++YP        
Sbjct  8    KGVKLERYASGGALLLRRVASGKLVSASSHLLFRATVLATIALVFLFTLHYPSLLSRSFS  67

Query  145  -----------PLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNG-M  288
                       PL  +S   R   + ++  +  AA+  G   W+K+++ SA PR+ +G M
Sbjct  68   LSSSSSSSSPTPLQHASH--RSLLMSSSTPAASAASVYGSEKWQKEIKKSAKPRKADGGM  125

Query  289  SVLVTGAAGFVGSHCSLALKKR  354
            SVLVTGAAGFVG+HC+LAL+ R
Sbjct  126  SVLVTGAAGFVGTHCALALRAR  147



>ref|XP_002965131.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
 gb|EFJ33969.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
Length=445

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 70/115 (61%), Gaps = 9/115 (8%)
 Frame = +1

Query  10   KLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRRALH  189
            K+ER N+Y  RV++    + S +  F   + VAL+   FF I+ PP  ++    R     
Sbjct  13   KMER-NNYFGRVSNRWHSSGSGRYFFWMFVSVALMFYAFFHISAPPAVQTGLESRH----  67

Query  190  TTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              G+  LA    GG+ WEKQV+ SA  +R+NGM VLVTGAAGFVG+H SLALKKR
Sbjct  68   -FGNRALAW---GGSKWEKQVRHSARTKRENGMVVLVTGAAGFVGTHVSLALKKR  118



>ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=401

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GGA+WEKQV+ S+TPRR +G+SVLVTGAAGFVGSHCSLALKKR
Sbjct  31   GGASWEKQVRHSSTPRRPSGLSVLVTGAAGFVGSHCSLALKKR  73



>ref|XP_006660806.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Oryza brachyantha]
Length=492

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 82/137 (60%), Gaps = 19/137 (14%)
 Frame = +1

Query  1    KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  162
            K  KLERY S       +RR +  K+++ASS LLFRAT++  L L+F FT +YP L   S
Sbjct  8    KGMKLERYASGGAMLLLLRRASGGKIVSASSHLLFRATVLATLGLVFLFTFHYPSLLSRS  67

Query  163  GGGRRRAL-----HTTGHSLL--------AATFSGGAAWEKQVQSSATPRRQNGMSVLVT  303
                         H +  SLL        A+   GGAAWEK+V+ SA PR+  G++VLVT
Sbjct  68   FSLSGGGGDGGPAHASHRSLLMSSSSSYSASAAYGGAAWEKEVRKSAKPRKDGGIAVLVT  127

Query  304  GAAGFVGSHCSLALKKR  354
            GAAGFVG+HCSLAL+ R
Sbjct  128  GAAGFVGTHCSLALRAR  144



>ref|XP_002962217.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
 gb|EFJ37477.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
Length=450

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 68/115 (59%), Gaps = 9/115 (8%)
 Frame = +1

Query  10   KLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRRALH  189
            K+ER N+Y  RV++    + S +  F   + VAL+   FF I+ PP  ++    R     
Sbjct  18   KMER-NNYFGRVSNRWHSSGSGRYFFWMFVSVALMFYAFFHISAPPAVQTGLESR-----  71

Query  190  TTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
               H    A   GG+ WEKQV+ SA  +R+NGM VLVTGAAGFVG+H SLALKKR
Sbjct  72   ---HFGNRALTWGGSKWEKQVRHSARTKRENGMVVLVTGAAGFVGTHVSLALKKR  123



>ref|XP_008664162.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Zea mays]
 tpg|DAA48160.1| TPA: hypothetical protein ZEAMMB73_095571 [Zea mays]
Length=450

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 54/91 (59%), Gaps = 13/91 (14%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAA-WEKQVQSS  261
            FRAT++  + L+  F  +YP L   S            + L AA +  GAA WE++V+ S
Sbjct  35   FRATVLATIALVVLFAAHYPSLLSRS------------YILSAAAYGRGAASWEREVRRS  82

Query  262  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            A PRR   +SVLVTGAAGFVG HCSLAL  R
Sbjct  83   AAPRRDGALSVLVTGAAGFVGLHCSLALSAR  113



>ref|XP_003524930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X1 [Glycine 
max]
Length=416

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  232  AAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +AWE QV+ SA PRR NGMSVLVTGAAGFVGSHCSLALKKR
Sbjct  53   SAWENQVRHSALPRRPNGMSVLVTGAAGFVGSHCSLALKKR  93



>ref|XP_006580148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X2 [Glycine 
max]
Length=405

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  232  AAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +AWE QV+ SA PRR NGMSVLVTGAAGFVGSHCSLALKKR
Sbjct  53   SAWENQVRHSALPRRPNGMSVLVTGAAGFVGSHCSLALKKR  93



>gb|ABK25339.1| unknown [Picea sitchensis]
Length=430

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 70/116 (60%), Gaps = 16/116 (14%)
 Frame = +1

Query  10   KLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRRALH  189
            K+ER   Y  R  +S+  + S++L F A  ++AL+ IFF  +  P  +E     RRR L 
Sbjct  12   KMERNGGYFGRPANSRCCSPSARLFFWAATLIALLFIFFMGMTSP--SEP----RRRVL-  64

Query  190  TTGHSLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
                     ++S GG  WEKQV+ S   +R+NG+ VLVTGAAGFVGSH SLALKKR
Sbjct  65   --------GSYSWGGPDWEKQVRHSCKLKRENGIVVLVTGAAGFVGSHVSLALKKR  112



>ref|XP_009593138.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana tomentosiformis]
Length=445

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 7/86 (8%)
 Frame = +1

Query  97   LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  276
            L +  I++FFF   + P   S+ G  RR+L  T    ++   + G  WE++V++SA PR 
Sbjct  50   LFICFIVLFFF---FSPPTNSAAGNNRRSLKNT----VSPPAALGPNWERRVRASARPRS  102

Query  277  QNGMSVLVTGAAGFVGSHCSLALKKR  354
            + G +VLVTGAAGFVGSH SLALK+R
Sbjct  103  KTGFTVLVTGAAGFVGSHVSLALKRR  128



>ref|XP_003572425.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brachypodium distachyon]
Length=477

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 60/101 (59%), Gaps = 13/101 (13%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGH-SLLA----------ATFSGG  231
            FRAT++  + L+  F  +YP L   S   R  +  ++ H SLL           A   G 
Sbjct  44   FRATVLATIALVCLFAAHYPSLLSHSF--RLSSPTSSPHRSLLGSSSSSSSSSSAPAFGT  101

Query  232  AAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            AAW++ V+ SATPRR NGMSVLVTGAAGFVG HC++AL  R
Sbjct  102  AAWDRAVRRSATPRRANGMSVLVTGAAGFVGFHCAMALAAR  142



>ref|XP_002320057.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
 gb|EEE98372.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
Length=431

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 11/86 (13%)
 Frame = +1

Query  97   LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  276
            L +A+I +FF+    PP + +S   RR         L +AT+ GGAAWEK+V++SA  R 
Sbjct  40   LFIAVIFVFFY--RSPPSSSNSDLSRRY--------LTSATW-GGAAWEKRVRTSARIRS  88

Query  277  QNGMSVLVTGAAGFVGSHCSLALKKR  354
            +NG SVLVTGAAGFVG+H S ALK+R
Sbjct  89   RNGFSVLVTGAAGFVGTHVSSALKRR  114



>ref|XP_009789635.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana sylvestris]
Length=445

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 7/86 (8%)
 Frame = +1

Query  97   LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  276
            L +  I++FFF   + P    + G  RR+L  T    ++   + G  WE++V++SA PR 
Sbjct  50   LFICFIVLFFF---FSPPTSPAAGNNRRSLKNT----VSPPAALGPNWERRVRASARPRS  102

Query  277  QNGMSVLVTGAAGFVGSHCSLALKKR  354
            + G +VLVTGAAGFVGSH SLALK+R
Sbjct  103  KTGFTVLVTGAAGFVGSHVSLALKRR  128



