BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF020L03

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP18577.1|  unnamed protein product                                248   8e-79   Coffea canephora [robusta coffee]
ref|XP_009787718.1|  PREDICTED: uncharacterized protein LOC104235612    245   6e-78   Nicotiana sylvestris
ref|XP_004228972.1|  PREDICTED: uncharacterized protein LOC101267925    233   2e-73   Solanum lycopersicum
ref|XP_010276434.1|  PREDICTED: uncharacterized protein LOC104611177    231   2e-72   Nelumbo nucifera [Indian lotus]
ref|XP_002285769.1|  PREDICTED: uncharacterized protein LOC100250...    224   1e-69   
ref|XP_010651409.1|  PREDICTED: uncharacterized protein LOC100250...    224   1e-69   
gb|EYU32819.1|  hypothetical protein MIMGU_mgv1a012602mg                221   2e-68   Erythranthe guttata [common monkey flower]
ref|XP_004144065.1|  PREDICTED: uncharacterized protein LOC101216...    217   2e-67   
ref|XP_004144064.1|  PREDICTED: uncharacterized protein LOC101216...    218   3e-67   Cucumis sativus [cucumbers]
ref|XP_011089758.1|  PREDICTED: uncharacterized protein LOC105170618    214   6e-66   Sesamum indicum [beniseed]
ref|XP_008450994.1|  PREDICTED: uncharacterized protein LOC103492410    214   9e-66   Cucumis melo [Oriental melon]
ref|XP_006348221.1|  PREDICTED: uncharacterized protein LOC102606203    209   8e-64   Solanum tuberosum [potatoes]
ref|XP_006445553.1|  hypothetical protein CICLE_v10016445mg             202   4e-61   Citrus clementina [clementine]
gb|KDO54525.1|  hypothetical protein CISIN_1g025242mg                   202   4e-61   Citrus sinensis [apfelsine]
ref|XP_010536807.1|  PREDICTED: uncharacterized protein LOC104811711    202   6e-61   Tarenaya hassleriana [spider flower]
ref|XP_010032828.1|  PREDICTED: uncharacterized protein LOC104422263    201   9e-61   Eucalyptus grandis [rose gum]
ref|XP_006488962.1|  PREDICTED: uncharacterized protein LOC102628779    201   1e-60   Citrus sinensis [apfelsine]
ref|XP_002869612.1|  hypothetical protein ARALYDRAFT_913923             198   2e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_007014648.1|  Uncharacterized protein TCM_039966                 196   6e-59   
ref|XP_011048149.1|  PREDICTED: uncharacterized protein LOC105142285    196   8e-59   Populus euphratica
ref|XP_002523392.1|  conserved hypothetical protein                     196   1e-58   Ricinus communis
gb|KFK29159.1|  hypothetical protein AALP_AA7G096800                    195   1e-58   Arabis alpina [alpine rockcress]
ref|XP_002299091.1|  hypothetical protein POPTR_0001s03860g             195   2e-58   Populus trichocarpa [western balsam poplar]
gb|KJB83394.1|  hypothetical protein B456_013G245200                    191   2e-57   Gossypium raimondii
gb|KJB83391.1|  hypothetical protein B456_013G245200                    190   1e-56   Gossypium raimondii
gb|KJB83395.1|  hypothetical protein B456_013G245200                    190   1e-56   Gossypium raimondii
gb|KJB83392.1|  hypothetical protein B456_013G245200                    190   1e-56   Gossypium raimondii
gb|KJB83396.1|  hypothetical protein B456_013G245200                    189   3e-56   Gossypium raimondii
gb|KHG03556.1|  Chromosome-associated kinesin KIF4                      187   2e-55   Gossypium arboreum [tree cotton]
ref|XP_010448277.1|  PREDICTED: uncharacterized protein LOC104730768    188   2e-55   Camelina sativa [gold-of-pleasure]
gb|KDP30630.1|  hypothetical protein JCGZ_16195                         185   1e-54   Jatropha curcas
ref|NP_194371.2|  uncharacterized protein                               186   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010673453.1|  PREDICTED: uncharacterized protein LOC104889828    185   2e-54   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH30817.1|  hypothetical protein MTR_4g083250                       184   3e-54   Medicago truncatula
ref|XP_010438763.1|  PREDICTED: uncharacterized protein LOC104722317    185   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010433511.1|  PREDICTED: uncharacterized protein LOC104717609    184   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_003607819.1|  hypothetical protein MTR_4g083250                  184   4e-54   Medicago truncatula
ref|XP_006284348.1|  hypothetical protein CARUB_v10005520mg             184   6e-54   Capsella rubella
gb|EPS63583.1|  hypothetical protein M569_11194                         182   1e-53   Genlisea aurea
ref|XP_009137593.1|  PREDICTED: uncharacterized protein LOC103861626    181   6e-53   Brassica rapa
emb|CDY42739.1|  BnaA03g48000D                                          181   1e-52   Brassica napus [oilseed rape]
ref|XP_003556589.1|  PREDICTED: uncharacterized protein LOC100780119    178   7e-52   Glycine max [soybeans]
gb|KHN20511.1|  hypothetical protein glysoja_029524                     178   8e-52   Glycine soja [wild soybean]
gb|ACU19454.1|  unknown                                                 177   8e-52   Glycine max [soybeans]
ref|XP_004505352.1|  PREDICTED: uncharacterized protein LOC101513717    177   2e-51   Cicer arietinum [garbanzo]
ref|XP_006413188.1|  hypothetical protein EUTSA_v10026011mg             177   2e-51   Eutrema salsugineum [saltwater cress]
emb|CDX89342.1|  BnaA01g15510D                                          176   1e-50   
ref|XP_009142234.1|  PREDICTED: uncharacterized protein LOC103866109    176   1e-50   Brassica rapa
ref|XP_006829819.1|  hypothetical protein AMTR_s00119p00084860          176   1e-50   Amborella trichopoda
ref|XP_007157828.1|  hypothetical protein PHAVU_002G101500g             173   8e-50   Phaseolus vulgaris [French bean]
emb|CDX94341.1|  BnaC01g18430D                                          171   6e-49   
ref|XP_003529452.1|  PREDICTED: uncharacterized protein LOC100808143    169   1e-48   Glycine max [soybeans]
gb|KHN42956.1|  hypothetical protein glysoja_007486                     169   3e-48   Glycine soja [wild soybean]
emb|CDX92771.1|  BnaC07g40290D                                          165   1e-46   
ref|XP_010105296.1|  hypothetical protein L484_002346                   161   1e-45   
ref|XP_003607823.1|  hypothetical protein MTR_4g083290                  164   3e-45   
gb|KDO54526.1|  hypothetical protein CISIN_1g025242mg                   156   2e-43   Citrus sinensis [apfelsine]
ref|XP_006413187.1|  hypothetical protein EUTSA_v10026011mg             154   2e-42   
ref|XP_004294933.1|  PREDICTED: uncharacterized protein LOC101308945    153   3e-42   Fragaria vesca subsp. vesca
ref|XP_008220369.1|  PREDICTED: uncharacterized protein LOC103320436    152   9e-42   Prunus mume [ume]
ref|XP_007205735.1|  hypothetical protein PRUPE_ppa010110mg             151   4e-41   Prunus persica
ref|XP_008384350.1|  PREDICTED: uncharacterized protein LOC103446960    144   2e-38   
ref|XP_009339217.1|  PREDICTED: uncharacterized protein LOC103931455    142   7e-38   Pyrus x bretschneideri [bai li]
ref|XP_009589516.1|  PREDICTED: uncharacterized protein LOC104086877    141   9e-38   
emb|CAA18229.1|  putative protein                                       142   1e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KJB83393.1|  hypothetical protein B456_013G245200                    130   3e-34   Gossypium raimondii
ref|XP_010921336.1|  PREDICTED: uncharacterized protein LOC105044929    132   7e-34   Elaeis guineensis
ref|XP_008781206.1|  PREDICTED: uncharacterized protein LOC103701046    129   9e-33   Phoenix dactylifera
ref|XP_002511643.1|  conserved hypothetical protein                     127   5e-32   Ricinus communis
gb|KDP28809.1|  hypothetical protein JCGZ_14580                         124   8e-31   Jatropha curcas
ref|XP_010258900.1|  PREDICTED: uncharacterized protein LOC104598502    122   3e-30   Nelumbo nucifera [Indian lotus]
ref|XP_008232561.1|  PREDICTED: uncharacterized protein LOC103331692    117   3e-28   Prunus mume [ume]
ref|XP_007052190.1|  Uncharacterized protein isoform 3                  116   7e-28   
ref|XP_007052188.1|  Uncharacterized protein isoform 1                  116   8e-28   
ref|XP_007052189.1|  Uncharacterized protein isoform 2                  116   8e-28   
ref|XP_004984525.1|  PREDICTED: uncharacterized protein LOC101782...    114   1e-27   Setaria italica
ref|XP_006838189.1|  hypothetical protein AMTR_s00106p00135890          114   3e-27   Amborella trichopoda
ref|XP_009393907.1|  PREDICTED: uncharacterized protein LOC103979471    112   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010053946.1|  PREDICTED: uncharacterized protein LOC104442278    112   1e-26   Eucalyptus grandis [rose gum]
ref|XP_002465337.1|  hypothetical protein SORBIDRAFT_01g036710          111   2e-26   Sorghum bicolor [broomcorn]
gb|KCW78323.1|  hypothetical protein EUGRSUZ_D02501                     112   3e-26   Eucalyptus grandis [rose gum]
ref|XP_011017444.1|  PREDICTED: uncharacterized protein LOC105120771    111   4e-26   Populus euphratica
gb|KDO85660.1|  hypothetical protein CISIN_1g024845mg                   110   4e-26   Citrus sinensis [apfelsine]
ref|XP_001760783.1|  predicted protein                                  112   6e-26   
ref|XP_009617840.1|  PREDICTED: uncharacterized protein LOC104110119    107   6e-26   
ref|XP_002302514.1|  hypothetical protein POPTR_0002s14390g             111   7e-26   Populus trichocarpa [western balsam poplar]
ref|NP_001049981.1|  Os03g0324800                                       109   9e-26   
ref|XP_010436412.1|  PREDICTED: uncharacterized protein LOC104720153    107   1e-25   Camelina sativa [gold-of-pleasure]
gb|KDO85659.1|  hypothetical protein CISIN_1g024845mg                   110   1e-25   Citrus sinensis [apfelsine]
ref|XP_006445337.1|  hypothetical protein CICLE_v10021755mg             110   1e-25   Citrus clementina [clementine]
ref|XP_008670078.1|  PREDICTED: uncharacterized protein LOC100276...    108   2e-25   
ref|XP_010456590.1|  PREDICTED: uncharacterized protein LOC104738049    107   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_004984524.1|  PREDICTED: uncharacterized protein LOC101782...    108   3e-25   Setaria italica
dbj|BAK05826.1|  predicted protein                                      108   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004306965.1|  PREDICTED: uncharacterized protein LOC101308610    109   4e-25   Fragaria vesca subsp. vesca
ref|XP_006650015.1|  PREDICTED: uncharacterized protein LOC102714271    107   5e-25   Oryza brachyantha
gb|EEC75161.1|  hypothetical protein OsI_11375                          106   9e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_010524407.1|  PREDICTED: uncharacterized protein LOC104802474    107   2e-24   Tarenaya hassleriana [spider flower]
ref|XP_002277999.1|  PREDICTED: uncharacterized protein LOC100266783    106   4e-24   Vitis vinifera
gb|KEH22362.1|  hypothetical protein MTR_7g445370                       106   5e-24   Medicago truncatula
ref|XP_003558009.1|  PREDICTED: uncharacterized protein LOC100838509    105   5e-24   Brachypodium distachyon [annual false brome]
gb|AFK35211.1|  unknown                                                 105   5e-24   Medicago truncatula
ref|XP_007052191.1|  Uncharacterized protein isoform 4                  105   9e-24   
ref|NP_566034.1|  uncharacterized protein                               104   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003538068.1|  PREDICTED: uncharacterized protein LOC100804339    103   3e-23   Glycine max [soybeans]
ref|XP_002881994.1|  hypothetical protein ARALYDRAFT_903941             103   3e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_006294796.1|  hypothetical protein CARUB_v10023846mg             103   3e-23   Capsella rubella
ref|XP_010508215.1|  PREDICTED: uncharacterized protein LOC104784826    103   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004229779.1|  PREDICTED: uncharacterized protein LOC101267648    103   6e-23   Solanum lycopersicum
emb|CDX83410.1|  BnaA03g20960D                                          101   9e-23   
gb|KJB09928.1|  hypothetical protein B456_001G175600                    102   1e-22   Gossypium raimondii
ref|XP_006294795.1|  hypothetical protein CARUB_v10023846mg             101   1e-22   
gb|AFK47092.1|  unknown                                                 102   1e-22   Lotus japonicus
gb|AFK39373.1|  unknown                                                 101   2e-22   Lotus japonicus
ref|XP_006397686.1|  hypothetical protein EUTSA_v10001582mg             101   3e-22   Eutrema salsugineum [saltwater cress]
ref|XP_010518116.1|  PREDICTED: uncharacterized protein LOC104793462    101   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010692135.1|  PREDICTED: uncharacterized protein LOC104905332    101   3e-22   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB09931.1|  hypothetical protein B456_001G175600                    101   3e-22   Gossypium raimondii
ref|XP_009385849.1|  PREDICTED: uncharacterized protein LOC103973101    101   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009776946.1|  PREDICTED: uncharacterized protein LOC104226615    100   4e-22   Nicotiana sylvestris
ref|XP_010506443.1|  PREDICTED: uncharacterized protein LOC104783...    100   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006375267.1|  hypothetical protein POPTR_0014s05780g             100   4e-22   
ref|XP_009142315.1|  PREDICTED: uncharacterized protein LOC103866188    100   6e-22   Brassica rapa
gb|KEH22363.1|  hypothetical protein MTR_7g445370                       100   9e-22   Medicago truncatula
emb|CDY37025.1|  BnaA04g26030D                                        99.8    1e-21   Brassica napus [oilseed rape]
ref|XP_011033296.1|  PREDICTED: uncharacterized protein LOC105131821  98.2    2e-21   Populus euphratica
ref|XP_009133693.1|  PREDICTED: uncharacterized protein LOC103858149  99.4    2e-21   Brassica rapa
gb|KHG03984.1|  Alanine--tRNA ligase                                  99.0    2e-21   Gossypium arboreum [tree cotton]
ref|XP_008459726.1|  PREDICTED: uncharacterized protein LOC103498769  98.6    3e-21   Cucumis melo [Oriental melon]
gb|KFK37300.1|  hypothetical protein AALP_AA4G239300                  98.6    3e-21   Arabis alpina [alpine rockcress]
ref|XP_006347915.1|  PREDICTED: uncharacterized protein LOC102584275  98.2    3e-21   Solanum tuberosum [potatoes]
ref|XP_010445295.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    4e-21   
emb|CDX95625.1|  BnaC03g25060D                                        97.8    9e-21   
ref|XP_004514234.1|  PREDICTED: uncharacterized protein LOC101491840  95.5    3e-20   Cicer arietinum [garbanzo]
ref|XP_008796934.1|  PREDICTED: uncharacterized protein LOC103712...  95.1    4e-20   Phoenix dactylifera
ref|XP_011093293.1|  PREDICTED: uncharacterized protein LOC105173298  95.1    4e-20   Sesamum indicum [beniseed]
ref|XP_008796933.1|  PREDICTED: uncharacterized protein LOC103712...  91.7    6e-19   
ref|XP_007140975.1|  hypothetical protein PHAVU_008G156600g           90.1    7e-19   Phaseolus vulgaris [French bean]
ref|XP_010506444.1|  PREDICTED: uncharacterized protein LOC104783...  90.9    1e-18   
gb|EYU42370.1|  hypothetical protein MIMGU_mgv1a023111mg              90.5    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_009337245.1|  PREDICTED: uncharacterized protein LOC103929743  89.7    4e-18   Pyrus x bretschneideri [bai li]
emb|CDY48625.1|  BnaC09g20600D                                        86.7    4e-18   Brassica napus [oilseed rape]
ref|XP_010934947.1|  PREDICTED: uncharacterized protein LOC105054...  89.4    5e-18   Elaeis guineensis
ref|XP_010934948.1|  PREDICTED: uncharacterized protein LOC105054...  89.0    5e-18   Elaeis guineensis
ref|XP_009631125.1|  PREDICTED: uncharacterized protein LOC104120950  87.8    7e-18   Nicotiana tomentosiformis
emb|CDY27396.1|  BnaC04g50090D                                        88.2    9e-18   Brassica napus [oilseed rape]
ref|XP_008375716.1|  PREDICTED: uncharacterized protein LOC103438950  88.2    1e-17   
ref|XP_009339857.1|  PREDICTED: uncharacterized protein LOC103932041  87.0    3e-17   Pyrus x bretschneideri [bai li]
gb|KGN46560.1|  hypothetical protein Csa_6G108580                     85.9    4e-17   Cucumis sativus [cucumbers]
ref|XP_004171485.1|  PREDICTED: uncharacterized LOC101214960          84.3    1e-16   
ref|XP_006375268.1|  hypothetical protein POPTR_0014s05780g           84.3    1e-16   
ref|XP_006423787.1|  hypothetical protein CICLE_v10029731mg           80.9    2e-16   
ref|XP_004140609.1|  PREDICTED: uncharacterized protein LOC101214960  84.3    3e-16   
ref|XP_001771369.1|  predicted protein                                84.0    5e-16   
ref|XP_007220768.1|  hypothetical protein PRUPE_ppa024369mg           80.9    2e-15   
emb|CDP09483.1|  unnamed protein product                              81.6    2e-15   Coffea canephora [robusta coffee]
ref|XP_002983323.1|  hypothetical protein SELMODRAFT_445444           80.1    2e-14   Selaginella moellendorffii
ref|XP_002987624.1|  hypothetical protein SELMODRAFT_447060           79.3    5e-14   Selaginella moellendorffii
gb|EPS62058.1|  hypothetical protein M569_12732                       76.3    1e-13   Genlisea aurea
ref|XP_011396980.1|  hypothetical protein F751_1359                   72.8    2e-12   Auxenochlorella protothecoides
ref|XP_006659070.1|  PREDICTED: uncharacterized protein LOC102721384  68.6    8e-11   Oryza brachyantha
ref|NP_001144763.1|  uncharacterized protein LOC100277822             67.8    2e-10   Zea mays [maize]
gb|AFW66822.1|  hypothetical protein ZEAMMB73_141697                  67.4    2e-10   
gb|EEC75159.1|  hypothetical protein OsI_11373                        66.2    3e-10   Oryza sativa Indica Group [Indian rice]
dbj|BAJ98005.1|  predicted protein                                    66.6    4e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN64905.1|  hypothetical protein VITISV_042831                   67.8    6e-10   Vitis vinifera
ref|XP_005846915.1|  hypothetical protein CHLNCDRAFT_134807           65.9    1e-09   Chlorella variabilis
gb|EMT05527.1|  hypothetical protein F775_07413                       64.3    1e-09   
gb|EEE56139.1|  hypothetical protein OsJ_05019                        65.1    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045615.1|  Os02g0104800                                     65.5    1e-09   
ref|XP_004951200.1|  PREDICTED: uncharacterized protein LOC101766807  65.5    1e-09   Setaria italica
ref|XP_006375269.1|  hypothetical protein POPTR_0014s05780g           63.5    2e-09   
gb|EMS57790.1|  hypothetical protein TRIUR3_22595                     62.4    2e-09   Triticum urartu
ref|XP_003570319.1|  PREDICTED: uncharacterized protein LOC100834616  64.7    3e-09   Brachypodium distachyon [annual false brome]
gb|EEC72302.1|  hypothetical protein OsI_05485                        64.3    3e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_003078117.1|  unnamed protein product                          63.2    4e-09   
gb|EMT21115.1|  hypothetical protein F775_32566                       62.8    4e-09   
gb|AEJ54427.1|  hypothetical protein                                  60.1    4e-09   Fagopyrum esculentum subsp. ancestrale
emb|CEF97085.1|  unnamed product                                      63.2    6e-09   Ostreococcus tauri
ref|XP_001416629.1|  predicted protein                                61.2    1e-08   Ostreococcus lucimarinus CCE9901
gb|KHN10117.1|  hypothetical protein glysoja_048900                   59.3    4e-08   Glycine soja [wild soybean]
gb|KDD75675.1|  hypothetical protein H632_c557p1                      60.1    8e-08   Helicosporidium sp. ATCC 50920
gb|KJB09930.1|  hypothetical protein B456_001G175600                  52.8    1e-05   Gossypium raimondii
gb|KJB09929.1|  hypothetical protein B456_001G175600                  49.3    2e-04   Gossypium raimondii