>gb|EYU30447.1| hypothetical protein MIMGU_mgv1a006641mg [Erythranthe guttata]
Length=437

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 8/71 (11%)
 Frame = +1

Query  142  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  321
            PP A  S GG+RR+L TTGHS L A       WE + ++SA P  ++G++VLVTGAAGFV
Sbjct  58   PPAA--SPGGKRRSLQTTGHSRLPAN------WEAKARNSARPVSKSGLTVLVTGAAGFV  109

Query  322  GSHCSLALKKR  354
            GSH +LALK R
Sbjct  110  GSHAALALKNR  120



>ref|XP_009586623.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana tomentosiformis]
Length=426

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +1

Query  178  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            ++   TG+   +AT+ GG  WEKQV++SA   R NGMSVLVTGAAGFVGSH SLALKKR
Sbjct  51   QSFMDTGNRYFSATW-GGHHWEKQVRTSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKR  108



>ref|XP_009800153.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana sylvestris]
Length=426

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +1

Query  178  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            ++   TG+   +AT+ GG  WEKQV++SA   R NGMSVLVTGAAGFVGSH SLALKKR
Sbjct  51   QSFMDTGNRYFSATW-GGHHWEKQVRTSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKR  108



>ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOX96243.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=437

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (64%), Gaps = 12/91 (13%)
 Frame = +1

Query  85   FRATLMVALILIFFF-TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  261
            F + + + LILIFFF + +  PL +      RR+L T           GG AWEK+V+SS
Sbjct  41   FWSFIFLGLILIFFFRSPSSNPLPQDPS---RRSLRTYNW--------GGPAWEKRVRSS  89

Query  262  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            A  R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  90   ARVRSRNGISVLVTGAAGFVGTHVSAALKRR  120



>gb|KJB41101.1| hypothetical protein B456_007G090500 [Gossypium raimondii]
Length=437

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 57/91 (63%), Gaps = 12/91 (13%)
 Frame = +1

Query  85   FRATLMVALILIFFF-TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  261
            F + + + LILIFFF + +  PL +      RR+L T           GG AWEK+V+SS
Sbjct  41   FWSFIFLGLILIFFFRSPSSNPLPQDPS---RRSLRTYNW--------GGPAWEKRVRSS  89

Query  262  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            A  R  NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  90   ARVRSHNGISVLVTGAAGFVGTHVSAALKRR  120



>ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
 gb|ESQ37662.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
Length=437

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 56/90 (62%), Gaps = 8/90 (9%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + V LI IFF+    P     S    RR+L T  ++       GG AWEK+V+SSA
Sbjct  39   FWSLVFVGLIFIFFY--RSPSSNPVSSDPSRRSLRTYAYTW------GGPAWEKRVRSSA  90

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R ++G+SVLVTGAAGFVG+H S ALK+R
Sbjct  91   RVRTRHGISVLVTGAAGFVGTHVSAALKRR  120



>ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 55/90 (61%), Gaps = 9/90 (10%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + V LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSLVFVGLIFVFFYRSPSS-SSHVSSDLFRRSLRTSSY--------GGPAWEKKIKASA  88

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             PR  NGM VLVTGAAGFVG+H S ALK+R
Sbjct  89   KPRSSNGMCVLVTGAAGFVGTHVSAALKRR  118



>ref|XP_009397005.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 53/86 (62%), Gaps = 9/86 (10%)
 Frame = +1

Query  97   LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  276
            L +AL++ FFF     P + S+ G R         SL  A   GG AWEK V+SSA  RR
Sbjct  49   LAIALLVAFFFLSPTTPNSSSTSGRR---------SLRNAAPWGGPAWEKCVRSSARVRR  99

Query  277  QNGMSVLVTGAAGFVGSHCSLALKKR  354
              G+SVLVTGAAGFVG+H S ALK+R
Sbjct  100  SGGISVLVTGAAGFVGTHVSTALKRR  125



>gb|EPS60141.1| hypothetical protein M569_14661, partial [Genlisea aurea]
Length=429

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +1

Query  178  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +A   +G    + T+ GG  WE+QV++SA  RRQNG SVLVTGAAGFVGSH SLALKKR
Sbjct  55   KACVDSGSRYFSTTW-GGGHWERQVRASAQIRRQNGFSVLVTGAAGFVGSHVSLALKKR  112



>gb|AFW61553.1| NAD-dependent epimerase/dehydratase family protein [Zea mays]
Length=476

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 59/102 (58%), Gaps = 14/102 (14%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESS------------GGGRRRALHTTGHSLLAATFSG  228
            FRAT++  L L+  F ++YP +   S                R +  +   S  A+ +S 
Sbjct  40   FRATVLATLALVVLFAVHYPSMLSRSFSLSAAPASGASSSRSRHSHRSLLGSRPASRWS-  98

Query  229  GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             AAWE++V+ SA PRR   +SVLVTGAAGFVG+HCSLAL+ R
Sbjct  99   -AAWEREVRRSAAPRRDGALSVLVTGAAGFVGAHCSLALRAR  139



>ref|NP_001150944.1| NAD-dependent epimerase/dehydratase family protein [Zea mays]
 gb|ACG41039.1| NAD-dependent epimerase/dehydratase family protein [Zea mays]
Length=476

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 59/102 (58%), Gaps = 14/102 (14%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESS------------GGGRRRALHTTGHSLLAATFSG  228
            FRAT++  L L+  F ++YP +   S                R +  +   S  A+ +S 
Sbjct  40   FRATVLATLALVVLFAVHYPSMLSRSFSLSAAPASGASSSRSRHSHRSLLGSRPASRWS-  98

Query  229  GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             AAWE++V+ SA PRR   +SVLVTGAAGFVG+HCSLAL+ R
Sbjct  99   -AAWEREVRRSAAPRRDGALSVLVTGAAGFVGAHCSLALRAR  139



>ref|XP_008465609.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis melo]
Length=431

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV+ SA P R NG SVLVTGAAGFVGSH SLALKKR
Sbjct  71   GGIQWEKQVRVSAQPHRTNGFSVLVTGAAGFVGSHVSLALKKR  113



>ref|XP_004162690.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus]
Length=431

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV+ SA P R NG SVLVTGAAGFVGSH SLALKKR
Sbjct  71   GGIQWEKQVRISAQPHRTNGFSVLVTGAAGFVGSHVSLALKKR  113



>ref|XP_009399578.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQ+++SATPRR  G+SVLVTGAAGFVG+H SLAL+KR
Sbjct  71   GGMHWEKQIRASATPRRPGGVSVLVTGAAGFVGTHVSLALRKR  113



>gb|EYU37123.1| hypothetical protein MIMGU_mgv1a006776mg [Erythranthe guttata]
Length=432

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV+SSA  RRQ G SVLVTGAAGFVGSH SLALKKR
Sbjct  72   GGIQWEKQVRSSAQIRRQGGFSVLVTGAAGFVGSHVSLALKKR  114



>ref|XP_002309376.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
 gb|EEE92899.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
Length=431

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            TG   L A++ GG  WEKQ++ SA   R NGMSVLVTGAAGFVGSH SLALKKR
Sbjct  61   TGSRYLTASW-GGIQWEKQIRHSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKR  113



>ref|XP_007218024.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
 ref|XP_008232642.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Prunus mume]
 gb|EMJ19223.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
Length=435

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 54/90 (60%), Gaps = 10/90 (11%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + + LILIFFF    P          RR+L T           GG AWEK+V+SSA
Sbjct  39   FWSFIFLGLILIFFF--RSPSSNSLPSDPSRRSLRTYNW--------GGPAWEKRVRSSA  88

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R ++GMSVLVTGAAGFVG+H S ALK+R
Sbjct  89   RVRSRHGMSVLVTGAAGFVGTHVSAALKRR  118



>ref|XP_011079342.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV+SSA   RQNG SVLVTGAAGFVG+H SLALKKR
Sbjct  72   GGIQWEKQVRSSAQIHRQNGFSVLVTGAAGFVGTHVSLALKKR  114



>ref|NP_191922.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
 sp|O81312.1|GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3; AltName: Full=UDP-glucuronic 
acid epimerase 3 [Arabidopsis thaliana]
 gb|AAC19298.1| contains similarity to nucleotide sugar epimerases [Arabidopsis 
thaliana]
 emb|CAB80769.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|ABH04594.1| At4g00110 [Arabidopsis thaliana]
 gb|AEE81824.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
Length=430

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 54/90 (60%), Gaps = 11/90 (12%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + V LI IFF+     P++ +     RR+L T           GG AWEK+V+SSA
Sbjct  35   FWSLVFVGLIFIFFYR---SPVSSNPADPSRRSLRTYSW--------GGPAWEKRVRSSA  83

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R + G SVLVTGAAGFVG+H S ALK+R
Sbjct  84   RLRTRRGFSVLVTGAAGFVGTHVSAALKRR  113



>ref|XP_011069826.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV+ SA   RQNG SVLVTGAAGFVGSH SLALKKR
Sbjct  72   GGIHWEKQVRDSAQIHRQNGFSVLVTGAAGFVGSHVSLALKKR  114



>ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 ref|XP_006490911.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Citrus sinensis]
 gb|ESR58515.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 gb|KDO85806.1| hypothetical protein CISIN_1g013602mg [Citrus sinensis]
Length=439

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 60/93 (65%), Gaps = 15/93 (16%)
 Frame = +1

Query  85   FRATLMVALILIFFF---TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQ  255
            F + + +A+ILIFFF   + N  P A+ S    RR+L T           GG A+EK+V+
Sbjct  42   FWSFIFLAVILIFFFRSPSSNPLPSADPS----RRSLRTYDW--------GGPAFEKRVR  89

Query  256  SSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            SSA  R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  90   SSARVRARNGISVLVTGAAGFVGTHVSAALKRR  122



>ref|XP_008351675.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 55/90 (61%), Gaps = 10/90 (11%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + + LILIFFF    P    S     RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFFHSPSPNSLPSDPS--RRSLRTYNW--------GGXAWEKRVRSSA  91

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R ++G+SVLVTGAAGFVG+H S ALK+R
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRR  121



>ref|XP_009342752.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Pyrus x bretschneideri]
Length=438

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 55/90 (61%), Gaps = 10/90 (11%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + + LILIFFF    P    S     RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFFHSPSPNSLPSDPS--RRSLRTYNW--------GGPAWEKRVRSSA  91

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R ++G+SVLVTGAAGFVG+H S ALK+R
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRR  121



>ref|XP_004144711.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus]
 gb|KGN61076.1| UDP-glucuronate 5-epimerase [Cucumis sativus]
Length=431

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV+ SA P R NG SV+VTGAAGFVGSH SLALKKR
Sbjct  71   GGIQWEKQVRISAQPHRTNGFSVVVTGAAGFVGSHVSLALKKR  113



>ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+R
Sbjct  61   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRR  113



>ref|XP_007154841.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
 gb|ESW26835.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
Length=431

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+R
Sbjct  61   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRR  113



>gb|ACN26174.1| unknown [Zea mays]
Length=249

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 7/55 (13%)
 Frame = +1

Query  208  LAATFSGGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            LAA++ GG  WE+Q+++SA PRR  G      MSVLVTGAAGFVG+HCSLAL+KR
Sbjct  19   LAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  72



>gb|KEH16056.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=421

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 55/90 (61%), Gaps = 12/90 (13%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + L   +I   FF     P + SS   RR +L T  +        GGAAWEK+V+SSA
Sbjct  27   FWSILFFGVIYFLFFRT---PSSFSSDTSRR-SLRTYNY--------GGAAWEKKVRSSA  74

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
                +NG+SVLVTGAAGFVGSH S+ALK+R
Sbjct  75   KVTSKNGVSVLVTGAAGFVGSHVSIALKRR  104



>gb|KFK30589.1| hypothetical protein AALP_AA6G001300 [Arabis alpina]
Length=432

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 54/90 (60%), Gaps = 10/90 (11%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + V LI IFF+    P     S    RR+L T           GG AWEK+V+SSA
Sbjct  36   FWSLVFVGLIFIFFY--RSPSSNPVSSDPSRRSLRTYSW--------GGPAWEKRVRSSA  85

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R ++G+SVLVTGAAGFVG+H S ALK+R
Sbjct  86   RVRTRHGVSVLVTGAAGFVGTHVSAALKRR  115



>ref|XP_010909513.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 3-like 
[Elaeis guineensis]
Length=469

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 55/105 (52%), Gaps = 23/105 (22%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESS--------------GGGRRRALHTTGHSLLAATF  222
            F A L +A+    F     PP AE+               GG  RR+L T          
Sbjct  47   FWAFLAIAVFAALFLLSPXPPSAEADPPPSSSLGGAASGNGGQHRRSLRTASW-------  99

Query  223  SGGAAWEKQVQSSATPRRQ-NGMSVLVTGAAGFVGSHCSLALKKR  354
             GG AWEK+V+SSA  RRQ  G SVLVTGAAGFVG+H S ALKKR
Sbjct  100  -GGPAWEKRVRSSARIRRQLGGFSVLVTGAAGFVGTHVSAALKKR  143



>ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +G   L A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+R
Sbjct  61   SGSRYLTASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRR  113



>ref|XP_011010511.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
 ref|XP_011014870.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
Length=431

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            TG     A++ GG  WEKQ++ SA   R NGMSVLVTGAAGFVGSH SLALKKR
Sbjct  61   TGSRYFTASW-GGILWEKQIRHSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKR  113



>gb|KEH32594.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=434

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGF+GSH SLALK+R
Sbjct  65   SGSRYLSASW-GGIQWEKQVRASAQIHRQGGMSVLVTGAAGFIGSHVSLALKRR  117



>ref|XP_008364369.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 54/90 (60%), Gaps = 10/90 (11%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + + LILIFFF    P          RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFF--RSPSSNSLPSDPXRRSLRTYNW--------GGPAWEKRVRSSA  91

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R ++G+SVLVTGAAGFVG+H S ALK+R
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRR  121



>ref|XP_006286788.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
 gb|EOA19686.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
Length=438

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 50/71 (70%), Gaps = 6/71 (8%)
 Frame = +1

Query  142  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  321
            PP + S     RR L+ +  S+ AA + GG+ WEKQV+ SA PR   G++VLVTGA+GFV
Sbjct  55   PPPSPS-----RRNLNDSSSSVSAAKY-GGSHWEKQVRKSARPRTHGGLTVLVTGASGFV  108

Query  322  GSHCSLALKKR  354
            G+H S+AL++R
Sbjct  109  GTHVSIALRRR  119



>ref|XP_010914055.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQ+++SA PRR  G SVLVTGAAGFVG+H SLAL+KR
Sbjct  71   GGLHWEKQIRASAEPRRSQGFSVLVTGAAGFVGTHVSLALRKR  113



>ref|XP_001761984.1| predicted protein [Physcomitrella patens]
 gb|EDQ73088.1| predicted protein [Physcomitrella patens]
Length=446

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +1

Query  190  TTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            T G +LL A F    AW+ +V  S TP R+NG+ VLVTGAAGFVGSH SLALKKR
Sbjct  74   TNGGTLLPA-FKSDHAWDLKVAQSCTPERENGLVVLVTGAAGFVGSHVSLALKKR  127



>emb|CDO97699.1| unnamed protein product [Coffea canephora]
Length=437

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (62%), Gaps = 9/91 (10%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAES-SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  261
            F + + + LI +FFF        ES +    RR+L T+ +        GG  WEK++++S
Sbjct  38   FWSFVFLGLIFVFFFRSPSSSSPESLTADPSRRSLRTSSY--------GGPDWEKRIKAS  89