>emb|CDP18577.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   248 bits (633),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 141/179 (79%), Gaps = 2/179 (1%)
 Frame = +2

Query  56   VPSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLR  235
            VP + I  TS+        + DK WH+YISEDLPRTVQ+STDSA+RSAR F ++SS H R
Sbjct  18   VPESSI--TSASPSKDKSDKADKTWHSYISEDLPRTVQQSTDSALRSARSFHHSSSTHFR  75

Query  236  SLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRN  415
            +L+DF+PQL SQY+ YEDA F K+KDE+   RE+PAV GGIAVA GL+  RGPRRFLFR+
Sbjct  76   TLRDFMPQLGSQYRTYEDAFFLKIKDELTKVRENPAVTGGIAVAVGLLLFRGPRRFLFRH  135

Query  416  TLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            TLGRF+SEEAQF +AEKNVKEL LSVDLMKKESGKL ERAALA  EMK G  +LMNAG 
Sbjct  136  TLGRFQSEEAQFIRAEKNVKELNLSVDLMKKESGKLLERAALAEKEMKHGQIDLMNAGV  194



>ref|XP_009787718.1| PREDICTED: uncharacterized protein LOC104235612 [Nicotiana sylvestris]
Length=249

 Score =   245 bits (626),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +2

Query  59   PSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRS  238
            P+ +ID +SS  P  + Q ++K WH+YISEDLPRTVQESTDSA+RSAR  Q TSS HLR+
Sbjct  7    PAVDIDPSSSSLPLPS-QNKEKAWHSYISEDLPRTVQESTDSALRSARSIQYTSSTHLRT  65

Query  239  LQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNT  418
            LQDF+P++ +QY  YE+  F+K+KDE+  AREHPA+ GGI +A GL+ MRGPRRFLFR T
Sbjct  66   LQDFMPKIKAQYTTYEEVFFRKIKDELVTAREHPAMAGGIGIAAGLLLMRGPRRFLFRQT  125

Query  419  LGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            LGR +SEEA+F+KAEKNVKEL LSVDLMKKES KL ERAALA  +MKRG S+LM+AG
Sbjct  126  LGRLQSEEAKFSKAEKNVKELSLSVDLMKKESKKLLERAALAEKDMKRGLSDLMDAG  182



>ref|XP_004228972.1| PREDICTED: uncharacterized protein LOC101267925 [Solanum lycopersicum]
Length=233

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  116  RDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDAL  295
            ++K WH+YISEDLPRTVQ+ST SAIRSAR  QNTSS HLR+LQDF+P++  QY+ YE+  
Sbjct  9    QNKVWHSYISEDLPRTVQQSTYSAIRSARSIQNTSSTHLRTLQDFMPKIKGQYRTYEEVF  68

Query  296  FQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVK  475
            F+K+KDE+  AREHPA+ GGI +A GL+  RGPRRFL+R TLGR +SEEA+F KAEKNVK
Sbjct  69   FRKIKDELVSAREHPALAGGIGIAAGLLLTRGPRRFLYRQTLGRLQSEEAKFIKAEKNVK  128

Query  476  ELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            EL LSV LMKKES KL ERA+LA  +MKRGHS+LM AG 
Sbjct  129  ELGLSVGLMKKESKKLLERASLAEKDMKRGHSDLMVAGN  167



>ref|XP_010276434.1| PREDICTED: uncharacterized protein LOC104611177 [Nelumbo nucifera]
Length=248

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 131/169 (78%), Gaps = 3/169 (2%)
 Frame = +2

Query  83   SSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQL  262
            SSP  A+   Q  KPWHAY +EDL +TV  +TDSA+RSAR  Q  SS H RSLQ F  QL
Sbjct  16   SSPREAS---QEQKPWHAYTAEDLKQTVFGTTDSALRSARSLQENSSTHFRSLQTFTAQL  72

Query  263  SSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEE  442
             SQYK YEDA+F+KVKDE+  A+EHPAV GGIAV  GL+ MRGPRRFLFR+TLGR +SEE
Sbjct  73   KSQYKTYEDAVFKKVKDELMSAQEHPAVAGGIAVTAGLLLMRGPRRFLFRHTLGRLQSEE  132

Query  443  AQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            AQF +AEKNVKEL LSVDLMK ES KL ERA LA  +MKRG+ +LMNAG
Sbjct  133  AQFLRAEKNVKELTLSVDLMKNESKKLLERATLAEKDMKRGYDQLMNAG  181



>ref|XP_002285769.1| PREDICTED: uncharacterized protein LOC100250144 isoform X2 [Vitis 
vinifera]
 emb|CBI16570.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 140/186 (75%), Gaps = 9/186 (5%)
 Frame = +2

Query  44   MASDVPSTEIDETSSPAPA---ATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQN  214
            MA   PS      S+PAPA   +  QQ+ KPWH   +EDL RTV ES DSAIRSA   Q 
Sbjct  1    MAEATPS------SAPAPADGESISQQQQKPWHISFAEDLQRTVSESADSAIRSALSLQQ  54

Query  215  TSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGP  394
             SS HLRSLQ+F+PQ+ SQY+ YEDA F+KVKDE+  A+EHP VVG +AV  GLIF+RGP
Sbjct  55   NSSSHLRSLQEFIPQMESQYRTYEDAFFKKVKDELTSAKEHPVVVGAVAVTAGLIFLRGP  114

Query  395  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  574
            RRFLF +TLGRF+SEEAQF +AEKNVKEL LSVDLMK ES KL ERAALA  +MK GH+E
Sbjct  115  RRFLFHHTLGRFQSEEAQFVRAEKNVKELNLSVDLMKNESRKLLERAALAEKDMKCGHTE  174

Query  575  LMNAGT  592
            LMN G+
Sbjct  175  LMNTGS  180



>ref|XP_010651409.1| PREDICTED: uncharacterized protein LOC100250144 isoform X1 [Vitis 
vinifera]
Length=252

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 140/186 (75%), Gaps = 9/186 (5%)
 Frame = +2

Query  44   MASDVPSTEIDETSSPAPA---ATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQN  214
            MA   PS      S+PAPA   +  QQ+ KPWH   +EDL RTV ES DSAIRSA   Q 
Sbjct  1    MAEATPS------SAPAPADGESISQQQQKPWHISFAEDLQRTVSESADSAIRSALSLQQ  54

Query  215  TSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGP  394
             SS HLRSLQ+F+PQ+ SQY+ YEDA F+KVKDE+  A+EHP VVG +AV  GLIF+RGP
Sbjct  55   NSSSHLRSLQEFIPQMESQYRTYEDAFFKKVKDELTSAKEHPVVVGAVAVTAGLIFLRGP  114

Query  395  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  574
            RRFLF +TLGRF+SEEAQF +AEKNVKEL LSVDLMK ES KL ERAALA  +MK GH+E
Sbjct  115  RRFLFHHTLGRFQSEEAQFVRAEKNVKELNLSVDLMKNESRKLLERAALAEKDMKCGHTE  174

Query  575  LMNAGT  592
            LMN G+
Sbjct  175  LMNTGS  180



>gb|EYU32819.1| hypothetical protein MIMGU_mgv1a012602mg [Erythranthe guttata]
Length=245

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +2

Query  128  WHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKV  307
            W +YISEDLPR+VQ+S DSAIRSAR  Q +SS HLRS+QDF+PQ+ ++Y+ YEDA   KV
Sbjct  25   WRSYISEDLPRSVQQSADSAIRSARSLQESSSTHLRSIQDFVPQIGTRYRYYEDAFIHKV  84

Query  308  KDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRL  487
            KDE+   +EHPA+ GG+AV    + M GPRRFLFR TLGR +SEEAQF KAE NVKEL L
Sbjct  85   KDELMTLKEHPALAGGVAVTAFFLLMPGPRRFLFRQTLGRLQSEEAQFVKAENNVKELTL  144

Query  488  SVDLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            SVD+MKKES KL ER+ LA  +MKRGHS+LM AGT
Sbjct  145  SVDIMKKESKKLLERSVLAEKDMKRGHSDLMGAGT  179



>ref|XP_004144065.1| PREDICTED: uncharacterized protein LOC101216418 isoform 2 [Cucumis 
sativus]
 ref|XP_004159355.1| PREDICTED: uncharacterized LOC101216418 isoform 2 [Cucumis sativus]
Length=217

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = +2

Query  140  ISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEV  319
            I+EDL RTV +S DSAIRSAR FQ  SS H+RSLQDF+PQ +SQ+K YED  F+K+ DE+
Sbjct  25   IAEDLQRTVVQSKDSAIRSARSFQQASSSHIRSLQDFVPQATSQFKTYEDTFFRKLTDEL  84

Query  320  EIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDL  499
            +IAREHPA   G+AV  GL+ MRGPRRFLFR+TLGRF++EEA F KAEK+VKEL LSVDL
Sbjct  85   KIAREHPAATIGVAVTAGLLIMRGPRRFLFRHTLGRFQTEEASFLKAEKHVKELNLSVDL  144

Query  500  MKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            MK ES KL ERAALA  +MK GH+ELMNAG+
Sbjct  145  MKNESKKLLERAALAEKDMKYGHNELMNAGS  175



>ref|XP_004144064.1| PREDICTED: uncharacterized protein LOC101216418 isoform 1 [Cucumis 
sativus]
 ref|XP_004159354.1| PREDICTED: uncharacterized LOC101216418 isoform 1 [Cucumis sativus]
 gb|KGN66344.1| hypothetical protein Csa_1G599380 [Cucumis sativus]
Length=241

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = +2

Query  140  ISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEV  319
            I+EDL RTV +S DSAIRSAR FQ  SS H+RSLQDF+PQ +SQ+K YED  F+K+ DE+
Sbjct  25   IAEDLQRTVVQSKDSAIRSARSFQQASSSHIRSLQDFVPQATSQFKTYEDTFFRKLTDEL  84

Query  320  EIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDL  499
            +IAREHPA   G+AV  GL+ MRGPRRFLFR+TLGRF++EEA F KAEK+VKEL LSVDL
Sbjct  85   KIAREHPAATIGVAVTAGLLIMRGPRRFLFRHTLGRFQTEEASFLKAEKHVKELNLSVDL  144

Query  500  MKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            MK ES KL ERAALA  +MK GH+ELMNAG+
Sbjct  145  MKNESKKLLERAALAEKDMKYGHNELMNAGS  175



>ref|XP_011089758.1| PREDICTED: uncharacterized protein LOC105170618 [Sesamum indicum]
Length=234

 Score =   214 bits (545),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 135/172 (78%), Gaps = 7/172 (4%)
 Frame = +2

Query  74   DETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFL  253
            +E ++PAP  TP      W  YISE+LPR+VQES DSAIRSAR  Q +SS HLRSLQ+F 
Sbjct  3    EEEATPAP--TP-----AWRTYISEELPRSVQESADSAIRSARSLQQSSSTHLRSLQEFF  55

Query  254  PQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFR  433
            PQL +QY+ YE+A   +VKDE+   RE+PA+ GG+AVA  L+ MRGPRRFLFR TLGR +
Sbjct  56   PQLGTQYRYYEEAFVNRVKDELVNVRENPALAGGVAVAACLLLMRGPRRFLFRQTLGRLQ  115

Query  434  SEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            SEEAQF +AEKNVKEL LSVDLMKKES KL ER+ALA  +MKRGHS+LMNAG
Sbjct  116  SEEAQFVRAEKNVKELNLSVDLMKKESKKLLERSALAEKDMKRGHSDLMNAG  167



>ref|XP_008450994.1| PREDICTED: uncharacterized protein LOC103492410 [Cucumis melo]
Length=241

 Score =   214 bits (544),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +2

Query  140  ISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEV  319
            I+EDL RTV +S DSAIRSAR  Q  SS H+RS QDF+P+ +SQ+K YEDA F+K+ DE+
Sbjct  25   IAEDLQRTVVQSKDSAIRSARSLQEASSSHIRSFQDFVPRATSQFKTYEDAFFRKLTDEL  84