Query  262  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            A  R +NGMSVLVTGAAGFVG+H S ALK+R
Sbjct  90   AKVRSRNGMSVLVTGAAGFVGTHVSAALKRR  120



>emb|CDP21367.1| unnamed protein product [Coffea canephora]
Length=433

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV+SSA   R NG SVLVTGAAGFVGSH SLALKKR
Sbjct  72   GGHHWEKQVKSSAQIHRANGFSVLVTGAAGFVGSHVSLALKKR  114



>ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=444

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQ+++SAT RR  GMSVLVTGAAGFVG+H SLAL+KR
Sbjct  72   GGMHWEKQIRASATVRRPGGMSVLVTGAAGFVGTHVSLALRKR  114



>ref|XP_010433651.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Camelina sativa]
Length=436

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 50/71 (70%), Gaps = 6/71 (8%)
 Frame = +1

Query  142  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  321
            PP + S     RR L+ +  S+ AA + GG+ WEKQV+ SA PR   G++VLVTGA+GFV
Sbjct  56   PPPSPS-----RRNLNDSSSSVSAAKY-GGSHWEKQVRKSARPRSPGGLTVLVTGASGFV  109

Query  322  GSHCSLALKKR  354
            G+H S+AL++R
Sbjct  110  GTHVSIALRRR  120



>ref|XP_004513504.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cicer arietinum]
Length=426

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 56/90 (62%), Gaps = 12/90 (13%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + L V +I   FF     P + SS   RR +L T  +        GG+AWEK+V+SSA
Sbjct  33   FWSILFVGIIFFLFFRT---PSSFSSDTSRR-SLRTYNY--------GGSAWEKKVRSSA  80

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
                +NG++VLVTGAAGFVG+H S+ALK+R
Sbjct  81   RVTSKNGVTVLVTGAAGFVGTHTSIALKQR  110



>ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 9/90 (10%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + V LI +FF+       +  S    RR+L T+ +        GG AWEK++++S 
Sbjct  38   FWSLVFVGLIFVFFYRSPSS-SSHVSSDLFRRSLRTSSY--------GGPAWEKKIKAST  88

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
             PR  NG+ VLVTGAAGFVG+H S ALK+R
Sbjct  89   KPRSSNGLCVLVTGAAGFVGTHVSAALKRR  118



>emb|CDX86716.1| BnaA09g21060D [Brassica napus]
Length=434

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 7/71 (10%)
 Frame = +1

Query  142  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  321
            PP   S     RR+L+ +  SL +A   GG+ WEKQV+ SA PR + G++VLVTGAAGFV
Sbjct  55   PPPTPS-----RRSLNDS--SLSSAAKYGGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFV  107

Query  322  GSHCSLALKKR  354
            G+H S+AL++R
Sbjct  108  GTHVSIALRRR  118



>ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
 gb|KGN56607.1| UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
Length=432

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 10/90 (11%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + +++  ILIFFF       +       RR+L T           GG AWEK+V+SSA
Sbjct  36   FWSLVILGSILIFFFRSPS--SSPLPSDHSRRSLSTYDW--------GGPAWEKRVRSSA  85

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R +NG+SVLVTGAAGFVG+H S+ALK+R
Sbjct  86   RVRSRNGISVLVTGAAGFVGTHVSVALKRR  115



>ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
Length=438

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 10/90 (11%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + +++  ILIFFF       +       RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSLVILGSILIFFFRSPS--SSPLPSDHSRRSLSTYDW--------GGPAWEKRVRSSA  91

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R +NG+SVLVTGAAGFVG+H S+ALK+R
Sbjct  92   RVRSRNGISVLVTGAAGFVGTHVSVALKRR  121



>emb|CDX94504.1| BnaC09g23320D [Brassica napus]
Length=435

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 51/71 (72%), Gaps = 8/71 (11%)
 Frame = +1

Query  142  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  321
            PP   S     RR+L+ +  SL AA + GG+ WEKQV+ SA PR + G++VLVTGAAGFV
Sbjct  55   PPPTPS-----RRSLNDS--SLSAAKY-GGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFV  106

Query  322  GSHCSLALKKR  354
            G+H S+AL++R
Sbjct  107  GTHVSIALRRR  117



>ref|XP_002301280.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
 gb|EEE80553.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
Length=435

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 52/88 (59%), Gaps = 7/88 (8%)
 Frame = +1

Query  91   ATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATP  270
            ++L VALI +FF+                R         LA+   GGAAWEK+V++SA  
Sbjct  38   SSLFVALIFLFFYRSPSSSSNNPPSSDPSR-------RYLASANWGGAAWEKRVRTSARI  90

Query  271  RRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            R +NG SVLVTGAAGFVG+H S ALK+R
Sbjct  91   RSRNGFSVLVTGAAGFVGTHVSSALKRR  118



>ref|XP_001769370.1| predicted protein [Physcomitrella patens]
 gb|EDQ65739.1| predicted protein [Physcomitrella patens]
Length=450

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 68/115 (59%), Gaps = 3/115 (3%)
 Frame = +1

Query  10   KLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRRALH  189
            K+ER +SY  RV S     AS++LL  +  ++A+ +   F I      +   GG   A  
Sbjct  18   KVER-SSYFGRVASRWHSTASARLLVFSAFLLAVTIFICFRIAANGFVDVYIGGT--AYS  74

Query  190  TTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +T    + + +     W+K+V+ S TP+R+NG+ VLVTGAAGFVGSH SLALKKR
Sbjct  75   STNGGTIRSAYRSDHLWDKKVRQSCTPKRENGLVVLVTGAAGFVGSHVSLALKKR  129



>ref|XP_010053904.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW78281.1| hypothetical protein EUGRSUZ_D02464 [Eucalyptus grandis]
Length=436

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GGAAWEK+V+SSA  R +NGMSVLVTGAAGFVG+H S ALK+R
Sbjct  77   GGAAWEKRVRSSARIRSRNGMSVLVTGAAGFVGTHVSAALKRR  119



>ref|XP_010687680.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=434

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV++SA   R  GMSVLVTGAAGFVGSH SLALKKR
Sbjct  74   GGIQWEKQVRTSAQIHRSGGMSVLVTGAAGFVGSHVSLALKKR  116



>gb|EYU34305.1| hypothetical protein MIMGU_mgv1a006903mg [Erythranthe guttata]
Length=427

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV++SA   R NG SVLVTGAAGFVGSH SLALKKR
Sbjct  72   GGIHWEKQVRASAQIHRHNGFSVLVTGAAGFVGSHVSLALKKR  114



>ref|XP_009591830.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009591831.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009802117.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana sylvestris]
Length=435

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 9/90 (10%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + + LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSFVFLGLIFVFFYRSPAS-SSPVSSDLSRRSLRTSSY--------GGPAWEKRIKASA  88

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R +NG+SVLVTGAAGFVG+H S+ALK+R
Sbjct  89   KVRSRNGISVLVTGAAGFVGTHVSVALKRR  118



>ref|XP_010523080.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523081.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X2 [Tarenaya 
hassleriana]
Length=435

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 52/90 (58%), Gaps = 10/90 (11%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + +   LI IFF+    P     S    RR+L T           GG  WEK+V+SSA
Sbjct  39   FWSLVFTGLIFIFFY--RSPSSNPISSAPSRRSLRTYSW--------GGPDWEKRVRSSA  88

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  89   RVRTRNGISVLVTGAAGFVGTHVSAALKRR  118



>ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
Length=435

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 55/90 (61%), Gaps = 9/90 (10%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F A + V LI +FF+      ++  S    RR+L T+ +        GG  WEK+++SSA
Sbjct  38   FWALVFVGLIFVFFYRSPNS-VSNVSSDLSRRSLRTSSY--------GGPVWEKKIKSSA  88

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R +NG+ VLVTGAAGFVG+H S ALK+R
Sbjct  89   KIRSKNGICVLVTGAAGFVGTHVSAALKRR  118



>ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Solanum lycopersicum]
Length=435

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 9/90 (10%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + + LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSFVFLGLIFVFFYRSPAS-SSPVSSDLSRRSLRTSSY--------GGPAWEKRIKASA  88

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R +NG+SVLVTGAAGFVG+H S+ALK+R
Sbjct  89   KVRSRNGISVLVTGAAGFVGTHVSVALKRR  118



>ref|NP_001142515.1| hypothetical protein [Zea mays]
 gb|ACG24575.1| hypothetical protein [Zea mays]
 gb|ACN27084.1| unknown [Zea mays]
 gb|AFW73831.1| hypothetical protein ZEAMMB73_770166 [Zea mays]
Length=439

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 7/60 (12%)
 Frame = +1

Query  193  TGHSLLAATFSGGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            T    LAA++ GG  WE+Q+++SA PRR  G      MSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYLAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119



>ref|XP_004506538.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cicer arietinum]
Length=440

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 9/83 (11%)
 Frame = +1

Query  106  ALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNG  285
            A ILIFFF    P  +       RR+L +  +        GG  WEK+V+SSA  R +NG
Sbjct  50   AAILIFFF--RSPATSPLPADPSRRSLRSPSNW-------GGPIWEKRVRSSARVRSRNG  100

Query  286  MSVLVTGAAGFVGSHCSLALKKR  354
            +SVLVTGAAGFVG+H S ALK+R
Sbjct  101  LSVLVTGAAGFVGTHVSAALKRR  123



>ref|XP_010047039.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Eucalyptus grandis]
 gb|KCW78789.1| hypothetical protein EUGRSUZ_C00223 [Eucalyptus grandis]
Length=442

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 58/92 (63%), Gaps = 15/92 (16%)
 Frame = +1

Query  91   ATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATP  270
            AT M AL L+   T +Y  L         + L ++G+ LLAA++ GG  WEKQV+ SA P
Sbjct  43   ATFMWALFLLAL-TASYLSL---------QGLLSSGNRLLAASW-GGIQWEKQVRVSARP  91

Query  271  RRQNGM----SVLVTGAAGFVGSHCSLALKKR  354
            RR  G     SVLVTGAAGFVG+H SLAL+KR
Sbjct  92   RRPAGAGAGHSVLVTGAAGFVGAHVSLALRKR  123



>ref|XP_010525760.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Tarenaya hassleriana]
Length=431

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +G   L+A++ GG  WEKQV++SA   R  G+SVLVTGAAGFVGSH SLALKKR
Sbjct  58   SGSKYLSASW-GGIQWEKQVRTSAEIHRSGGISVLVTGAAGFVGSHVSLALKKR  110



>ref|XP_011018096.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Populus euphratica]
Length=431

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQ+++SA   R  GMSVLVTGAAGFVGSH SLALKKR
Sbjct  71   GGIQWEKQIRNSAQIHRSKGMSVLVTGAAGFVGSHVSLALKKR  113



>ref|XP_002324510.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
 gb|EEF03075.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
Length=431

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQ+++SA   R  GMSVLVTGAAGFVGSH SLALKKR
Sbjct  71   GGIQWEKQIRNSAQIHRSKGMSVLVTGAAGFVGSHVSLALKKR  113



>ref|XP_010539945.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Tarenaya hassleriana]
Length=437

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +1

Query  178  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            R L+ +  S+  AT+ GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL +R
Sbjct  62   RNLNKSSSSVSPATY-GGSQWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALHRR  119



>ref|XP_002872971.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49230.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 52/90 (58%), Gaps = 12/90 (13%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + V LI IFF    Y     S+    RR+L T           GG AWEK+V+SSA
Sbjct  35   FWSLVFVGLIFIFF----YRSPVSSNPDPSRRSLRTYSW--------GGPAWEKRVRSSA  82

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R + G SVLVTGAAGFVG+H S ALK+R
Sbjct  83   RVRTRRGFSVLVTGAAGFVGTHVSAALKRR  112



>ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
 sp|Q9LPC1.1|GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2; AltName: Full=UDP-glucuronic 
acid epimerase 2 [Arabidopsis thaliana]
 gb|AAF76478.1|AC020622_12 Contains similarity to CAPI protein from Staphylococcus aureus 
gi|P39858 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain. ESTs gb|N97076, gb|AI997010 come from this 
gene [Arabidopsis thaliana]
 gb|AAG50112.1|AF334734_1 putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE27364.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
Length=434

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 13/90 (14%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + +   L+ IFF+     P+  S+    RR+L T           GG AWEK+V+SSA
Sbjct  38   FWSLVFFGLLFIFFYR---SPI--SNPDSSRRSLRTYSW--------GGPAWEKRVRSSA  84

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  85   RVRTRNGVSVLVTGAAGFVGTHVSAALKRR  114



>ref|XP_008438174.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=432

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 55/90 (61%), Gaps = 10/90 (11%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + +++  ILIFFF       +       RR+L T           GG +WEK+V+SSA
Sbjct  36   FWSLVILGSILIFFFRSPS--SSPLPSDHSRRSLSTYDW--------GGPSWEKRVRSSA  85

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R +NG+SVLVTGAAGFVG+H S+ALK+R
Sbjct  86   RVRSRNGISVLVTGAAGFVGTHVSVALKRR  115



>gb|AAM61323.1| nucleotide sugar epimerase, putative [Arabidopsis thaliana]
Length=419

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 13/90 (14%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + +   L+ IFF+     P+  S+    RR+L T           GG AWEK+V+SSA
Sbjct  23   FWSLVFFGLLFIFFYR---SPI--SNPDSSRRSLRTYSW--------GGPAWEKRVRSSA  69

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  70   RVRTRNGVSVLVTGAAGFVGTHVSAALKRR  99



>ref|XP_008354844.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=432

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 53/90 (59%), Gaps = 10/90 (11%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + + +ILIFFF    P          RR+L T           GG AWEK V+SSA
Sbjct  36   FWSFVFLGMILIFFF--RSPSSNSLPSDPSRRSLRTYNW--------GGPAWEKXVRSSA  85

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R ++G+SVLVTGAAGFVG+H S ALK+R
Sbjct  86   RVRSRHGISVLVTGAAGFVGTHVSAALKRR  115



>ref|XP_010268405.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nelumbo nucifera]
Length=431

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV++SA  RR  GMSVLVTG AGFVG+H SLALKKR
Sbjct  69   GGIQWEKQVRTSAQIRRSGGMSVLVTGGAGFVGTHVSLALKKR  111



>ref|XP_008372097.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Malus domestica]
Length=432

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV++SA   R  GMSVL+TGAAGFVGSH SLALKKR
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLITGAAGFVGSHVSLALKKR  114



>ref|XP_006477270.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Citrus sinensis]
 gb|KDO63776.1| hypothetical protein CISIN_1g042406mg [Citrus sinensis]
Length=424

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 38/52 (73%), Gaps = 4/52 (8%)
 Frame = +1

Query  211  AATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +ATF    SGG  WEKQ+  S  PR   G++VLVTGAAGFVGSH SLALKKR
Sbjct  51   SATFRRHSSGGPQWEKQIVKSTRPRSTRGLTVLVTGAAGFVGSHVSLALKKR  102



>ref|XP_001767292.1| predicted protein [Physcomitrella patens]
 gb|EDQ67973.1| predicted protein [Physcomitrella patens]
Length=446

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 60/115 (52%), Gaps = 4/115 (3%)
 Frame = +1

Query  10   KLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRRALH  189
            K+ER N + R  N     A++   LF   L+   I I F  I    + E   G    A  
Sbjct  17   KMERSNYFGRVTNRWHTSASAKLFLFSVFLLAVTIFICF-RITANGMVE---GYMSTAYT  72

Query  190  TTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +T    + + F     W++++  S TP R +G+ VLVTGAAGFVGSH SLALKKR
Sbjct  73   STNGGTIRSAFKSDKVWDQKLLQSCTPERDDGLVVLVTGAAGFVGSHVSLALKKR  127