Query  320  EIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDL  499
            +IAREHPA   G+AV  GL+ MRGPRRFLFR+TLGRF++EEA F KAEK+VKEL LSVDL
Sbjct  85   KIAREHPAATIGVAVTAGLLIMRGPRRFLFRHTLGRFQTEEASFLKAEKHVKELNLSVDL  144

Query  500  MKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            MK ES KL ERAALA  +MK GH+ELMNAG+
Sbjct  145  MKNESKKLLERAALAEKDMKYGHNELMNAGS  175



>ref|XP_006348221.1| PREDICTED: uncharacterized protein LOC102606203 [Solanum tuberosum]
Length=233

 Score =   209 bits (531),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  116  RDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDAL  295
            ++K WH+YISE+LPRTVQ STDSAIRSAR  QNTSS HLR+LQDF+P++  QY+  E+  
Sbjct  9    QNKAWHSYISENLPRTVQASTDSAIRSARSIQNTSSTHLRTLQDFIPKIKGQYRTCEEVF  68

Query  296  FQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVK  475
            F+K+KDE+  AREHPA+ GGI +A GL+ MRGPRRFL+R TLGR +SEEA+F KAEKNVK
Sbjct  69   FRKIKDELVSAREHPAIAGGIGIAAGLLLMRGPRRFLYRQTLGRLQSEEAKFIKAEKNVK  128

Query  476  ELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            EL LSV LMKKES KL ERA+LA  +M+RGHS+LM AG 
Sbjct  129  ELGLSVGLMKKESKKLLERASLAEKDMQRGHSDLMVAGN  167



>ref|XP_006445553.1| hypothetical protein CICLE_v10016445mg [Citrus clementina]
 gb|ESR58793.1| hypothetical protein CICLE_v10016445mg [Citrus clementina]
 gb|KDO54524.1| hypothetical protein CISIN_1g025242mg [Citrus sinensis]
Length=243

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 125/171 (73%), Gaps = 5/171 (3%)
 Frame = +2

Query  80   TSSPAPAATPQQRD-KPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  256
            T + APA T + +D K W     EDL R+V +S DSAIRSAR FQ+ SS +L++LQDF+ 
Sbjct  10   TVAAAPAITTRTKDAKEW----VEDLQRSVIQSKDSAIRSARSFQHNSSTYLQTLQDFVL  65

Query  257  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  436
               SQY+ YEDA F KVKDE+  AREHPA   G+A+  GL+FMRGPRRFLFR+T GR RS
Sbjct  66   HGVSQYQTYEDAFFSKVKDELVSAREHPAAATGVALTAGLLFMRGPRRFLFRHTFGRLRS  125

Query  437  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            EEA F +AEKNV EL LS +LMKKES KL ERAALA  EM RG +EL NAG
Sbjct  126  EEAMFVRAEKNVNELNLSGELMKKESKKLLERAALAEKEMIRGETELKNAG  176



>gb|KDO54525.1| hypothetical protein CISIN_1g025242mg [Citrus sinensis]
Length=255

 Score =   202 bits (515),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 125/171 (73%), Gaps = 5/171 (3%)
 Frame = +2

Query  80   TSSPAPAATPQQRD-KPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  256
            T + APA T + +D K W     EDL R+V +S DSAIRSAR FQ+ SS +L++LQDF+ 
Sbjct  10   TVAAAPAITTRTKDAKEW----VEDLQRSVIQSKDSAIRSARSFQHNSSTYLQTLQDFVL  65

Query  257  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  436
               SQY+ YEDA F KVKDE+  AREHPA   G+A+  GL+FMRGPRRFLFR+T GR RS
Sbjct  66   HGVSQYQTYEDAFFSKVKDELVSAREHPAAATGVALTAGLLFMRGPRRFLFRHTFGRLRS  125

Query  437  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            EEA F +AEKNV EL LS +LMKKES KL ERAALA  EM RG +EL NAG
Sbjct  126  EEAMFVRAEKNVNELNLSGELMKKESKKLLERAALAEKEMIRGETELKNAG  176



>ref|XP_010536807.1| PREDICTED: uncharacterized protein LOC104811711 [Tarenaya hassleriana]
Length=255

 Score =   202 bits (513),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = +2

Query  53   DVPSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHL  232
            D P  E+ E ++       ++    W     ED  RTV+ESTDSAIRSAR  +N SS H 
Sbjct  18   DKPEVEVIEATAETAVGGAER----W----VEDFQRTVKESTDSAIRSARSLRNNSSSHF  69

Query  233  RSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFR  412
            RSLQDF+P    QYK YE+A F KV +E+  A++HPA   G+ VA GL+ MRGPRRFLFR
Sbjct  70   RSLQDFIPHALVQYKTYENAFFSKVTEELTNAKDHPAATVGLGVAAGLLLMRGPRRFLFR  129

Query  413  NTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
             TLGRF+SEEA++ K EKNV+EL ++VDLMKKES KL ERAALA  +MKRG SELM++G 
Sbjct  130  QTLGRFQSEEARYLKVEKNVQELNMTVDLMKKESRKLLERAALAEKDMKRGLSELMSSGC  189



>ref|XP_010032828.1| PREDICTED: uncharacterized protein LOC104422263 [Eucalyptus grandis]
 gb|KCW52324.1| hypothetical protein EUGRSUZ_J01745 [Eucalyptus grandis]
Length=242

 Score =   201 bits (511),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 124/173 (72%), Gaps = 5/173 (3%)
 Frame = +2

Query  83   SSPAPAA----TPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDF  250
            +SP+P A     P+Q  K   A I+ED+ RTV ES DSAI++AR  Q  SS HLRSLQ+ 
Sbjct  4    ASPSPPAAEPAVPRQNGKSI-ADIAEDVQRTVLESRDSAIQTARSLQQNSSTHLRSLQEL  62

Query  251  LPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRF  430
            L ++ SQY AYED    KVKDEV  AREHP    G++VA  L+ +RGPRRFL R T GR 
Sbjct  63   LTKMRSQYHAYEDTFVNKVKDEVRSAREHPGTTVGVSVAAALLLLRGPRRFLIRQTFGRL  122

Query  431  RSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            +SEEAQF +AEKNVK+L LSVDLMKKES KL ERAALA T+MKRG ++L N G
Sbjct  123  QSEEAQFVRAEKNVKDLNLSVDLMKKESKKLIERAALAETDMKRGLTDLKNTG  175



>ref|XP_006488962.1| PREDICTED: uncharacterized protein LOC102628779 [Citrus sinensis]
Length=243

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 125/171 (73%), Gaps = 5/171 (3%)
 Frame = +2

Query  80   TSSPAPAATPQQRD-KPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  256
            T + APA T + +D K W     EDL R+V +S DSAIRSAR FQ+ SS +L++LQDF+ 
Sbjct  10   TVAAAPAITTRTKDAKEW----VEDLQRSVIQSKDSAIRSARSFQHNSSTYLQTLQDFVL  65

Query  257  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  436
               SQY+ YEDA F KVKDE+  AREHPA   G+A+  GL+FMRGPRRFLFR+T GR RS
Sbjct  66   HGVSQYQTYEDAFFSKVKDELVSAREHPAAATGVALTAGLLFMRGPRRFLFRHTFGRLRS  125

Query  437  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            EEA F +AEKNV EL LS +LMKKES KL ERAALA  +M RG +EL NAG
Sbjct  126  EEAMFVRAEKNVNELNLSGELMKKESKKLLERAALAEKDMIRGETELKNAG  176



>ref|XP_002869612.1| hypothetical protein ARALYDRAFT_913923 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45871.1| hypothetical protein ARALYDRAFT_913923 [Arabidopsis lyrata subsp. 
lyrata]
Length=263

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +2

Query  146  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +D  RTV+ESTDSA+RSAR  +  S+   RS+QDF+P   +QYK YE+A F KV +E+  
Sbjct  49   DDFQRTVKESTDSAMRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTEELIY  108

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A+EHPA   GI VA GL+ MRGPRRFLFR+TLGRF+SEEAQF KAEK+V+EL +SVDLMK
Sbjct  109  AKEHPAATVGIGVAAGLVLMRGPRRFLFRHTLGRFQSEEAQFLKAEKHVQELNMSVDLMK  168

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
            KES KL ER ALA  +MKRG SELMN+G
Sbjct  169  KESRKLLERTALAEKDMKRGLSELMNSG  196



>ref|XP_007014648.1| Uncharacterized protein TCM_039966 [Theobroma cacao]
 gb|EOY32267.1| Uncharacterized protein TCM_039966 [Theobroma cacao]
Length=238

 Score =   196 bits (499),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +2

Query  146  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            E+L R++Q+S +SAI+SAR   + SS HLRSLQDF+P   S+YK+YEDA   K+K+E+  
Sbjct  24   EELQRSLQDSKESAIQSARSLHHNSSTHLRSLQDFVPHAFSRYKSYEDAFVNKLKEELMS  83

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A+EHPA   GI V   L  M GPRR LFRNTLGRF+SEEAQF +AEKNVKEL LSVD+MK
Sbjct  84   AKEHPAAAIGITVTAALFLMPGPRRLLFRNTLGRFQSEEAQFLRAEKNVKELNLSVDMMK  143

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
            KES KL ERAALA  +MKRGH ELMNAG
Sbjct  144  KESSKLLERAALAEKDMKRGHKELMNAG  171



>ref|XP_011048149.1| PREDICTED: uncharacterized protein LOC105142285 [Populus euphratica]
Length=236

 Score =   196 bits (497),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = +2

Query  128  WHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKV  307
            W   + EDL RTV+ES DSAIRSA  FQ +SS HLRS QD +P+  S++ +YE+  F KV
Sbjct  18   WE--VMEDLQRTVKESKDSAIRSAVSFQQSSSSHLRSFQDHVPEAISKFNSYENTFFSKV  75

Query  308  KDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRL  487
            K+E+  A++HPA   G+ +  GL  MRGPRRFLFRNTLGRF+SEEAQF +AEKNVKE   
Sbjct  76   KEELLTAKDHPAAAIGLTLTAGLFLMRGPRRFLFRNTLGRFQSEEAQFLRAEKNVKEYSF  135

Query  488  SVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            SVDLMKKES KL ERA+LA  EMK GH+EL++AG
Sbjct  136  SVDLMKKESRKLLERASLAEKEMKNGHTELLDAG  169



>ref|XP_002523392.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38971.1| conserved hypothetical protein [Ricinus communis]
Length=265

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = +2

Query  146  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            EDL RTV ES DSAIRSAR     SS  LRSLQD +PQ  S ++ YED+ F K+K+E+ I
Sbjct  51   EDLQRTVIESKDSAIRSARSLHQNSSSRLRSLQDHVPQALSLFRTYEDSFFNKIKEELMI  110

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            AREHP  V G+AV  G + MRGPRRFLFR+T GRF+SEEA+F K EKNVKEL LSVDLMK
Sbjct  111  AREHPVEVVGVAVTAGFLLMRGPRRFLFRHTFGRFQSEEARFLKTEKNVKELNLSVDLMK  170

Query  506  KESGKLFERAALAHTEMKRGHSELMNAGT  592
             ES KL ERA+LA  +MK GH+ELM+AG+
Sbjct  171  NESRKLLERASLAEKDMKHGHTELMDAGS  199



>gb|KFK29159.1| hypothetical protein AALP_AA7G096800 [Arabis alpina]
Length=229

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = +2

Query  146  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +D  RTV+ESTDSAIRSAR  +  S+   RS+QDF+P   +QYK YE+A F KV +E+  
Sbjct  15   DDFSRTVKESTDSAIRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTEELVN  74

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A+EHPA   GI +   L+ MRGPRRFLFRNTLGRF+SEEAQF +AEK+V+EL +SVDLMK
Sbjct  75   AKEHPAAAAGIGLTAALVLMRGPRRFLFRNTLGRFQSEEAQFLRAEKHVQELNMSVDLMK  134

Query  506  KESGKLFERAALAHTEMKRGHSELMNAGT  592
            KES KL ERAALA  +MKRG SELM++G 
Sbjct  135  KESRKLLERAALAEKDMKRGLSELMDSGN  163



>ref|XP_002299091.1| hypothetical protein POPTR_0001s03860g [Populus trichocarpa]
 gb|EEE83896.1| hypothetical protein POPTR_0001s03860g [Populus trichocarpa]
Length=239

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = +2

Query  128  WHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKV  307
            W   + EDL RTV+ES DSAIRSA  FQ +SS HLRS QD +P+  S++ +YE+  F KV
Sbjct  21   WE--VMEDLQRTVKESKDSAIRSALSFQQSSSSHLRSFQDHVPEAISKFNSYENTFFSKV  78

Query  308  KDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRL  487
            K+E+  A++HPA   G+ +  GL  MRGPRRFLFRNTLGRF+SEEAQF +AEKNVKE   
Sbjct  79   KEELLTAKDHPAAAIGLTLTAGLFLMRGPRRFLFRNTLGRFQSEEAQFLRAEKNVKEFSF  138

Query  488  SVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            SVDLMKKES KL ERA+LA  EMK GH+EL++ G
Sbjct  139  SVDLMKKESRKLLERASLAEKEMKNGHTELLDTG  172



>gb|KJB83394.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=193

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 121/171 (71%), Gaps = 8/171 (5%)
 Frame = +2

Query  83   SSPAPAATPQQRDKPWHAYISEDLP--RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  256
            ++  PAA      KPW     E+LP   ++ +S D AIRSA+   + SS HLRS QD LP
Sbjct  11   TATVPAANSST--KPW----VEELPTIESLIDSKDLAIRSAQSLFHNSSTHLRSFQDSLP  64

Query  257  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  436
            Q SS YK+YEDA F K+K+ V IA+E+P    GI +   L  MRGPRRFLFRNTLGRF+S
Sbjct  65   QASSHYKSYEDAFFSKLKEGVMIAKENPGAAVGITLTAALCLMRGPRRFLFRNTLGRFQS  124

Query  437  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            EEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  ELMN+G
Sbjct  125  EEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKELMNSG  175



>gb|KJB83391.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=229

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 121/171 (71%), Gaps = 8/171 (5%)
 Frame = +2

Query  83   SSPAPAATPQQRDKPWHAYISEDLP--RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  256
            ++  PAA      KPW     E+LP   ++ +S D AIRSA+   + SS HLRS QD LP
Sbjct  11   TATVPAANSST--KPW----VEELPTIESLIDSKDLAIRSAQSLFHNSSTHLRSFQDSLP  64

Query  257  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  436
            Q SS YK+YEDA F K+K+ V IA+E+P    GI +   L  MRGPRRFLFRNTLGRF+S
Sbjct  65   QASSHYKSYEDAFFSKLKEGVMIAKENPGAAVGITLTAALCLMRGPRRFLFRNTLGRFQS  124

Query  437  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            EEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  ELMN+G
Sbjct  125  EEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKELMNSG  175



>gb|KJB83395.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=237

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 121/171 (71%), Gaps = 8/171 (5%)
 Frame = +2

Query  83   SSPAPAATPQQRDKPWHAYISEDLP--RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  256
            ++  PAA      KPW     E+LP   ++ +S D AIRSA+   + SS HLRS QD LP
Sbjct  11   TATVPAANSST--KPW----VEELPTIESLIDSKDLAIRSAQSLFHNSSTHLRSFQDSLP  64

Query  257  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  436
            Q SS YK+YEDA F K+K+ V IA+E+P    GI +   L  MRGPRRFLFRNTLGRF+S
Sbjct  65   QASSHYKSYEDAFFSKLKEGVMIAKENPGAAVGITLTAALCLMRGPRRFLFRNTLGRFQS  124

Query  437  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            EEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  ELMN+G
Sbjct  125  EEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKELMNSG  175



>gb|KJB83392.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=242

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 121/171 (71%), Gaps = 8/171 (5%)
 Frame = +2

Query  83   SSPAPAATPQQRDKPWHAYISEDLP--RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  256
            ++  PAA      KPW     E+LP   ++ +S D AIRSA+   + SS HLRS QD LP
Sbjct  11   TATVPAANSST--KPW----VEELPTIESLIDSKDLAIRSAQSLFHNSSTHLRSFQDSLP  64

Query  257  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  436
            Q SS YK+YEDA F K+K+ V IA+E+P    GI +   L  MRGPRRFLFRNTLGRF+S
Sbjct  65   QASSHYKSYEDAFFSKLKEGVMIAKENPGAAVGITLTAALCLMRGPRRFLFRNTLGRFQS  124

Query  437  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            EEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  ELMN+G
Sbjct  125  EEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKELMNSG  175



>gb|KJB83396.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=239

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 121/171 (71%), Gaps = 8/171 (5%)
 Frame = +2

Query  83   SSPAPAATPQQRDKPWHAYISEDLP--RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  256
            ++  PAA      KPW     E+LP   ++ +S D AIRSA+   + SS HLRS QD LP
Sbjct  11   TATVPAANSST--KPW----VEELPTIESLIDSKDLAIRSAQSLFHNSSTHLRSFQDSLP  64

Query  257  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  436
            Q SS YK+YEDA F K+K+ V IA+E+P    GI +   L  MRGPRRFLFRNTLGRF+S
Sbjct  65   QASSHYKSYEDAFFSKLKEGVMIAKENPGAAVGITLTAALCLMRGPRRFLFRNTLGRFQS  124

Query  437  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            EEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  ELMN+G
Sbjct  125  EEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKELMNSG  175



>gb|KHG03556.1| Chromosome-associated kinesin KIF4 [Gossypium arboreum]
Length=243

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 118/167 (71%), Gaps = 8/167 (5%)
 Frame = +2

Query  95   PAATPQQRDKPWHAYISEDLP--RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSS  268
            PAA      KPW     E+LP    + +S D AIRSA+   + SS HLR+ QD LPQ SS
Sbjct  16   PAANSST--KPW----VEELPTIENLIDSKDLAIRSAQSLFHNSSTHLRTFQDSLPQASS  69

Query  269  QYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQ  448
             YK+YEDA F K+K+ V IA+E+P    GI +   L  MRGPRRFLFRNTLGRF+SEEA+
Sbjct  70   YYKSYEDAFFSKLKEGVMIAKENPGAAVGITLTASLCLMRGPRRFLFRNTLGRFQSEEAK  129

Query  449  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  ELMN+G
Sbjct  130  FSRAEKNVKVLSLSVDLMKKESSKLLERAALAEKDMKRGQKELMNSG  176



>ref|XP_010448277.1| PREDICTED: uncharacterized protein LOC104730768 [Camelina sativa]
Length=263

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  149  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  328
            DL +TV+ESTDSA+RSAR F+  S+   RS+QDF+P   +QYK YE+A F KV +E+  A
Sbjct  50   DLQQTVKESTDSAMRSARSFRENSTSQFRSIQDFIPHALTQYKNYENAFFSKVTEELTYA  109

Query  329  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  508
            +EHPA   GI VA  L+ MRGPRRFLFR TLGRF+SEEAQF +AEK V+EL +SVDLMKK
Sbjct  110  KEHPAAAVGIGVAASLVLMRGPRRFLFRQTLGRFQSEEAQFLRAEKQVQELNMSVDLMKK  169

Query  509  ESGKLFERAALAHTEMKRGHSELMNAG  589
            ES KL ERA LA  +MKRGHSELMN+G
Sbjct  170  ESKKLLERATLAEKDMKRGHSELMNSG  196



>gb|KDP30630.1| hypothetical protein JCGZ_16195 [Jatropha curcas]
Length=226

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = +2

Query  146  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            EDL RTV +S DSAIRSA  FQ  SS HLRSLQD LP+  SQ+K YEDA   K+K+E+  
Sbjct  12   EDLQRTVIQSKDSAIRSACSFQQNSSFHLRSLQDHLPRAVSQFKTYEDAFVNKIKEELMS  71

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            AREHP    G+AV  GL+ MRGPRR LFR T GR +SEEA+F KAEKN+KEL LSVDLMK
Sbjct  72   AREHPVETVGVAVTAGLLLMRGPRRLLFRQTFGRLQSEEAKFLKAEKNLKELTLSVDLMK  131

Query  506  KESGKLFERAALAHTEMKRGHSELMNAGT  592
             ES KL ERA+ A  +MK G +EL+++G+
Sbjct  132  NESRKLLERASYAEKDMKHGLTELLDSGS  160



>ref|NP_194371.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAO22774.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42434.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85195.1| uncharacterized protein AT4G26410 [Arabidopsis thaliana]
Length=263

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  149  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  328
            DL RTV+ES D+A+RSAR  +  S+   RS+QDF+P   +QYK YE+A F KV DE+  A
Sbjct  50   DLQRTVKESKDTAMRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTDELIYA  109

Query  329  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  508
            +EHPA   GI VA  L+ MRGPRRFLFRNTLGRF+SEEAQF KAEK+V+EL +SVDLMKK
Sbjct  110  KEHPAAAIGIGVAASLVLMRGPRRFLFRNTLGRFQSEEAQFLKAEKHVQELNMSVDLMKK  169

Query  509  ESGKLFERAALAHTEMKRGHSELMNAG  589
            ES KL ER ALA  +MKRG SELMN+G
Sbjct  170  ESRKLLERTALAEKDMKRGLSELMNSG  196



>ref|XP_010673453.1| PREDICTED: uncharacterized protein LOC104889828 [Beta vulgaris 
subsp. vulgaris]
Length=248

 Score =   185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = +2

Query  77   ETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLP  256
            ET    P   P    KPWH+YIS+DLPR+  ES D+AIRSAR   + SS  LR +QD +P
Sbjct  14   ETKREDPTRQP---SKPWHSYISDDLPRSFMESADAAIRSARSLHHDSSTRLRFMQDLIP  70

Query  257  QLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRS  436
            ++  ++  YE+A  +K KD +    +HP +  GI +AT  + MRGPRRFLF++T+GR +S
Sbjct  71   EVKFKFSNYEEACIKKFKDGLATGLQHPTMTVGITLATVFLLMRGPRRFLFQHTVGRLQS  130

Query  437  EEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            EE QF +AEK+VK L LSVDLMKKES KL ERA+LA  EM  G ++LMNAG
Sbjct  131  EEVQFVRAEKSVKMLELSVDLMKKESRKLLERASLAEKEMINGQTDLMNAG  181



>gb|KEH30817.1| hypothetical protein MTR_4g083250 [Medicago truncatula]
Length=240

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = +2

Query  182  SAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  361
            SAI SAR  Q+ S+ H R+ Q+FLP   SQY+ YEDA F KVKD V +ARE+PA+  G+A
Sbjct  64   SAIESARTVQHNSTTHFRTFQNFLPGAVSQYRTYEDAFFNKVKDGVMVARENPAIGVGLA  123

Query  362  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  541
            V+T L+ MRGPRRFLFR+TLGRF+SEEA++  AEKNVK+L LSVDL+KKES KL +R AL
Sbjct  124  VSTALLVMRGPRRFLFRHTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESIKLLQRTAL  183

Query  542  AHTEMKRGHSELMNAG  589
            A  EMK GHSELMN G
Sbjct  184  AEKEMKYGHSELMNTG  199



>ref|XP_010438763.1| PREDICTED: uncharacterized protein LOC104722317 [Camelina sativa]
Length=263

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  149  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  328
            DL +TV+ESTDSA+RSAR F+  S+   RS+QDF+P   +QYK YE+A F KV +E+  A
Sbjct  50   DLQQTVKESTDSAMRSARSFRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTEELTYA  109

Query  329  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  508
            +EHPA   GI VA  L+ MRGPRRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMKK
Sbjct  110  KEHPAAAVGIGVAASLVLMRGPRRFLFRQTLGRFQSEEAQFLRAEKHVQELNMSVDLMKK  169

Query  509  ESGKLFERAALAHTEMKRGHSELMNAG  589
            ES KL ERA LA  +MKRG SELMN+G
Sbjct  170  ESKKLLERATLAEKDMKRGLSELMNSG  196



>ref|XP_010433511.1| PREDICTED: uncharacterized protein LOC104717609 [Camelina sativa]
Length=263

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  149  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  328
            DL +TV+ESTDSA+RSAR F+  S+   RS+QDF+P   +QYK YE+A F KV +E+  A
Sbjct  50   DLQQTVKESTDSAMRSARSFRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTEELTYA  109

Query  329  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  508
            +EHPA   GI VA  L+ MRGPRRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMKK
Sbjct  110  KEHPAAAVGIGVAASLVLMRGPRRFLFRQTLGRFQSEEAQFLRAEKHVQELNMSVDLMKK  169

Query  509  ESGKLFERAALAHTEMKRGHSELMNAG  589
            ES KL ERA LA  +MKRG SELMN+G
Sbjct  170  ESKKLLERATLAEKDMKRGLSELMNSG  196



>ref|XP_003607819.1| hypothetical protein MTR_4g083250 [Medicago truncatula]
 gb|AES90016.1| hypothetical protein MTR_4g083250 [Medicago truncatula]
 gb|AFK36915.1| unknown [Medicago truncatula]
Length=266

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = +2

Query  182  SAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  361
            SAI SAR  Q+ S+ H R+ Q+FLP   SQY+ YEDA F KVKD V +ARE+PA+  G+A
Sbjct  64   SAIESARTVQHNSTTHFRTFQNFLPGAVSQYRTYEDAFFNKVKDGVMVARENPAIGVGLA  123

Query  362  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  541
            V+T L+ MRGPRRFLFR+TLGRF+SEEA++  AEKNVK+L LSVDL+KKES KL +R AL
Sbjct  124  VSTALLVMRGPRRFLFRHTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESIKLLQRTAL  183

Query  542  AHTEMKRGHSELMNAG  589
            A  EMK GHSELMN G
Sbjct  184  AEKEMKYGHSELMNTG  199



>ref|XP_006284348.1| hypothetical protein CARUB_v10005520mg [Capsella rubella]
 gb|EOA17246.1| hypothetical protein CARUB_v10005520mg [Capsella rubella]
Length=263

 Score =   184 bits (467),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +2

Query  146  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +DL RTV+++TDSA+RSAR  +  S+ H RS+QDF+P   +QYK YE+A F KV +E+  
Sbjct  49   DDLQRTVKDTTDSAMRSARSLRENSTSHFRSIQDFIPHALTQYKTYENAFFSKVTEELIY  108

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A+EHPA   GI VA GL+ MRGPRRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMK
Sbjct  109  AKEHPAAAVGIGVAAGLVLMRGPRRFLFRQTLGRFQSEEAQFLRAEKHVQELNMSVDLMK  168

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
            KES KL ER ALA  +MKRG SELMN+G
Sbjct  169  KESKKLLERTALAEKDMKRGLSELMNSG  196



>gb|EPS63583.1| hypothetical protein M569_11194 [Genlisea aurea]
Length=236

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +2

Query  122  KPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSL-QDFLPQLSSQYKAYEDALF  298
            K WH+YISED+PR  ++S D+AIRSAR  Q ++S   R+L Q+F+PQ+   Y+ YE+A F
Sbjct  14   KAWHSYISEDIPRNFKDSADAAIRSARSIQESTSSIGRNLFQEFIPQIGPTYRYYEEAFF  73

Query  299  QKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKE  478
             K KDEV   R++P +  G+AVA  L  MRGPRRFL R TL R +SEEA+F +AEKNV E
Sbjct  74   NKAKDEVVYLRDNPPLAAGLAVAC-LFLMRGPRRFLLRQTLHRLQSEEARFVRAEKNVNE  132

Query  479  LRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            L LSV+LMKKE  KLF+R+ LA  +MK G+S LMNAGT
Sbjct  133  LNLSVELMKKEGVKLFQRSMLAEKDMKHGYSSLMNAGT  170



>ref|XP_009137593.1| PREDICTED: uncharacterized protein LOC103861626 [Brassica rapa]
Length=254

 Score =   181 bits (460),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 110/144 (76%), Gaps = 3/144 (2%)
 Frame = +2

Query  158  RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREH  337
            RTV+ESTDSAIRS R     S+   RS+QD +P   + YK YE+A F KV +E+  A+EH
Sbjct  47   RTVKESTDSAIRSLR---ENSTSQFRSIQDLIPHALTHYKTYENAFFSKVTEELVNAKEH  103

Query  338  PAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESG  517
            PA   GI +A GL+ MRGPRRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES 
Sbjct  104  PAASAGIGLAAGLVLMRGPRRFLFRRTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESS  163

Query  518  KLFERAALAHTEMKRGHSELMNAG  589
            KL ER+ALA  +MKRG SELM++G
Sbjct  164  KLLERSALAEKDMKRGLSELMDSG  187



>emb|CDY42739.1| BnaA03g48000D [Brassica napus]
Length=254

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 110/144 (76%), Gaps = 3/144 (2%)
 Frame = +2

Query  158  RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREH  337
            RTV+ESTDSAIRS R     S+   RS+QD +P   + YK YE+A F KV +E+  A+EH
Sbjct  47   RTVKESTDSAIRSLR---ENSTSQFRSIQDLIPHALTHYKTYENAFFSKVTEELVNAKEH  103

Query  338  PAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESG  517
            PA   GI +A GL+ MRGPRRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES 
Sbjct  104  PAASAGIGLAAGLVLMRGPRRFLFRRTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESM  163

Query  518  KLFERAALAHTEMKRGHSELMNAG  589
            KL ER+ALA  +MKRG SELM++G
Sbjct  164  KLLERSALAEKDMKRGLSELMDSG  187



>ref|XP_003556589.1| PREDICTED: uncharacterized protein LOC100780119 [Glycine max]
Length=230

 Score =   178 bits (451),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 115/153 (75%), Gaps = 7/153 (5%)
 Frame = +2

Query  134  AYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKD  313
            A I+E+L R       SAI+SAR  Q++SS H R+ Q+FLP+  SQY+ YEDA   KVKD
Sbjct  19   ASIAENLQR-------SAIQSARTVQHSSSTHFRAFQNFLPEAVSQYRTYEDAFVNKVKD  71

Query  314  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  493
             + IA+E+PAV  G+A++  L+ MR PRRFLFR+TLGRF+SEEA++ + EKNVK+L LSV
Sbjct  72   GLMIAKENPAVSAGVAISAALLAMRAPRRFLFRHTLGRFQSEEARYARIEKNVKDLNLSV  131

Query  494  DLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            DL+KKE+ KL +R  LA  EMK GH+EL++AGT
Sbjct  132  DLLKKENAKLLQRTTLAEKEMKYGHTELVSAGT  164



>gb|KHN20511.1| hypothetical protein glysoja_029524 [Glycine soja]
Length=237

 Score =   178 bits (451),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 115/153 (75%), Gaps = 7/153 (5%)
 Frame = +2

Query  134  AYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKD  313
            A I+E+L R       SAI+SAR  Q++SS H R+ Q+FLP+  SQY+ YEDA   KVKD
Sbjct  19   ASIAENLQR-------SAIQSARTVQHSSSTHFRAFQNFLPEAVSQYRTYEDAFVNKVKD  71

Query  314  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  493
             + IA+E+PAV  G+A++  L+ MR PRRFLFR+TLGRF+SEEA++ + EKNVK+L LSV
Sbjct  72   GLMIAKENPAVSAGVAISAALLAMRAPRRFLFRHTLGRFQSEEARYARIEKNVKDLNLSV  131

Query  494  DLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            DL+KKE+ KL +R  LA  EMK GH+EL++AGT
Sbjct  132  DLLKKENAKLLQRTTLAEKEMKYGHTELVSAGT  164



>gb|ACU19454.1| unknown [Glycine max]
Length=230

 Score =   177 bits (450),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 115/153 (75%), Gaps = 7/153 (5%)
 Frame = +2

Query  134  AYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKD  313
            A I+E+L R       SAI+SAR  Q++SS H R+ Q+FLP+  SQY+ YEDA   KVKD
Sbjct  19   ASIAENLQR-------SAIQSARTVQHSSSTHFRAFQNFLPEAVSQYRTYEDAFVNKVKD  71

Query  314  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  493
             + IA+E+PAV  G+A++  L+ MR PRRFLFR+TLGRF+SEEA++ + EKNVK+L LSV
Sbjct  72   GLMIAKENPAVSAGVAISVALLAMRAPRRFLFRHTLGRFQSEEARYARIEKNVKDLNLSV  131

Query  494  DLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            DL+KKE+ KL +R  LA  EMK GH+EL++AGT
Sbjct  132  DLLKKENAKLLQRTTLAEKEMKYGHTELVSAGT  164