>ref|XP_006350062.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum tuberosum]
Length=431

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +1

Query  178  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            ++   +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVGSH S+ALKKR
Sbjct  56   QSFMDSGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGSHVSIALKKR  113



>ref|XP_007013947.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
 gb|EOY31566.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
Length=433

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +G   L A++ GG  WEKQV+SS+   R  GMSVLVTGAAGFVG+H SLALKKR
Sbjct  63   SGSRYLTASW-GGIQWEKQVRSSSQIHRSGGMSVLVTGAAGFVGTHVSLALKKR  115



>ref|XP_009786918.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nicotiana sylvestris]
Length=431

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +1

Query  178  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            ++   +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVG+H SLALKKR
Sbjct  56   QSFMDSGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGTHVSLALKKR  113



>ref|XP_009600710.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nicotiana tomentosiformis]
Length=431

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +1

Query  178  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            ++   +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVG+H SLALKKR
Sbjct  56   QSFMDSGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGTHVSLALKKR  113



>gb|KJB27036.1| hypothetical protein B456_004G273500 [Gossypium raimondii]
Length=403

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQ+++SA   R  GMSVLVTGAAGF+GSH SLALKKR
Sbjct  71   GGIQWEKQIRNSAKTNRPGGMSVLVTGAAGFIGSHVSLALKKR  113



>ref|XP_009390535.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQ+++SAT RR  G SVLVTGAAGFVG+H SLAL+KR
Sbjct  71   GGMQWEKQIRASATVRRPGGFSVLVTGAAGFVGTHVSLALRKR  113



>gb|AFW85530.1| hypothetical protein ZEAMMB73_797483 [Zea mays]
Length=413

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQN------GMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q+++SA+PRR++      G+SVLVTGAAGFVG+HCSLAL+KR
Sbjct  49   GGLHWERQIRASASPRRRSAPGAPAGLSVLVTGAAGFVGAHCSLALRKR  97



>gb|KJB27035.1| hypothetical protein B456_004G273500 [Gossypium raimondii]
Length=430

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQ+++SA   R  GMSVLVTGAAGF+GSH SLALKKR
Sbjct  71   GGIQWEKQIRNSAKTNRPGGMSVLVTGAAGFIGSHVSLALKKR  113



>ref|XP_004251783.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum lycopersicum]
Length=432

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVGSH S+ALKKR
Sbjct  61   SGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGSHVSIALKKR  113



>ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=435

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 55/90 (61%), Gaps = 9/90 (10%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + V LI +FF+      ++  S    RR+L T+ +        GG  WEK+++SSA
Sbjct  38   FWSLVFVGLIFVFFYRSPNS-VSNVSSDLSRRSLRTSSY--------GGPVWEKKIKSSA  88

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R +NG+ VLVTGAAGFVG+H S ALK+R
Sbjct  89   KIRSKNGICVLVTGAAGFVGTHVSAALKRR  118



>ref|XP_006396783.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
 gb|ESQ38236.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
Length=435

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 8/71 (11%)
 Frame = +1

Query  142  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  321
            PP + S     RR L+ +  S+ AA + GG+ WEKQV+ SA PR + G++VLVTGAAGFV
Sbjct  55   PPPSPS-----RRNLYDS--SVSAAKY-GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFV  106

Query  322  GSHCSLALKKR  354
            G+H S+AL++R
Sbjct  107  GTHVSIALRRR  117



>ref|XP_010103125.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
 gb|EXB94890.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
Length=432

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKR
Sbjct  71   GGIQWEKQVRTSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKR  113



>gb|ACJ11754.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=431

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +1

Query  172  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  351
            R ++   +G    +A++ GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKK
Sbjct  54   RFQSFVDSGSRYFSASW-GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKK  112

Query  352  R  354
            R
Sbjct  113  R  113



>ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 8/90 (9%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + + LI I FF       +  S    RR+L T+ +         G AWEK++++SA
Sbjct  37   FWSFVFLGLIFICFFKSTSSSSSPVSSDLSRRSLRTSSYD--------GPAWEKRIKASA  88

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R  NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  89   KIRSTNGISVLVTGAAGFVGTHVSSALKRR  118



>ref|XP_010278008.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nelumbo nucifera]
Length=433

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            TG   L A++ GG  WEKQV++SA  RR  G SVLVTG AGFVG+H SLALKKR
Sbjct  61   TGSRYLTASW-GGIQWEKQVRTSAEIRRSGGFSVLVTGGAGFVGTHVSLALKKR  113



>ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago truncatula]
 gb|AES87335.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=440

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 50/83 (60%), Gaps = 9/83 (11%)
 Frame = +1

Query  106  ALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNG  285
            A ILIFFF    P  +       RR+L +  +        GG  WEK+V+SSA  R +NG
Sbjct  50   AAILIFFF--RSPASSPLPADPSRRSLRSPSNW-------GGPVWEKRVRSSARVRSRNG  100

Query  286  MSVLVTGAAGFVGSHCSLALKKR  354
             SVLVTGAAGFVG+H S ALK+R
Sbjct  101  FSVLVTGAAGFVGTHVSAALKRR  123



>ref|XP_009348282.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Pyrus x bretschneideri]
Length=432

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKR
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKR  114



>ref|NP_001048359.1| Os02g0791500 [Oryza sativa Japonica Group]
 dbj|BAD19123.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 dbj|BAD19172.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 gb|ABC59069.1| UDP-glucuronic acid 4-epimerase isoform 2 [Oryza sativa Japonica 
Group]
 dbj|BAF10273.1| Os02g0791500 [Oryza sativa Japonica Group]
 gb|EAY87821.1| hypothetical protein OsI_09239 [Oryza sativa Indica Group]
 gb|EAZ24901.1| hypothetical protein OsJ_08679 [Oryza sativa Japonica Group]
Length=437

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q+++SA PRR  G      MSVLVTGAAGFVG+HCSLAL+KR
Sbjct  71   GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119



>gb|KDP38751.1| hypothetical protein JCGZ_04104 [Jatropha curcas]
Length=431

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKR
Sbjct  71   GGIQWEKQVRTSAQIHRTGGMSVLVTGAAGFVGTHVSLALKKR  113



>gb|KJB76605.1| hypothetical protein B456_012G096800 [Gossypium raimondii]
Length=431

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKR
Sbjct  71   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKR  113



>ref|XP_006648037.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Oryza brachyantha]
Length=437

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q+++SA PRR  G      MSVLVTGAAGFVG+HCSLAL+KR
Sbjct  71   GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119



>ref|XP_008223573.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Prunus mume]
Length=432

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKR
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKR  114



>ref|XP_007222381.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
 gb|EMJ23580.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
Length=432

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKR
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKR  114



>ref|XP_004954186.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=439

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q+++SA PRR  G      MSVLVTGAAGFVG+HCSLAL+KR
Sbjct  71   GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119



>ref|XP_002452964.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
 gb|EES05940.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
Length=439

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q+++SA PRR  G      MSVLVTGAAGFVG+HCSLAL+KR
Sbjct  71   GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119



>gb|KDP28767.1| hypothetical protein JCGZ_14538 [Jatropha curcas]
Length=435

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 52/90 (58%), Gaps = 9/90 (10%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + V +I +FF+               RR+L T+          GG+ WEK+V+SSA
Sbjct  37   FWSLVFVGVIFLFFYRSPSSSTNPLPSDPSRRSLRTSW---------GGSDWEKRVRSSA  87

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R +NG SVLVTGAAGFVG+H S ALK+R
Sbjct  88   RIRSRNGFSVLVTGAAGFVGTHVSAALKRR  117



>ref|XP_008781382.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Phoenix dactylifera]
Length=432

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQ+++SA  RR  G+SVLVTGAAGFVGSH SLAL+KR
Sbjct  71   GGLHWEKQIRASAEVRRPQGISVLVTGAAGFVGSHVSLALRKR  113