>ref|XP_004505352.1| PREDICTED: uncharacterized protein LOC101513717 [Cicer arietinum]
Length=233

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = +2

Query  182  SAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  361
            SAI SAR  Q+ SS H R+ Q+FLP+  SQY  YEDA F KVKD + + RE+PA+  G+A
Sbjct  31   SAIESARSMQHNSSTHFRTFQNFLPEAVSQYITYEDAFFNKVKDGLMVGRENPALGVGLA  90

Query  362  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  541
            ++  L+ MR PRRFLFRNTLGRF+SEEA++  AEKNVK+L LSVDL+KKES KL +R AL
Sbjct  91   ISAALLVMRAPRRFLFRNTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESIKLLQRTAL  150

Query  542  AHTEMKRGHSELMNAG  589
            A  EMK GH+ELMN G
Sbjct  151  AEKEMKYGHNELMNTG  166



>ref|XP_006413188.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
 gb|ESQ54641.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
Length=261

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = +2

Query  146  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +D  RTV+ES DSAIRSAR  +  S+   RS+QDF+P   +QYK YE+A F KV +E+  
Sbjct  47   DDFQRTVKESKDSAIRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTEELIY  106

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A+EHPA   GI +A GL+ MRGPRRFLFR+TLGRF+SEEAQF KAEK+V+EL +SVDLMK
Sbjct  107  AKEHPAAAAGIGLAAGLVLMRGPRRFLFRHTLGRFQSEEAQFLKAEKHVQELNMSVDLMK  166

Query  506  KESGKLFERAALAHTEMKRGHSELMNAGT  592
            KES KL ER+ALA  +MKRG SELM++G 
Sbjct  167  KESRKLLERSALAEKDMKRGLSELMDSGN  195



>emb|CDX89342.1| BnaA01g15510D [Brassica napus]
Length=261

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 131/197 (66%), Gaps = 19/197 (10%)
 Frame = +2

Query  50   SDVPSTEIDETSSPAPAATPQQRDKPWHAYIS----------------EDLPRTVQESTD  181
            SD  +  + + S+PA A +    D   H  I                 +DL RTV+ESTD
Sbjct  2    SDTEANGVTDDSAPANAVSA---DATEHKAIGVIESVEEAVGGAEKWVDDLQRTVKESTD  58

Query  182  SAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  361
            SA+RSAR  +  S+   RS+QDF+P   +QYK YE+  F KV +E+  A+E+PA   GI 
Sbjct  59   SAMRSARSLRENSTSQFRSIQDFIPHALNQYKTYENVFFSKVTEELRNAKENPAAAAGIG  118

Query  362  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  541
            +A GL+ MRGPRRFLFR+TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES KL ER+AL
Sbjct  119  LAAGLVLMRGPRRFLFRHTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESMKLLERSAL  178

Query  542  AHTEMKRGHSELMNAGT  592
            A  +MKRG SELM++G 
Sbjct  179  AEKDMKRGLSELMDSGN  195



>ref|XP_009142234.1| PREDICTED: uncharacterized protein LOC103866109 [Brassica rapa]
Length=261

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 131/197 (66%), Gaps = 19/197 (10%)
 Frame = +2

Query  50   SDVPSTEIDETSSPAPAATPQQRDKPWHAYIS----------------EDLPRTVQESTD  181
            SD  +  + + S+PA A +    D   H  I                 +DL RTV+ESTD
Sbjct  2    SDTEANGVTDDSAPANAVSA---DATEHKAIGVIESVEEAVGGAEKWVDDLQRTVKESTD  58

Query  182  SAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  361
            SA+RSAR  +  S+   RS+QDF+P   +QYK YE+  F KV +E+  A+E+PA   GI 
Sbjct  59   SAMRSARSLRENSTSQFRSIQDFIPHALNQYKTYENVFFSKVTEELRNAKENPAAAAGIG  118

Query  362  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  541
            +A GL+ MRGPRRFLFR+TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES KL ER+AL
Sbjct  119  LAAGLVLMRGPRRFLFRHTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESVKLLERSAL  178

Query  542  AHTEMKRGHSELMNAGT  592
            A  +MKRG SELM++G 
Sbjct  179  AEKDMKRGLSELMDSGN  195



>ref|XP_006829819.1| hypothetical protein AMTR_s00119p00084860 [Amborella trichopoda]
 gb|ERM97235.1| hypothetical protein AMTR_s00119p00084860 [Amborella trichopoda]
Length=292

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 124/185 (67%), Gaps = 9/185 (5%)
 Frame = +2

Query  50   SDVPSTEIDETSSPAPAATPQQR--DKPWHAYISED---LPRTVQESTDSAIRSARLFQN  214
            ++  S+E   +S+   A T + +  +KPWH Y +E    L R+V ES     +SA   Q 
Sbjct  45   AETTSSEALSSSTETGALTHELKPLNKPWHVYTTEQAEGLRRSVVES----FQSAPSLQQ  100

Query  215  TSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGP  394
                H  +LQDF+PQL S+Y  YEDA F+K K+E+ ++REHP    GIAVATGL+ +RGP
Sbjct  101  YFPLHFSTLQDFIPQLKSKYHVYEDAFFKKAKEELMVSREHPIETIGIAVATGLLLLRGP  160

Query  395  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  574
            RRFLFR+T GR +SEEAQ+ + EK + EL LS+DLMKKES KL +RA  A  EM+RGH++
Sbjct  161  RRFLFRHTFGRLQSEEAQYVRTEKRLTELGLSLDLMKKESKKLLQRATFAEDEMRRGHAK  220

Query  575  LMNAG  589
            L NAG
Sbjct  221  LKNAG  225



>ref|XP_007157828.1| hypothetical protein PHAVU_002G101500g [Phaseolus vulgaris]
 gb|ESW29822.1| hypothetical protein PHAVU_002G101500g [Phaseolus vulgaris]
Length=241

 Score =   173 bits (438),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 7/156 (4%)
 Frame = +2

Query  125  PWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQK  304
            P  A I+E+L R       SAI+SAR  Q++SS    + Q+ LP+ +SQY+ YEDA F K
Sbjct  20   PSLATIAENLQR-------SAIQSARTVQHSSSTQFHAFQNSLPEAASQYRTYEDAFFNK  72

Query  305  VKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELR  484
            VKD + I +E+PA+  G+A++  L+ MR PRRFLFR TLGRF+SEEA++ + EK+VK+  
Sbjct  73   VKDGLMIVKENPALGAGVAISAALLVMRAPRRFLFRQTLGRFQSEEARYARTEKSVKDFN  132

Query  485  LSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            LSVDL+KKESGKL +R ALA  EMK GHSEL++AG+
Sbjct  133  LSVDLLKKESGKLLQRTALAEKEMKYGHSELLSAGS  168



>emb|CDX94341.1| BnaC01g18430D [Brassica napus]
Length=261

 Score =   171 bits (433),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +2

Query  146  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +DL RTV+ES DSA+RSAR  +  S+   RS+QDF+P   +QYK YE+A F KV +E+  
Sbjct  47   DDLQRTVKESKDSAMRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTEELRN  106

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A+E+PA   GI +A GL+ MRGPRRFLFR+TLGRF+SEEAQF +AEK+V+EL +SVDLMK
Sbjct  107  AKENPAAAAGIGLAAGLLLMRGPRRFLFRHTLGRFQSEEAQFLRAEKHVQELNMSVDLMK  166

Query  506  KESGKLFERAALAHTEMKRGHSELMNAGT  592
            KES KL ER+ALA  +MKRG SELM++G 
Sbjct  167  KESMKLLERSALAEKDMKRGLSELMDSGN  195



>ref|XP_003529452.1| PREDICTED: uncharacterized protein LOC100808143 [Glycine max]
Length=231

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 113/153 (74%), Gaps = 7/153 (5%)
 Frame = +2

Query  134  AYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKD  313
            A I+E+L R       SAI+SAR  Q+++  H R+ Q+FLP+   QY+ YEDA   KVKD
Sbjct  20   ASIAENLQR-------SAIQSARTVQHSTINHFRAFQNFLPEAVPQYRTYEDAFVNKVKD  72

Query  314  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  493
             + IA+E+PA+  G+AV+  L+ MR PRRFLFR+TLGRF+SEE ++ + EKNVK+L LSV
Sbjct  73   GLMIAKENPALSAGLAVSGALLAMRAPRRFLFRHTLGRFQSEEVRYARTEKNVKDLGLSV  132

Query  494  DLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            DL+KKES KL +R ALA  EMK GH+EL++AGT
Sbjct  133  DLLKKESVKLLQRTALAEKEMKYGHTELVSAGT  165



>gb|KHN42956.1| hypothetical protein glysoja_007486 [Glycine soja]
Length=264

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 113/153 (74%), Gaps = 7/153 (5%)
 Frame = +2

Query  134  AYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKD  313
            A I+E+L R       SAI+SAR  Q+++  H R+ Q+FLP+   QY+ YEDA   KVKD
Sbjct  58   ASIAENLQR-------SAIQSARTVQHSTINHFRAFQNFLPEAVPQYRTYEDAFVNKVKD  110

Query  314  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  493
             + IA+E+PA+  G+AV+  L+ MR PRRFLFR+TLGRF+SEE ++ + EKNVK+L LSV
Sbjct  111  GLMIAKENPALSAGLAVSGALLAMRAPRRFLFRHTLGRFQSEEVRYARTEKNVKDLGLSV  170

Query  494  DLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            DL+KKES KL +R ALA  EMK GH+EL++AGT
Sbjct  171  DLLKKESVKLLQRTALAEKEMKYGHTELVSAGT  203



>emb|CDX92771.1| BnaC07g40290D [Brassica napus]
Length=263

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 113/158 (72%), Gaps = 14/158 (9%)
 Frame = +2

Query  158  RTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREH  337
            RTV+ESTDSAIRSAR  +  S+   RS+QD +P   +QYK YE+A F KV +E+  A+EH
Sbjct  39   RTVKESTDSAIRSARSLRENSTSQFRSVQDLIPHALTQYKTYENAFFSKVTEELINAKEH  98

Query  338  PAVVGGIAVATGLIFMRG--------------PRRFLFRNTLGRFRSEEAQFNKAEKNVK  475
            PA   GI +A GL+ MRG              PRRFLFR TLGRF+SEEAQF +AEK+V+
Sbjct  99   PAAAAGIGLAAGLVLMRGITTSSLIYFLNLFCPRRFLFRRTLGRFQSEEAQFLRAEKHVQ  158

Query  476  ELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            EL +SVDLMKKES KL ER+ALA  +MKRG SELMN+G
Sbjct  159  ELNMSVDLMKKESSKLLERSALAEKDMKRGLSELMNSG  196



>ref|XP_010105296.1| hypothetical protein L484_002346 [Morus notabilis]
 gb|EXC04261.1| hypothetical protein L484_002346 [Morus notabilis]
Length=226

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 113/187 (60%), Gaps = 28/187 (15%)
 Frame = +2

Query  35   LKEMASDVPSTEIDETSSPAPAATPQQRD-KPWHAYISEDLPRTVQESTDSAIRSARLFQ  211
            + E A++  S E D + SPA  +  ++R+ +   A ++EDL R V  STDSAIRSAR   
Sbjct  1    MAETATESSSGE-DLSVSPASESKKKERNERQTLASMAEDLQRNVISSTDSAIRSARSLH  59

Query  212  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRG  391
            + SS H R+LQ+F+    S YK YED  F  VK                          G
Sbjct  60   HNSSAHFRNLQEFVANAKSHYKTYEDTFFNTVK--------------------------G  93

Query  392  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHS  571
            PRRFLFR+TLGR RSEEAQF KAEKNVKEL LSVD+MK ES KL ERAALA  +MK GH+
Sbjct  94   PRRFLFRHTLGRLRSEEAQFVKAEKNVKELSLSVDVMKNESRKLLERAALAEKDMKYGHT  153

Query  572  ELMNAGT  592
            ELM AG 
Sbjct  154  ELMKAGN  160



>ref|XP_003607823.1| hypothetical protein MTR_4g083290 [Medicago truncatula]
Length=353

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +2

Query  233  RSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFR  412
            R  ++FLP   SQY+ YEDA F KVKD V +ARE+PA+  G+AV+T L+ MRGPRRFLFR
Sbjct  168  RKEENFLPGAVSQYRTYEDAFFNKVKDGVMVARENPAIGVGLAVSTALLVMRGPRRFLFR  227

Query  413  NTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            +TLGRF+SEEA++  AEKNVK+L LSVDL+KKES KL +R ALA  EMK GHSELMN G
Sbjct  228  HTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESIKLLQRTALAEKEMKYGHSELMNTG  286



>gb|KDO54526.1| hypothetical protein CISIN_1g025242mg [Citrus sinensis]
Length=250

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +2

Query  242  QDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTL  421
            QDF+    SQY+ YEDA F KVKDE+  AREHPA   G+A+  GL+FMRGPRRFLFR+T 
Sbjct  68   QDFVLHGVSQYQTYEDAFFSKVKDELVSAREHPAAATGVALTAGLLFMRGPRRFLFRHTF  127

Query  422  GRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            GR RSEEA F +AEKNV EL LS +LMKKES KL ERAALA  EM RG +EL NAG 
Sbjct  128  GRLRSEEAMFVRAEKNVNELNLSGELMKKESKKLLERAALAEKEMIRGETELKNAGN  184



>ref|XP_006413187.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
 gb|ESQ54640.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
Length=245

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = +2

Query  146  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +D  RTV+ES DSAIRSAR  +  S+   RS+QDF+P   +QYK YE+A F KV +E+  
Sbjct  47   DDFQRTVKESKDSAIRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTEELIY  106

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A+EHPA   GI +A GL+ MRGPRRFLFR+TLGRF+SEEAQF KAEK+V+EL +SVDLMK
Sbjct  107  AKEHPAAAAGIGLAAGLVLMRGPRRFLFRHTLGRFQSEEAQFLKAEKHVQELNMSVDLMK  166

Query  506  KESGKLFER  532
            KES KL ER
Sbjct  167  KESRKLLER  175



>ref|XP_004294933.1| PREDICTED: uncharacterized protein LOC101308945 [Fragaria vesca 
subsp. vesca]
Length=249

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 103/148 (70%), Gaps = 7/148 (5%)
 Frame = +2

Query  149  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  328
            DL R+V +S DSA+RSAR+ Q+   G       ++ + +S+Y+ YE A F K+K+ V+ A
Sbjct  43   DLQRSVMQSRDSAMRSARILQHNMPG-------YIDKAASKYRTYEHAFFHKIKEGVKRA  95

Query  329  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  508
             E+PA   GI +    IF+RGPRRFLFRNTLGRF+S EA++ KAEKNV +L LSVDLMK+
Sbjct  96   AENPASTIGIGLTAAFIFLRGPRRFLFRNTLGRFQSLEAKYAKAEKNVNQLNLSVDLMKQ  155

Query  509  ESGKLFERAALAHTEMKRGHSELMNAGT  592
            ES KL ERA  A   MK G ++LM+ G+
Sbjct  156  ESKKLLERAGYAEKHMKVGQTDLMDVGS  183



>ref|XP_008220369.1| PREDICTED: uncharacterized protein LOC103320436 [Prunus mume]
Length=263

 Score =   152 bits (385),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 99/153 (65%), Gaps = 15/153 (10%)
 Frame = +2

Query  146  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLS----SQYKAYEDALFQKVKD  313
            EDL RTV +STDSAIRSAR           SLQ  LPQ      S Y+ YE+A F K+K+
Sbjct  56   EDLQRTVMQSTDSAIRSAR-----------SLQHHLPQYVEKAVSDYRTYENAFFTKIKE  104

Query  314  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  493
             +  AREHPA   GI +    + + GPRRF  R T  R +SEEAQF +AEKNVKEL LSV
Sbjct  105  GLMSAREHPASTLGIGLTAAFLLLPGPRRFFIRQTFSRLQSEEAQFVRAEKNVKELNLSV  164

Query  494  DLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            DLMKKES KL ERA LA  +MK G ++LM+ G+
Sbjct  165  DLMKKESKKLLERALLAEKDMKYGQTDLMDVGS  197



>ref|XP_007205735.1| hypothetical protein PRUPE_ppa010110mg [Prunus persica]
 gb|EMJ06934.1| hypothetical protein PRUPE_ppa010110mg [Prunus persica]
Length=263

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 98/153 (64%), Gaps = 15/153 (10%)
 Frame = +2

Query  146  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLS----SQYKAYEDALFQKVKD  313
            EDL RTV +STDSAIRSAR           SLQ  LPQ      S Y+ YE+A F K+K+
Sbjct  56   EDLQRTVMQSTDSAIRSAR-----------SLQHHLPQYVEKAVSDYRTYENAFFTKIKE  104

Query  314  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  493
             +  AREHP    GI +    + + GPRRF  R T  R +SEEAQF +AEKNVKEL LSV
Sbjct  105  GLMSAREHPTSTLGIGLTAAFLLLPGPRRFFIRQTFSRLQSEEAQFVRAEKNVKELNLSV  164

Query  494  DLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            DLMKKES KL ERA LA  +MK G ++LM+ G+
Sbjct  165  DLMKKESKKLLERALLAEKDMKYGQTDLMDVGS  197



>ref|XP_008384350.1| PREDICTED: uncharacterized protein LOC103446960 [Malus domestica]
Length=259

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 98/152 (64%), Gaps = 7/152 (5%)
 Frame = +2

Query  134  AYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKD  313
            A ++EDL RTV ESTDSA+RSAR  Q+        L  ++ +    Y+ YE A F K+K+
Sbjct  48   ATMAEDLQRTVMESTDSAVRSARYIQH-------HLPQYIGKAVDNYRIYEHAFFTKIKE  100

Query  314  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  493
             +  A E+PA   GI +    + + GPRRFLFR T  R +SEEAQF  AEK+VKEL LSV
Sbjct  101  GLTSAIENPAPTLGIGLTAAFLVLPGPRRFLFRQTFRRLQSEEAQFLSAEKSVKELNLSV  160

Query  494  DLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            DLM KES KL ERA LA  +M  GH++LM+ G
Sbjct  161  DLMXKESKKLLERALLAEKDMTYGHTDLMDVG  192



>ref|XP_009339217.1| PREDICTED: uncharacterized protein LOC103931455 [Pyrus x bretschneideri]
Length=259

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 98/152 (64%), Gaps = 7/152 (5%)
 Frame = +2

Query  134  AYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKD  313
            A ++EDL RT  ESTDSA+RSAR  Q+        L  ++ +    Y+ YE A F K+K+
Sbjct  48   ATMAEDLQRTGMESTDSAVRSARYIQH-------HLPQYIGKAVDNYRIYEHAFFTKIKE  100

Query  314  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  493
             +  A E+PA   GI +    + + GPRRFLFR T  R +SEEAQF  AEK+VKEL LSV
Sbjct  101  GLTSAIENPAPTLGIGLTAAFLVLPGPRRFLFRQTFRRLQSEEAQFLSAEKSVKELNLSV  160

Query  494  DLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            DLMKKES KL ERA LA  +M  GH++LM+ G
Sbjct  161  DLMKKESKKLLERALLAEKDMTYGHNDLMDVG  192



>ref|XP_009589516.1| PREDICTED: uncharacterized protein LOC104086877 [Nicotiana tomentosiformis]
Length=234

 Score =   141 bits (356),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = +2

Query  110  QQRDKPWHAYISEDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYED  289
            Q +DK WH+YISEDLPRTVQESTDSA+RSAR  Q TSS HLR+LQDF+P++ +QY  YE+
Sbjct  23   QNKDKAWHSYISEDLPRTVQESTDSALRSARSIQYTSSTHLRTLQDFMPKIKAQYTTYEE  82

Query  290  ALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFN  454
              F+K+KDE+  AREHPA+ GGI +A  L+ MRG      R+T GR  S    F+
Sbjct  83   VFFKKIKDELVTAREHPAMAGGIGIAASLLLMRGN-----RSTPGREISHRKSFS  132



>emb|CAA18229.1| putative protein [Arabidopsis thaliana]
 emb|CAB79496.1| putative protein [Arabidopsis thaliana]
Length=266

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 103/151 (68%), Gaps = 5/151 (3%)
 Frame = +2

Query  149  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  328
            DL RTV+ES D+A+RSAR  +  S+   RS+QDF+P   +QYK YE+A F KV DE+  A
Sbjct  50   DLQRTVKESKDTAMRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTDELIYA  109

Query  329  REHPAVVGGIAVATGLIFMRGPR----RFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVD  496
            +EHPA   GI VA  L+ MR         +F +T  +  S +AQF KAEK+V+EL +SVD
Sbjct  110  KEHPAAAIGIGVAASLVLMRVALVCVPSLIFTST-SKSSSLQAQFLKAEKHVQELNMSVD  168

Query  497  LMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            LMKKES KL ER ALA  +MKRG SELMN+G
Sbjct  169  LMKKESRKLLERTALAEKDMKRGLSELMNSG  199



>gb|KJB83393.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=169

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +2

Query  317  VEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVD  496
            V IA+E+P    GI +   L  MRGPRRFLFRNTLGRF+SEEA+F++AEKNVK L LSVD
Sbjct  12   VMIAKENPGAAVGITLTAALCLMRGPRRFLFRNTLGRFQSEEAKFSRAEKNVKVLNLSVD  71

Query  497  LMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            LMKKES KL ERAALA  +MKRG  ELMN+G
Sbjct  72   LMKKESSKLLERAALAEKDMKRGQKELMNSG  102



>ref|XP_010921336.1| PREDICTED: uncharacterized protein LOC105044929 [Elaeis guineensis]
Length=250

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 93/139 (67%), Gaps = 0/139 (0%)
 Frame = +2

Query  173  STDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVG  352
            S  S +R A   Q  SS  LRSLQD++ ++ +QYK +EDA  QKVKD++ IAREHP    
Sbjct  45   SNGSVLRFAPSPQENSSWSLRSLQDYMTRVQAQYKVHEDAFVQKVKDQLMIAREHPTETF  104

Query  353  GIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFER  532
            GI VA GL+ M+GPRRFL RNT GR  SE+ +  KAE  +KEL  SV+ +KK+S  +  +
Sbjct  105  GIVVAAGLVLMQGPRRFLLRNTFGRLVSEQDRSAKAELCLKELSQSVEKLKKDSKNMLLK  164

Query  533  AALAHTEMKRGHSELMNAG  589
            A+    +++RGH+++  AG
Sbjct  165  ASWGEQDLQRGHAKIRAAG  183



>ref|XP_008781206.1| PREDICTED: uncharacterized protein LOC103701046 [Phoenix dactylifera]
Length=248

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 91/136 (67%), Gaps = 0/136 (0%)
 Frame = +2

Query  182  SAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  361
            SA+R A   Q  SS  L+ LQD++P + + YK YEDA  +KVKD++ IAR+HP    G+ 
Sbjct  46   SALRFAPSPQENSSWSLQRLQDYMPSVQAWYKDYEDAFVKKVKDQLMIARDHPTETFGVV  105

Query  362  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  541
            VA G + M+GPRRFL RNT+GR  SE+ +  KAE  +KEL  SVD +KK+S  +  +A+ 
Sbjct  106  VAAGFVLMQGPRRFLVRNTIGRLLSEQDRSAKAELCLKELSQSVDKLKKDSKNMLLKASW  165

Query  542  AHTEMKRGHSELMNAG  589
               +++RGH+++  AG
Sbjct  166  GEQDLQRGHTKIRAAG  181



>ref|XP_002511643.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50312.1| conserved hypothetical protein [Ricinus communis]
Length=267

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 106/185 (57%), Gaps = 16/185 (9%)
 Frame = +2

Query  83   SSPAPAATPQ---------QRDKPWHAY-ISEDLP--RTVQESTDSAIRSARL----FQN  214
            S PAP+  P+         +   PW  Y I + L   +T++E+ D A ++ R      ++
Sbjct  16   SPPAPSHFPEAEMIKYKTLEEVTPWIDYAIQQALTYQKTIEEAVDDATKALRSRFSEIRS  75

Query  215  TSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGP  394
            TSS H     D L  + S+  AYED LF KVKD V +A  HP + GG+AV  G +  + P
Sbjct  76   TSSAHFNQTMDSLQDVKSELGAYEDTLFGKVKDGVNVAASHPLITGGVAVGLGFVLFKRP  135

Query  395  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  574
            RRFL+ NTL  F SEEA  +KA+  VKEL+ S+ L++ ES KL +RA+ A  E+ RG ++
Sbjct  136  RRFLYYNTLRLFVSEEALLSKADAKVKELQQSISLLRAESEKLEKRASSAEGELIRGRTK  195

Query  575  LMNAG  589
            L  AG
Sbjct  196  LRQAG  200



>gb|KDP28809.1| hypothetical protein JCGZ_14580 [Jatropha curcas]
Length=264

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 99/177 (56%), Gaps = 30/177 (17%)
 Frame = +2

Query  149  DLPRTVQEST--------DSAIRSARLFQ----------------------NTSSGHLRS  238
            D P T++  T        DSA++ A ++Q                      +TSS H   
Sbjct  21   DFPSTIKSKTLEEVTPWIDSAVQQALIYQKNMEETLEGATSVFRSRFSEIRSTSSAHFHQ  80

Query  239  LQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNT  418
              D L    S++ AYED LF KVK+ V+IA  HP + GG+AV  GL  ++ PRRFL+ NT
Sbjct  81   TIDSLQDFKSEFDAYEDMLFGKVKEGVKIAVSHPIITGGVAVGLGLALLKRPRRFLYYNT  140

Query  419  LGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            L  F SEE+  ++A+  VKELR S+ L+K ES K+ +RA+LA TE+ RG ++L  AG
Sbjct  141  LRLFVSEESLLSQADAKVKELRQSISLLKAESEKIEKRASLAETELIRGRTKLRQAG  197



>ref|XP_010258900.1| PREDICTED: uncharacterized protein LOC104598502 [Nelumbo nucifera]
Length=250

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 101/177 (57%), Gaps = 8/177 (5%)
 Frame = +2

Query  83   SSPAPAATPQQRDK-PWHAYISED---LPRTVQESTDSAIRSA--RL--FQNTSSGHLRS  238
            S   P  +P +  + PW  Y  +    + +T+QE+ DS I  A  RL   ++TSS HL  
Sbjct  7    SEEKPELSPMENQQTPWIEYAVQQAQLVQKTIQETVDSTIEVAGSRLSEIRSTSSAHLHQ  66

Query  239  LQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNT  418
              D L  + S++  YED  F K+KD + +A  HP +  G+A   GL+ ++ PR FL+ +T
Sbjct  67   TLDNLQDIKSEFNTYEDVFFGKIKDGLTLAALHPMITCGVAAGVGLVALKRPRLFLYHST  126

Query  419  LGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            L  F SEE+   +A+  VK LR S+ LMK ES KL +RA  A  EMKRG ++L  AG
Sbjct  127  LRLFMSEESLLARADSKVKALRQSIALMKAESEKLEKRALQAEQEMKRGRTKLRQAG  183



>ref|XP_008232561.1| PREDICTED: uncharacterized protein LOC103331692 [Prunus mume]
Length=264

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 98/169 (58%), Gaps = 7/169 (4%)
 Frame = +2

Query  104  TPQQRDKPWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQL  262
            T +Q   PW  Y  E      +T++E+ +SAI ++R      ++TS+ H     + L  +
Sbjct  29   TLEQSATPWIDYAVEQARVYQKTIEETFESAIEASRSRLSEIRSTSAAHFSQTINSLEDI  88

Query  263  SSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEE  442
             S Y  YED  F K+K+ V IA  HP + GG+A   GL+ ++ PRR L+  TL  F SEE
Sbjct  89   KSDYGTYEDMFFGKIKEGVLIAASHPMITGGVAAGLGLLVLKRPRRMLYHKTLRLFVSEE  148

Query  443  AQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            +  ++A+  VKELR S+DL+K E  KL +RA+ A  E+ RG ++L + G
Sbjct  149  SLLSRADAKVKELRHSIDLLKAEGEKLEKRASHAEEELIRGRTKLRHTG  197



>ref|XP_007052190.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOX96347.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=290

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 97/162 (60%), Gaps = 7/162 (4%)
 Frame = +2

Query  125  PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAY  283
            PW  Y  E      + ++++ ++ I ++R     F +TS+ H     D L  + SQ   Y
Sbjct  56   PWIDYAVEQALLYQKIIEQNINATIEASRSRLSEFGSTSAAHFNQTIDSLEDVKSQLAVY  115

Query  284  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAE  463
            E+ +F KVK+ ++IA  HP + GGIAV  G++ ++ PRRFL+ NTL  F SEE+  +KA+
Sbjct  116  ENMMFGKVKEGIKIAASHPMITGGIAVGLGVLVLKRPRRFLYYNTLRLFVSEESWLSKAD  175

Query  464  KNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
              VKELR S+D +K ES KL   A++A  ++ RG  +L +AG
Sbjct  176  IRVKELRQSIDRLKTESVKLERSASVAEEDLIRGRKKLRHAG  217



>ref|XP_007052188.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX96345.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=284

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 97/162 (60%), Gaps = 7/162 (4%)
 Frame = +2

Query  125  PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAY  283
            PW  Y  E      + ++++ ++ I ++R     F +TS+ H     D L  + SQ   Y
Sbjct  56   PWIDYAVEQALLYQKIIEQNINATIEASRSRLSEFGSTSAAHFNQTIDSLEDVKSQLAVY  115

Query  284  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAE  463
            E+ +F KVK+ ++IA  HP + GGIAV  G++ ++ PRRFL+ NTL  F SEE+  +KA+
Sbjct  116  ENMMFGKVKEGIKIAASHPMITGGIAVGLGVLVLKRPRRFLYYNTLRLFVSEESWLSKAD  175

Query  464  KNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
              VKELR S+D +K ES KL   A++A  ++ RG  +L +AG
Sbjct  176  IRVKELRQSIDRLKTESVKLERSASVAEEDLIRGRKKLRHAG  217



>ref|XP_007052189.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX96346.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=285

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 97/162 (60%), Gaps = 7/162 (4%)
 Frame = +2

Query  125  PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAY  283
            PW  Y  E      + ++++ ++ I ++R     F +TS+ H     D L  + SQ   Y
Sbjct  56   PWIDYAVEQALLYQKIIEQNINATIEASRSRLSEFGSTSAAHFNQTIDSLEDVKSQLAVY  115

Query  284  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAE  463
            E+ +F KVK+ ++IA  HP + GGIAV  G++ ++ PRRFL+ NTL  F SEE+  +KA+
Sbjct  116  ENMMFGKVKEGIKIAASHPMITGGIAVGLGVLVLKRPRRFLYYNTLRLFVSEESWLSKAD  175

Query  464  KNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
              VKELR S+D +K ES KL   A++A  ++ RG  +L +AG
Sbjct  176  IRVKELRQSIDRLKTESVKLERSASVAEEDLIRGRKKLRHAG  217



>ref|XP_004984525.1| PREDICTED: uncharacterized protein LOC101782823 isoform X2 [Setaria 
italica]
Length=210

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 80/126 (63%), Gaps = 0/126 (0%)
 Frame = +2

Query  212  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRG  391
            +TS   LR LQ F P L SQYK YE+A+ +  KD + + +EH A   G A   G I  RG
Sbjct  18   STSPWPLRKLQSFTPGLWSQYKVYENAVVESTKDALVLVKEHQAEAIGCATVAGFILFRG  77

Query  392  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHS  571
            PRRFL+RNT GRF++E+   N AE+++ E + S+  +KKES    ++ A+  ++++RG +
Sbjct  78   PRRFLYRNTFGRFKTEKDLLNDAEESMMEYKTSIANLKKESKYTLDKVAIGESDLQRGQT  137

Query  572  ELMNAG  589
            +L + G
Sbjct  138  DLRSTG  143



>ref|XP_006838189.1| hypothetical protein AMTR_s00106p00135890 [Amborella trichopoda]
 gb|ERN00758.1| hypothetical protein AMTR_s00106p00135890 [Amborella trichopoda]
Length=263

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 104/162 (64%), Gaps = 7/162 (4%)
 Frame = +2

Query  125  PWHAYI---SEDLPRTVQESTDSAIRS--ARLF--QNTSSGHLRSLQDFLPQLSSQYKAY  283
            PW  Y    +E + +T+ E+TDSA+ +  +RLF    TSS H    ++ L  + ++Y  Y
Sbjct  35   PWIEYAVQEAESIKKTLMEATDSALEATRSRLFDIHATSSAHFYQAKEALLDVKTKYSEY  94