>ref|XP_006287814.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
 gb|EOA20712.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
Length=426

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 52/90 (58%), Gaps = 12/90 (13%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + V LI IFF    Y     S+    RR+L T           GG AWEK+V+SSA
Sbjct  32   FWSLVFVGLIFIFF----YRSPVSSNPDPSRRSLRTYSW--------GGPAWEKRVRSSA  79

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R + G SVLVTGAAGFVG+H S ALK+R
Sbjct  80   RLRFRRGFSVLVTGAAGFVGTHVSSALKRR  109



>ref|XP_006440401.1| hypothetical protein CICLE_v10020257mg [Citrus clementina]
 gb|ESR53641.1| hypothetical protein CICLE_v10020257mg [Citrus clementina]
Length=427

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQ+  S  PR  +G++VLVTGAAGFVGSH SLALKKR
Sbjct  63   GGPQWEKQIVKSTRPRSTSGLTVLVTGAAGFVGSHVSLALKKR  105



>ref|XP_011017483.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Populus euphratica]
Length=435

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  208  LAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            LA+   GGAAWEK+V++SA  R +NG SVLVTGAAGFVG+H S ALK+R
Sbjct  70   LASATWGGAAWEKRVRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRR  118



>ref|XP_008649176.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Zea mays]
Length=440

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q+++SA+PRR  G      +SVLVTGAAGFVG+HCSLAL+KR
Sbjct  71   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKR  119



>ref|XP_006359203.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 8/90 (9%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + + LI + FF       + +S    RR+L T+ +         G AWEK++++SA
Sbjct  37   FWSFVFLGLIFVCFFRSPSSSSSPASSDLSRRSLRTSSYD--------GPAWEKRIKASA  88

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  89   KIRSRNGISVLVTGAAGFVGTHVSSALKRR  118



>ref|XP_003564175.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Brachypodium distachyon]
Length=441

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q+++SA+PRR  G      +SVLVTGAAGFVG+HCSLAL+KR
Sbjct  72   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKR  120



>gb|KDO62346.1| hypothetical protein CISIN_1g043169mg [Citrus sinensis]
Length=421

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEK V+SSA   R  GMSVLVTGAAGFVG+H SLALKKR
Sbjct  71   GGIQWEKHVRSSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKR  113



>emb|CDP09891.1| unnamed protein product [Coffea canephora]
Length=454

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 16/80 (20%)
 Frame = +1

Query  142  PPLAESSG------GGRRRALHT---TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSV  294
            PP A S+       GG+RR+LHT    G SL       G  WE +  +SA P  ++G+SV
Sbjct  65   PPSATSTASNASVNGGKRRSLHTAAVVGPSL-------GPNWENRAWASARPASKSGLSV  117

Query  295  LVTGAAGFVGSHCSLALKKR  354
            LVTGA GFVG+H SLALKKR
Sbjct  118  LVTGAVGFVGAHVSLALKKR  137



>dbj|BAK06545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=443

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q+++SA+PRR  G      +SVLVTGAAGFVG+HCSLAL+KR
Sbjct  74   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKR  122



>ref|XP_002437985.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
 gb|EER89352.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
Length=440

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q+++SA+PRR  G      +SVLVTGAAGFVG+HCSLAL+KR
Sbjct  71   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKR  119



>ref|XP_002874760.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51019.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
Length=436

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 7/71 (10%)
 Frame = +1

Query  142  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  321
            PP + S     RR L+ +  S ++A   GG+ WEKQV+ SA PR + G++VLVTGA+GFV
Sbjct  55   PPPSPS-----RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSRGGLTVLVTGASGFV  107

Query  322  GSHCSLALKKR  354
            G+H S+AL++R
Sbjct  108  GTHVSIALRRR  118



>ref|NP_192962.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
 sp|Q9STI6.1|GAE5_ARATH RecName: Full=UDP-glucuronate 4-epimerase 5; AltName: Full=UDP-glucuronic 
acid epimerase 5 [Arabidopsis thaliana]
 emb|CAB45972.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 emb|CAB78268.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAN12948.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE83108.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
Length=436

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 7/71 (10%)
 Frame = +1

Query  142  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  321
            PP + S     RR L+ +  S ++A   GG+ WEKQV+ SA PR   G++VLVTGA+GFV
Sbjct  55   PPPSPS-----RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSHGGLTVLVTGASGFV  107

Query  322  GSHCSLALKKR  354
            G+H S+AL++R
Sbjct  108  GTHVSIALRRR  118



>ref|XP_002993206.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
 gb|EFJ05726.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
Length=455

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG+ WEK V+ SA  +R+NG+ VLVTGAAGFVG+H SLALKKR
Sbjct  86   GGSVWEKHVRHSAHAKRENGLVVLVTGAAGFVGTHVSLALKKR  128



>ref|XP_002965479.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
 gb|EFJ32899.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
Length=456

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG+ WEK V+ SA  +R+NG+ VLVTGAAGFVG+H SLALKKR
Sbjct  86   GGSVWEKHVRHSAHAKRENGLVVLVTGAAGFVGTHVSLALKKR  128



>ref|XP_006453511.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
 ref|XP_006474082.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Citrus sinensis]
 gb|ESR66751.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
Length=431

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEK V+SSA   R  GMSVLVTGAAGFVG+H SLALKKR
Sbjct  71   GGIQWEKHVRSSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKR  113



>dbj|BAD36515.1| putative uridine diphosphate galacturonate 4-epimerase [Oryza 
sativa Japonica Group]
 dbj|BAD72456.1| putative uridine diphosphate galacturonate 4-epimerase [Oryza 
sativa Japonica Group]
Length=453

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q+++SA+PRR  G      +SVLVTGAAGFVG+HCSLAL+KR
Sbjct  83   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGAHCSLALRKR  131



>gb|EAY99954.1| hypothetical protein OsI_21957 [Oryza sativa Indica Group]
Length=453

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q+++SA+PRR  G      +SVLVTGAAGFVG+HCSLAL+KR
Sbjct  83   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGAHCSLALRKR  131



>ref|XP_009114629.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Brassica 
rapa]
Length=435

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 51/71 (72%), Gaps = 8/71 (11%)
 Frame = +1

Query  142  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  321
            PP   S     RR+L+ +  SL +A + GG+ WEK+V+ SA PR + G++VLVTGAAGFV
Sbjct  55   PPPTPS-----RRSLNDS--SLSSAKY-GGSQWEKKVRKSAHPRSRGGLTVLVTGAAGFV  106

Query  322  GSHCSLALKKR  354
            G+H S+AL++R
Sbjct  107  GTHVSIALRRR  117



>gb|AAK93670.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
Length=436

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 7/71 (10%)
 Frame = +1

Query  142  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  321
            PP + S     RR L+ +  S ++A   GG+ WEKQV+ SA PR   G++VLVTGA+GFV
Sbjct  55   PPPSPS-----RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSHGGLTVLVTGASGFV  107

Query  322  GSHCSLALKKR  354
            G+H S+AL++R
Sbjct  108  GTHVSIALQRR  118



>ref|XP_004507780.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cicer arietinum]
Length=432

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTG+A FVGSH SLALK+R
Sbjct  64   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGSACFVGSHVSLALKRR  116



>ref|NP_001105911.1| LOC732831 [Zea mays]
 gb|ABB51650.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q+++SA PRR  G      MSVLVTGAAGFVG+HCSLAL++R
Sbjct  71   GGLHWERQIRASAVPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRRR  119



>ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG AWEK++++SA  R +NG+SVLVTGAAGFVG+H S+ALK+R
Sbjct  76   GGPAWEKRIKASAKVRSRNGISVLVTGAAGFVGTHVSVALKRR  118



>ref|XP_008677814.1| PREDICTED: LOC732831 isoform X1 [Zea mays]
 gb|ACF78800.1| unknown [Zea mays]
 gb|ACN28799.1| unknown [Zea mays]
 gb|ACR36221.1| unknown [Zea mays]
 gb|AFW64179.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q+++SA PRR  G      MSVLVTGAAGFVG+HCSLAL++R
Sbjct  71   GGLHWERQIRASAVPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRRR  119