Query  284  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAE  463
            ED++F KVK+ + IA  HP++  G+AV +G++ M+ PRR+LF +    F SEE+    AE
Sbjct  95   EDSMFGKVKEGLLIAASHPSLACGVAVGSGVLIMKRPRRYLFNSVQRLFVSEESMLASAE  154

Query  464  KNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
              VKELR S++L+K ES KL ERA LA  EM+RG ++L +AG
Sbjct  155  AKVKELRQSIELVKNESKKLEERARLAEEEMRRGQTKLRHAG  196



>ref|XP_009393907.1| PREDICTED: uncharacterized protein LOC103979471 [Musa acuminata 
subsp. malaccensis]
Length=212

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 85/140 (61%), Gaps = 0/140 (0%)
 Frame = +2

Query  170  ESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVV  349
            +ST  A+ SA+  Q  S   L   QD + ++ S ++AYEDAL    KDE+ +A +HP   
Sbjct  6    DSTGPAVGSAQSSQQRSPRPLEKFQDLMLRVRSHWQAYEDALVHNAKDELLVAYDHPLEA  65

Query  350  GGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFE  529
             G+ V  G++ +RGPRRFL+R TLGRF++EE +   AE  ++E+  SV  +KKES  L  
Sbjct  66   CGVVVVAGILLLRGPRRFLYRKTLGRFKTEEERLTDAESFLREINESVTKLKKESKNLLT  125

Query  530  RAALAHTEMKRGHSELMNAG  589
            + +    ++ RG +++  AG
Sbjct  126  KVSYGEEDLHRGRTKIRAAG  145



>ref|XP_010053946.1| PREDICTED: uncharacterized protein LOC104442278 [Eucalyptus grandis]
 gb|KCW78322.1| hypothetical protein EUGRSUZ_D02501 [Eucalyptus grandis]
Length=268

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 97/167 (58%), Gaps = 13/167 (8%)
 Frame = +2

Query  125  PWHAYISEDLPRTVQESTDSAIRS------ARLFQ--NTSSGH----LRSLQDFLPQLSS  268
            PW  Y + D  R +++  +  + S      +RL Q  +T++ H    +  +QD   ++ S
Sbjct  36   PWVDY-AVDQARLLRKGVEDDVGSFAEASRSRLAQIRSTAAAHTMMTVAMIQDTFQEVKS  94

Query  269  QYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQ  448
            +Y AYED  F KVK  +EIA  +P +  G+   +G I ++ PRRFL+ NTL    SEE+ 
Sbjct  95   KYDAYEDIFFGKVKGGIEIAASNPMLTAGVVTGSGFIVLKRPRRFLYYNTLRLLMSEESM  154

Query  449  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
             ++A+  VKELR S+DL+K ES KL  RA LA  EM RG ++L  AG
Sbjct  155  LSRADAKVKELRKSIDLLKAESEKLERRAQLAEEEMLRGRTKLRQAG  201



>ref|XP_002465337.1| hypothetical protein SORBIDRAFT_01g036710 [Sorghum bicolor]
 gb|EER92335.1| hypothetical protein SORBIDRAFT_01g036710 [Sorghum bicolor]
Length=214

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 80/130 (62%), Gaps = 4/130 (3%)
 Frame = +2

Query  212  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVK----DEVEIAREHPAVVGGIAVATGLI  379
            +TS   LR LQ F P L SQYKAYEDA+ +  K    D + + REH     G A   G I
Sbjct  18   STSPWPLRKLQSFTPGLWSQYKAYEDAVVEGTKGTIADALVLVREHQTEAIGCATVAGFI  77

Query  380  FMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMK  559
              RGPRRFL+RNT GRF++E+   N AE+++ E + S+  +KKES    ++ A+  ++++
Sbjct  78   LFRGPRRFLYRNTFGRFKTEKDLLNDAEQSMMEYKTSIQNLKKESKYTLDKVAVGESDLQ  137

Query  560  RGHSELMNAG  589
            RG ++L + G
Sbjct  138  RGRTDLRSTG  147



>gb|KCW78323.1| hypothetical protein EUGRSUZ_D02501 [Eucalyptus grandis]
Length=270

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 97/167 (58%), Gaps = 13/167 (8%)
 Frame = +2

Query  125  PWHAYISEDLPRTVQESTDSAIRS------ARLFQ--NTSSGH----LRSLQDFLPQLSS  268
            PW  Y + D  R +++  +  + S      +RL Q  +T++ H    +  +QD   ++ S
Sbjct  36   PWVDY-AVDQARLLRKGVEDDVGSFAEASRSRLAQIRSTAAAHTMMTVAMIQDTFQEVKS  94

Query  269  QYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQ  448
            +Y AYED  F KVK  +EIA  +P +  G+   +G I ++ PRRFL+ NTL    SEE+ 
Sbjct  95   KYDAYEDIFFGKVKGGIEIAASNPMLTAGVVTGSGFIVLKRPRRFLYYNTLRLLMSEESM  154

Query  449  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
             ++A+  VKELR S+DL+K ES KL  RA LA  EM RG ++L  AG
Sbjct  155  LSRADAKVKELRKSIDLLKAESEKLERRAQLAEEEMLRGRTKLRQAG  201



>ref|XP_011017444.1| PREDICTED: uncharacterized protein LOC105120771 [Populus euphratica]
Length=270

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 99/184 (54%), Gaps = 9/184 (5%)
 Frame = +2

Query  59   PSTEIDETSSPAPAATPQQRDKPW-HAYISEDL--PRTVQESTDSAIRSARL----FQNT  217
            P+ E D TS     A   +   PW  + + + L   +T+Q+S D AI S++        T
Sbjct  22   PTAETDLTSILKSKAV--EETAPWIDSALQQALVYQKTIQDSLDIAIESSKSRFSEIITT  79

Query  218  SSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPR  397
            S  H     D L  + S+   YED LF K K+ + +A  HP +   +AV  G + ++ PR
Sbjct  80   SQAHFSQTIDSLQDVKSEIGVYEDKLFGKAKEGINVAASHPLITSAVAVGLGFVVLKRPR  139

Query  398  RFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  577
            R L+  TL  F SEEA  ++A+  VKELR S+ L+K ES KL  RA+LA  E+ RG ++L
Sbjct  140  RILYYKTLRLFTSEEALLSQADAKVKELRQSISLLKAESEKLERRASLAEEELIRGRTKL  199

Query  578  MNAG  589
              AG
Sbjct  200  RQAG  203



>gb|KDO85660.1| hypothetical protein CISIN_1g024845mg [Citrus sinensis]
Length=217

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 91/148 (61%), Gaps = 4/148 (3%)
 Frame = +2

Query  158  RTVQESTDSAIRSAR--LFQN--TSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            + V+ES DSAI ++R  L Q   T+S H +   D+L  + S+Y AYEDA   KVK+ + +
Sbjct  47   KIVEESIDSAIEASRSRLSQTRLTASVHFQQTLDYLQDVKSEYAAYEDAAVGKVKEGIHV  106

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  HP +  G A+  G   ++ PR FL+ NTL  F SEE+  ++A+  VK+LR S+D +K
Sbjct  107  AASHPFITAGGAIGLGSFLLKRPRHFLYYNTLRLFASEESLLSRADTKVKQLRQSIDRLK  166

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
             ES KL + A +A  E+ RG ++L  AG
Sbjct  167  AESEKLEKVALVAEDELIRGRTKLRQAG  194



>ref|XP_001760783.1| predicted protein [Physcomitrella patens]
 gb|EDQ74522.1| predicted protein [Physcomitrella patens]
Length=387

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 94/164 (57%), Gaps = 6/164 (4%)
 Frame = +2

Query  119  DKPWHAYISE--DLPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKA  280
            D  W  Y ++   +      STD A+R+AR+     Q+ SS    + Q    +   +Y  
Sbjct  77   DDSWSFYTAQAQSMGHRALNSTDEALRTARVQIDQLQDASSQQFAAAQKLADRAKQEYTH  136

Query  281  YEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKA  460
            YE  +F+K+K+ V IA ++P    GI   T L+ +R PRR L+R T+G+FRSEEA   +A
Sbjct  137  YEGLVFKKLKEGVNIAVQNPNATFGILGVTTLLALRTPRRLLYRYTIGQFRSEEAMLTRA  196

Query  461  EKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGT  592
            E  VKE+  +VD +K E+ KL ERA LA  E  RG ++L N+G+
Sbjct  197  ETKVKEMHQTVDSLKNETKKLEERAKLAEEEFLRGMTKLKNSGS  240



>ref|XP_009617840.1| PREDICTED: uncharacterized protein LOC104110119, partial [Nicotiana 
tomentosiformis]
Length=133

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  392  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHS  571
            PRRFLFR TLGR +SEEA+F+KAEKNVKEL LSVDLMKKES KL ERAALA  +MKRG S
Sbjct  1    PRRFLFRQTLGRLQSEEAKFSKAEKNVKELSLSVDLMKKESKKLLERAALAEKDMKRGLS  60

Query  572  ELMNAGT  592
            ELM+AG 
Sbjct  61   ELMDAGN  67



>ref|XP_002302514.1| hypothetical protein POPTR_0002s14390g [Populus trichocarpa]
 gb|EEE81787.1| hypothetical protein POPTR_0002s14390g [Populus trichocarpa]
Length=270

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 98/187 (52%), Gaps = 15/187 (8%)
 Frame = +2

Query  59   PSTEIDETSSPAPAATPQQRDKPW------HAYISEDLPRTVQESTDSAIRSARL----F  208
            P+ E D TS     A   +   PW       A I +   +T+Q+S D AI S++      
Sbjct  22   PTAETDLTSILKSKAL--EETAPWIDNALQQALIYQ---KTIQDSLDIAIESSKSRFSEI  76

Query  209  QNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMR  388
              TS  H     D L   +S+   YED LF K K+ + +A  HP +   +AV  G + ++
Sbjct  77   ITTSQAHFSQTIDSLQYFTSEIGVYEDKLFGKAKEGINVAASHPLITSAVAVGLGFVVLK  136

Query  389  GPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGH  568
             PRR L+  TL  F SEEA  ++A+  VKELR S+ L+K ES KL  RA+LA  E+ RG 
Sbjct  137  RPRRILYYKTLRLFTSEEALLSQADAKVKELRQSISLLKAESEKLERRASLAEEELIRGR  196

Query  569  SELMNAG  589
            ++L  AG
Sbjct  197  TKLRQAG  203



>ref|NP_001049981.1| Os03g0324800 [Oryza sativa Japonica Group]
 gb|ABF95704.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11895.1| Os03g0324800 [Oryza sativa Japonica Group]
 dbj|BAG92495.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87177.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58974.1| hypothetical protein OsJ_10675 [Oryza sativa Japonica Group]
Length=214

 Score =   109 bits (273),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 80/130 (62%), Gaps = 4/130 (3%)
 Frame = +2

Query  212  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVK----DEVEIAREHPAVVGGIAVATGLI  379
            +TS   LR LQ F P L SQYKAYE+A     K    D + +  EH     G A   G I
Sbjct  18   STSPWPLRKLQSFTPGLCSQYKAYENAFVDMAKGTISDAMVLVNEHQTEAIGCATVAGFI  77

Query  380  FMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMK  559
             +RGPRRFL+RNTLGRF++E+   N AE+++ E + S++ +KK+S    ++ A+  ++++
Sbjct  78   LLRGPRRFLYRNTLGRFKTEKDLLNDAEQSMMEYKTSIEQLKKDSKYTLDKIAVGESDLQ  137

Query  560  RGHSELMNAG  589
            RG ++L + G
Sbjct  138  RGQTDLRSTG  147



>ref|XP_010436412.1| PREDICTED: uncharacterized protein LOC104720153 [Camelina sativa]
Length=153

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  328
            DL  TV+ESTDSA+RSAR F+  S+ H RS+QDF+P   +QYK YE+A F KV +E+  A
Sbjct  50   DLQHTVKESTDSAMRSARSFRENSNSHFRSIQDFIPHALTQYKTYENAFFSKVTEELTYA  109

Query  329  REHPAVVGGIAVATGLIFMRGPRRFLFRNTL  421
            +EHPA   GI VA  L+ MRGPRRF FR TL
Sbjct  110  KEHPAAAVGIGVAASLVLMRGPRRFFFRQTL  140



>gb|KDO85659.1| hypothetical protein CISIN_1g024845mg [Citrus sinensis]
Length=237

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 91/148 (61%), Gaps = 4/148 (3%)
 Frame = +2

Query  158  RTVQESTDSAIRSAR--LFQN--TSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            + V+ES DSAI ++R  L Q   T+S H +   D+L  + S+Y AYEDA   KVK+ + +
Sbjct  47   KIVEESIDSAIEASRSRLSQTRLTASVHFQQTLDYLQDVKSEYAAYEDAAVGKVKEGIHV  106

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  HP +  G A+  G   ++ PR FL+ NTL  F SEE+  ++A+  VK+LR S+D +K
Sbjct  107  AASHPFITAGGAIGLGSFLLKRPRHFLYYNTLRLFASEESLLSRADTKVKQLRQSIDRLK  166

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
             ES KL + A +A  E+ RG ++L  AG
Sbjct  167  AESEKLEKVALVAEDELIRGRTKLRQAG  194



>ref|XP_006445337.1| hypothetical protein CICLE_v10021755mg [Citrus clementina]
 ref|XP_006490844.1| PREDICTED: uncharacterized protein LOC102630500 [Citrus sinensis]
 gb|ESR58577.1| hypothetical protein CICLE_v10021755mg [Citrus clementina]
 gb|KDO85658.1| hypothetical protein CISIN_1g024845mg [Citrus sinensis]
Length=261

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 91/148 (61%), Gaps = 4/148 (3%)
 Frame = +2

Query  158  RTVQESTDSAIRSAR--LFQN--TSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            + V+ES DSAI ++R  L Q   T+S H +   D+L  + S+Y AYEDA   KVK+ + +
Sbjct  47   KIVEESIDSAIEASRSRLSQTRLTASVHFQQTLDYLQDVKSEYAAYEDAAVGKVKEGIHV  106

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  HP +  G A+  G   ++ PR FL+ NTL  F SEE+  ++A+  VK+LR S+D +K
Sbjct  107  AASHPFITAGGAIGLGSFLLKRPRHFLYYNTLRLFASEESLLSRADTKVKQLRQSIDRLK  166

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
             ES KL + A +A  E+ RG ++L  AG
Sbjct  167  AESEKLEKVALVAEDELIRGRTKLRQAG  194



>ref|XP_008670078.1| PREDICTED: uncharacterized protein LOC100276044 isoform X1 [Zea 
mays]
 gb|ACF85910.1| unknown [Zea mays]
 gb|ACG28462.1| hypothetical protein [Zea mays]
 gb|ACG32171.1| hypothetical protein [Zea mays]
 tpg|DAA45114.1| TPA: hypothetical protein ZEAMMB73_628651 [Zea mays]
Length=214

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 79/128 (62%), Gaps = 4/128 (3%)
 Frame = +2

Query  218  SSGHLRSLQDFLPQLSSQYKAYEDALFQKVK----DEVEIAREHPAVVGGIAVATGLIFM  385
            SS   R LQ F P L SQYKAYEDA+ + +K    D + + REH A   G A   G I  
Sbjct  20   SSWPPRKLQSFTPGLWSQYKAYEDAVVENIKGTIADALVLVREHQAEAIGCATVAGFILF  79

Query  386  RGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRG  565
            RGPRRFL+RNT GR ++E+   N AE+++ E + S+  +KKES    ++ A+  ++++RG
Sbjct  80   RGPRRFLYRNTFGRLKTEKDLLNDAEQSMMEYQTSIQNLKKESKYTLDKVAIGESDVQRG  139

Query  566  HSELMNAG  589
             ++L + G
Sbjct  140  RTDLRSTG  147



>ref|XP_010456590.1| PREDICTED: uncharacterized protein LOC104738049 [Camelina sativa]
Length=153

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  328
            DL  TV+ESTDSA+RSAR F+  S+ H RS+QDF+P   +QYK YE+A F KV +E+  A
Sbjct  50   DLQHTVKESTDSAMRSARSFRENSTSHFRSIQDFIPHALTQYKTYENAFFSKVTEELTYA  109