>ref|XP_010661665.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=427

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 8/60 (13%)
 Frame = +1

Query  175  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            RR+L T  HS       GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  59   RRSLRT--HSW------GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRR  110



>ref|XP_002892033.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68292.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=434

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 54/90 (60%), Gaps = 13/90 (14%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + +   L+ IFF+     P+  S+    RR+L T           GG  WEK+V+SSA
Sbjct  38   FWSLVFFGLLFIFFYR---SPI--SNPDSSRRSLRTYSW--------GGPHWEKRVRSSA  84

Query  265  TPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
              R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  85   RVRTRNGVSVLVTGAAGFVGTHVSAALKRR  114



>ref|XP_011034154.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Populus euphratica]
Length=431

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +1

Query  205  LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            L +AT+ GGAAWEK+V++SA  R +NG SVLVTGAAGFVG+H S ALK+R
Sbjct  66   LTSATW-GGAAWEKRVRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRR  114



>ref|XP_002281007.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=433

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  74   GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRR  116



>gb|ABR16292.1| unknown [Picea sitchensis]
Length=437

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 66/115 (57%), Gaps = 16/115 (14%)
 Frame = +1

Query  10   KLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRRALH  189
            K+ER N Y  R  S++  ++ +KL F   ++V LI+IFF       +  SS    RR   
Sbjct  21   KMERSNIYFGR-GSTRWQSSVAKLFFWTVVVVGLIVIFF-------MRSSSPVETRR---  69

Query  190  TTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
                 LL+    GG  WEK+V+ S   + + G+ VLVTGAAGFVGSH SLALK+R
Sbjct  70   -----LLSTPHWGGHDWEKRVRYSCRVKTEKGIVVLVTGAAGFVGSHVSLALKRR  119



>dbj|BAJ85817.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96031.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96148.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88803.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q+++SA PRR  G      MSVLVTGA+GFVG+HCSLAL+KR
Sbjct  72   GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGASGFVGAHCSLALRKR  120



>ref|XP_008361335.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Malus domestica]
Length=432

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SL LKKR
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLGLKKR  114



>emb|CDY04398.1| BnaC02g28500D [Brassica napus]
Length=429

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG+ WEKQV+ SA PR   G++VLVTGAAGFVG+H S+AL++R
Sbjct  69   GGSHWEKQVRKSACPRSSGGLTVLVTGAAGFVGTHVSIALRRR  111



>ref|XP_002280967.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Vitis vinifera]
Length=433

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  74   GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRR  116



>ref|XP_009114630.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Brassica 
rapa]
Length=436

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  76   GGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  118



>gb|ADB24771.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB22312.1| hypothetical protein B456_004G040600 [Gossypium raimondii]
Length=435

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG AWEK+V+SSA  R +NG SVLVTGAAGFVG+H S ALKKR
Sbjct  76   GGPAWEKRVRSSARVRSRNGFSVLVTGAAGFVGTHVSSALKKR  118



>ref|XP_004296420.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Fragaria vesca subsp. 
vesca]
Length=434

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV++SA   R  GMS+LVTGAAGFVG+H S+ALKKR
Sbjct  74   GGIQWEKQVRNSAQIHRSGGMSILVTGAAGFVGTHVSVALKKR  116



>emb|CDX97356.1| BnaA02g21470D [Brassica napus]
Length=429

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  69   GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRR  111



>ref|XP_010422190.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Camelina 
sativa]
 ref|XP_010422191.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Camelina 
sativa]
 ref|XP_010422192.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X3 [Camelina 
sativa]
 ref|XP_010422193.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X4 [Camelina 
sativa]
 ref|XP_010455665.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Camelina sativa]
Length=435

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 7/71 (10%)
 Frame = +1

Query  142  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  321
            PP + S     RR L+ +  S ++A   GG+ WEKQV+ SA PR   G++VLVTGA+GFV
Sbjct  56   PPPSPS-----RRNLNDS--SSVSAAKYGGSHWEKQVRKSARPRSPGGLTVLVTGASGFV  108

Query  322  GSHCSLALKKR  354
            G+H S+AL++R
Sbjct  109  GTHVSIALRRR  119



>gb|KJB24820.1| hypothetical protein B456_004G162700 [Gossypium raimondii]
Length=433

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  74   GGPAWEKRVRSSARIRSRNGISVLVTGAAGFVGTHVSTALKRR  116



>ref|XP_009128629.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Brassica rapa]
Length=429

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  69   GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRR  111



>ref|XP_008443815.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis melo]
Length=432

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +G   L+A++ GG  WEKQV++SA   R  GMSVLVTGA+GFVG+H SLALK+R
Sbjct  62   SGTRYLSASW-GGLQWEKQVRTSAEISRSGGMSVLVTGASGFVGTHVSLALKRR  114



>ref|XP_006845469.1| hypothetical protein AMTR_s00019p00132110 [Amborella trichopoda]
 gb|ERN07144.1| hypothetical protein AMTR_s00019p00132110 [Amborella trichopoda]
Length=432

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG  WEKQV++S   RR  G++VLVTGAAGFVG+H SLALKKR
Sbjct  71   GGLHWEKQVRASCQTRRPGGLTVLVTGAAGFVGTHVSLALKKR  113



>gb|KGN65261.1| hypothetical protein Csa_1G277970 [Cucumis sativus]
Length=432

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            +G   L+A++ GG  WEKQV++SA   R  GMSVLVTGA+GFVG+H SLALK+R
Sbjct  62   SGTRYLSASW-GGLQWEKQVRTSAEITRSGGMSVLVTGASGFVGTHVSLALKRR  114



>ref|XP_010264164.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nelumbo nucifera]
Length=438

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  78   GGPAWEKRVRSSARVRARNGLSVLVTGAAGFVGTHVSAALKRR  120



>ref|XP_004966666.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=440

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 6/49 (12%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKR  354
            GG  WE+Q++SSA+PRR  G      +SVLVTGAAGFVG+HC+LAL++R
Sbjct  71   GGLHWERQIRSSASPRRPPGSAEGAGLSVLVTGAAGFVGTHCALALRRR  119



>ref|XP_010692224.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFS-GGAAWEKQVQSS  261
            F   + V LIL+F    +      +S    + ++ +T HS    TFS GG +WEK+V++S
Sbjct  43   FWCCIFVGLILVFMLRSSSSSSYSASDYRDKDSI-STRHSRSLRTFSWGGPSWEKRVRNS  101

Query  262  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
               R  NG SVLVTGAAGFVG+H S ALK+R
Sbjct  102  GRVRAPNGFSVLVTGAAGFVGTHVSAALKRR  132



>ref|XP_006853046.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
 gb|ERN14513.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
Length=439

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +1

Query  187  HTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            H  G +  AA++ GG AWEKQ++ S   RR N   VLVTGAAGF+G+H SLALKKR
Sbjct  66   HARGATTAAASW-GGPAWEKQLRRSCETRRANAQVVLVTGAAGFIGTHVSLALKKR  120



>ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXB76226.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=445

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  354
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  86   GGPAWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSSALKRR  128



>gb|EPS72617.1| hypothetical protein M569_02133, partial [Genlisea aurea]
Length=435

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 53/91 (58%), Gaps = 9/91 (10%)
 Frame = +1

Query  85   FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  264
            F + + + LI +FFF       A       RR+L TT        F GG  +E++V+ SA
Sbjct  33   FWSLVFLGLIFVFFFRSPASSSASVQSDLSRRSLRTT--------FYGGPEFERKVRGSA  84

Query  265  TPRR-QNGMSVLVTGAAGFVGSHCSLALKKR  354
              R  + GMSVLVTGAAGFVG+H SLALK+R
Sbjct  85   KVRSGRRGMSVLVTGAAGFVGTHVSLALKRR  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567748279395