Query  329  REHPAVVGGIAVATGLIFMRGPRRFLFRNTL  421
            +EHPA   GI VA GL+ MRGPRRF FR TL
Sbjct  110  KEHPAAAVGIGVAAGLLLMRGPRRFFFRQTL  140



>ref|XP_004984524.1| PREDICTED: uncharacterized protein LOC101782823 isoform X1 [Setaria 
italica]
Length=214

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 80/130 (62%), Gaps = 4/130 (3%)
 Frame = +2

Query  212  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVK----DEVEIAREHPAVVGGIAVATGLI  379
            +TS   LR LQ F P L SQYK YE+A+ +  K    D + + +EH A   G A   G I
Sbjct  18   STSPWPLRKLQSFTPGLWSQYKVYENAVVESTKGTIADALVLVKEHQAEAIGCATVAGFI  77

Query  380  FMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMK  559
              RGPRRFL+RNT GRF++E+   N AE+++ E + S+  +KKES    ++ A+  ++++
Sbjct  78   LFRGPRRFLYRNTFGRFKTEKDLLNDAEESMMEYKTSIANLKKESKYTLDKVAIGESDLQ  137

Query  560  RGHSELMNAG  589
            RG ++L + G
Sbjct  138  RGQTDLRSTG  147



>dbj|BAK05826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=214

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 79/130 (61%), Gaps = 4/130 (3%)
 Frame = +2

Query  212  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVK----DEVEIAREHPAVVGGIAVATGLI  379
            + SS  LR LQ F P L SQYKAYED   ++ K    D V +A EH     G A   G I
Sbjct  18   SASSWPLRKLQSFTPGLWSQYKAYEDVFVERAKVTISDAVVLASEHQVEAIGCATVAGFI  77

Query  380  FMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMK  559
              RGPRRFL+RNTLGRF++E+   N  E+++ E + S++ ++K+S    ++  +  ++++
Sbjct  78   LFRGPRRFLYRNTLGRFKTEKDLLNDVEQSMIEYKTSIESLRKDSKYTLDKVVIGESDLQ  137

Query  560  RGHSELMNAG  589
            RG ++L + G
Sbjct  138  RGRTDLRSTG  147



>ref|XP_004306965.1| PREDICTED: uncharacterized protein LOC101308610 [Fragaria vesca 
subsp. vesca]
Length=274

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 93/169 (55%), Gaps = 7/169 (4%)
 Frame = +2

Query  104  TPQQRDKPWHAYI---SEDLPRTVQESTDSAIRSAR----LFQNTSSGHLRSLQDFLPQL  262
            T  Q   PW  Y    +    + ++E+ +SA+ ++R     F+ T S HL    D +  +
Sbjct  39   TLDQPPTPWIDYAIAQARVYQKNIEETLNSALEASRSRLSQFRATGSAHLSQTIDLVEDV  98

Query  263  SSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEE  442
             + Y  YE+    K+++   +A  HP + GG+A A GL+ ++GPRRFL+  +L    SEE
Sbjct  99   KTNYADYENTFLAKIREGASVAASHPLITGGVATALGLVVLKGPRRFLYYKSLRLLMSEE  158

Query  443  AQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            +  N+A   VKELR ++D++K ES KL  RAA A  E  +G  +L  AG
Sbjct  159  SLLNRAHIEVKELRHAIDVLKAESQKLEIRAANAENEFIQGRKKLRYAG  207



>ref|XP_006650015.1| PREDICTED: uncharacterized protein LOC102714271 [Oryza brachyantha]
Length=214

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 78/130 (60%), Gaps = 4/130 (3%)
 Frame = +2

Query  212  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQ----KVKDEVEIAREHPAVVGGIAVATGLI  379
            +TS   LR LQ   P L SQYKAYEDA        V D + +  EH A   G A   G I
Sbjct  18   STSPWPLRKLQSLTPGLWSQYKAYEDAFVHMAKGTVSDALVLVNEHQAEAIGCATVAGFI  77

Query  380  FMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMK  559
             +RGPRRFL+RNTLGRF++E+   N AE+++ E + S+  +KK+S    ++ A+  ++++
Sbjct  78   LLRGPRRFLYRNTLGRFKTEKDLLNDAEQSMMEYKTSIKQLKKDSKYTLDKIAIGESDLQ  137

Query  560  RGHSELMNAG  589
            RG ++  + G
Sbjct  138  RGQTDFRSTG  147



>gb|EEC75161.1| hypothetical protein OsI_11375 [Oryza sativa Indica Group]
Length=192

 Score =   106 bits (264),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 79/130 (61%), Gaps = 4/130 (3%)
 Frame = +2

Query  212  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVK----DEVEIAREHPAVVGGIAVATGLI  379
            +TS   LR LQ F   L SQYKAYE+A     K    D + +  EH     G A   G I
Sbjct  18   STSPWPLRKLQSFTSGLCSQYKAYENAFVDMAKGTISDAMVLVNEHQTEAIGCATVAGFI  77

Query  380  FMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMK  559
             +RGPRRFL+RNTLGRF++E+   N AE+++ E + S++ +KK+S    ++ A+  ++++
Sbjct  78   LLRGPRRFLYRNTLGRFKTEKDLLNDAEQSMMEYKTSIEQLKKDSKYTLDKIAVGESDLQ  137

Query  560  RGHSELMNAG  589
            RG ++L + G
Sbjct  138  RGQTDLRSTG  147



>ref|XP_010524407.1| PREDICTED: uncharacterized protein LOC104802474 [Tarenaya hassleriana]
Length=269

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 87/147 (59%), Gaps = 4/147 (3%)
 Frame = +2

Query  161  TVQESTDSAIRSAR----LFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  328
            TV E+ +S I+++R      + TSS H     D L  ++S+Y  YE  LF KVK+ V +A
Sbjct  56   TVTETVESTIQASRSRLSQIRETSSAHFNQTLDSLRDIASEYTVYEHMLFGKVKEGVNVA  115

Query  329  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  508
              +P + GG+A   G+  ++  RRFL+ +TL  F SEEA  ++A+  VKELR S+D +K 
Sbjct  116  ASYPLISGGVAFGVGIFSLKRTRRFLYYSTLRIFSSEEALLSQADLKVKELRQSIDRLKA  175

Query  509  ESGKLFERAALAHTEMKRGHSELMNAG  589
            ES KL  R  +A  E+ RG  +L  AG
Sbjct  176  ESEKLERRTTVAEQELIRGRMKLRQAG  202



>ref|XP_002277999.1| PREDICTED: uncharacterized protein LOC100266783 [Vitis vinifera]
 emb|CBI16597.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 106/199 (53%), Gaps = 21/199 (11%)
 Frame = +2

Query  44   MASDVPSTEIDETSSPAPAATPQQRDKP---------WHAY---ISEDLPRTVQESTDSA  187
            MA+ V   E    S P+P   P   +KP         W  Y    ++ L +T+ ++ +S 
Sbjct  1    MATTVAECE----SKPSPGDYPPD-EKPKSLEEAASSWIEYGVNQAQLLHKTLDDTVNSF  55

Query  188  IRSA--RLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGG  355
            I ++  R  Q  +TSS HL+   + L  + S+Y  YED    K+K+ + +A  +P +  G
Sbjct  56   IEASGSRFSQILSTSSAHLQQTIESLKDVKSEYDVYEDLAVGKIKEGILVAASNPLITSG  115

Query  356  IAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERA  535
            + V  G + ++ PR FL+ NTL    SEE+   +A+  V ELR S+DL+K ES KL +RA
Sbjct  116  VCVGLGCLLLKRPRHFLYYNTLRLLVSEESMVARADAKVNELRKSIDLLKAESEKLEKRA  175

Query  536  ALAHTEMKRGHSELMNAGT  592
              A  EMKRG ++L  AG 
Sbjct  176  LQAEDEMKRGRTKLRQAGN  194



>gb|KEH22362.1| hypothetical protein MTR_7g445370 [Medicago truncatula]
Length=264

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 99/183 (54%), Gaps = 14/183 (8%)
 Frame = +2

Query  83   SSPAPAAT------PQQRD-KPWHAYISEDL---PRTVQESTDSAI--RSARLFQ--NTS  220
            S+PAP         PQ  D KP+  Y    +    +T  ++ DSAI   ++R  Q  +TS
Sbjct  15   STPAPTVNQSTTTNPQTLDVKPFIDYAVGHVLYYQKTFNDAVDSAIDASTSRFSQIRSTS  74

Query  221  SGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRR  400
            S H     D+L    SQY AYE+ LF K+K+ V +A  HP +  G   + GL+ ++ PRR
Sbjct  75   SAHFHQSLDYLDDFKSQYNAYEELLFGKIKEGVLVAASHPVITSGATASMGLLVLKRPRR  134

Query  401  FLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELM  580
            FL+ N    F SEE+  +KA + VKELR S+DL+K E  ++ + A  A  +   G ++L 
Sbjct  135  FLYYNMQRLFVSEESLVSKASEEVKELRQSIDLLKSEVERMEKSALHAEEQFLHGRTKLR  194

Query  581  NAG  589
             AG
Sbjct  195  QAG  197



>ref|XP_003558009.1| PREDICTED: uncharacterized protein LOC100838509 [Brachypodium 
distachyon]
Length=214

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 77/124 (62%), Gaps = 4/124 (3%)
 Frame = +2

Query  230  LRSLQDFLPQLSSQYKAYEDALFQKVK----DEVEIAREHPAVVGGIAVATGLIFMRGPR  397
            LR LQ F P L S YKAYED   ++ K    D + +A  H A   G A   G I +RGPR
Sbjct  24   LRKLQSFSPGLWSHYKAYEDVFVERAKVTISDALVLASGHQAEAIGCATVAGFILLRGPR  83

Query  398  RFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  577
            RFL+RNTLGRF++E+   N AE+++ E + S++ ++KES    ++  +  ++++RG ++L
Sbjct  84   RFLYRNTLGRFKTEKDLLNDAEQSMIEYKTSIENLRKESKYTLDKVVIGESDLQRGRTDL  143

Query  578  MNAG  589
             + G
Sbjct  144  RSTG  147



>gb|AFK35211.1| unknown [Medicago truncatula]
Length=264

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 99/183 (54%), Gaps = 14/183 (8%)
 Frame = +2

Query  83   SSPAPAAT------PQQRD-KPWHAYISEDL---PRTVQESTDSAI--RSARLFQ--NTS  220
            S+PAP         PQ  D KP+  Y    +    +T  ++ DSAI   ++R  Q  +TS
Sbjct  15   STPAPTVNQSTTTNPQTLDVKPFIDYAVGHVLYYQKTFNDAVDSAIDASTSRFSQIRSTS  74

Query  221  SGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRR  400
            S H     D+L    SQY AYE+ LF K+K+ V +A  HP +  G   + GL+ ++ PRR
Sbjct  75   SAHFHQSLDYLDDFKSQYNAYEELLFGKIKEGVLVAASHPVITSGATASMGLLVLKRPRR  134

Query  401  FLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELM  580
            FL+ N    F SEE+  +KA + VKELR S+DL+K E  ++ + A  A  +   G ++L 
Sbjct  135  FLYYNMQRLFVSEESLVSKASEEVKELRQSIDLLKSEVERMEKSALHAEEQFLHGKTKLR  194

Query  581  NAG  589
             AG
Sbjct  195  QAG  197



>ref|XP_007052191.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOX96348.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=278

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 92/162 (57%), Gaps = 13/162 (8%)
 Frame = +2

Query  125  PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAY  283
            PW  Y  E      + ++++ ++ I ++R     F +TS+ H     D L  + SQ   Y
Sbjct  56   PWIDYAVEQALLYQKIIEQNINATIEASRSRLSEFGSTSAAHFNQTIDSLEDVKSQLAVY  115

Query  284  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAE  463
            E+ +F KVK        HP + GGIAV  G++ ++ PRRFL+ NTL  F SEE+  +KA+
Sbjct  116  ENMMFGKVKAS------HPMITGGIAVGLGVLVLKRPRRFLYYNTLRLFVSEESWLSKAD  169

Query  464  KNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
              VKELR S+D +K ES KL   A++A  ++ RG  +L +AG
Sbjct  170  IRVKELRQSIDRLKTESVKLERSASVAEEDLIRGRKKLRHAG  211



>ref|NP_566034.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK73943.1| At2g45060/T14P1.13 [Arabidopsis thaliana]
 gb|AAM62665.1| unknown [Arabidopsis thaliana]
 gb|AAN28847.1| At2g45060/T14P1.13 [Arabidopsis thaliana]
 gb|AEC10501.1| uncharacterized protein AT2G45060 [Arabidopsis thaliana]
Length=272

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 86/148 (58%), Gaps = 4/148 (3%)
 Frame = +2

Query  158  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +T+ E+ DS I +  ARL Q  +TS  H     D L  ++S+Y  YE  +F K+KD V +
Sbjct  58   KTITETVDSTIDASKARLSQIRDTSVAHTSQTIDSLRDIASEYNVYEQMVFGKIKDGVNV  117

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  HP + G +A   G+  ++  RRF++ NT+  F SEEA  ++A+  VKELR S+D +K
Sbjct  118  AASHPLISGTLAFGVGIFALKKTRRFVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLK  177

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
             ES KL   A +A  E  RG  +L  AG
Sbjct  178  AESEKLERVATVAEEEFIRGRMKLRQAG  205



>ref|XP_003538068.1| PREDICTED: uncharacterized protein LOC100804339 [Glycine max]
Length=258

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 98/189 (52%), Gaps = 7/189 (4%)
 Frame = +2

Query  44   MASDVPSTEIDETSSPAPAATPQQRDKPWHAYI---SEDLPRTVQESTDSAIRSAR----  202
            M ++ P ++ D  SS            P+  Y    ++   +   ++ DS I +A+    
Sbjct  3    MVAESPESDSDNNSSKTNNPQTLNETAPFLDYALAQAQLYHKAFNDAVDSTIDTAKSRFS  62

Query  203  LFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIF  382
              ++TSS H     D L  L SQY AYE  LF K+K+ V +A  HP +  G   + GL+ 
Sbjct  63   QIRSTSSAHFHQTLDSLDDLKSQYTAYEGLLFGKIKEGVVVAASHPVITCGATASLGLLV  122

Query  383  MRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKR  562
            ++ PRR L+ NTL  F SEE+  ++A   VKELR S++L+K E  KL + A  A  +   
Sbjct  123  LKRPRRVLYYNTLRLFVSEESMISRAHAEVKELRQSIELLKAEGEKLEKSALHAEEQFLH  182

Query  563  GHSELMNAG  589
            G ++L +AG
Sbjct  183  GRTKLRHAG  191



>ref|XP_002881994.1| hypothetical protein ARALYDRAFT_903941 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58253.1| hypothetical protein ARALYDRAFT_903941 [Arabidopsis lyrata subsp. 
lyrata]
Length=272

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 87/148 (59%), Gaps = 4/148 (3%)
 Frame = +2

Query  158  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +T+ E+ DS I +  ARL Q  +TS  H     D L  ++S+Y  YE  +F K+KD V +
Sbjct  58   KTISETVDSTIDASKARLSQIRDTSVAHTSQTIDSLRDIASEYNVYEQMVFGKIKDGVNV  117

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  HP + G +A   G+  ++  R+F++ NT+  F SEEA  ++A+  VKELR S+D +K
Sbjct  118  AASHPLISGTLAFGVGIFALKKTRKFVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLK  177

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
             ES KL   A +A  E+ RG  +L  AG
Sbjct  178  AESEKLERVATVAEEELIRGRMKLRQAG  205



>ref|XP_006294796.1| hypothetical protein CARUB_v10023846mg [Capsella rubella]
 gb|EOA27694.1| hypothetical protein CARUB_v10023846mg [Capsella rubella]
Length=271

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 87/148 (59%), Gaps = 4/148 (3%)
 Frame = +2

Query  158  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +T+ E+ DS I +  ARL Q  +TS  H     D L +++S+Y  YE  +F K+KD V +
Sbjct  57   KTITETVDSTIDASKARLSQIRDTSVAHTSQTIDSLREIASEYNVYEQMVFGKIKDGVNV  116

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  HP + G +A   G+  ++  RRF++ NT+  F SEEA  ++A+  VKELR S+D + 
Sbjct  117  AASHPLISGTLAFGVGIFALKKTRRFVYYNTVRMFLSEEALLSRADLKVKELRQSMDRLT  176

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
             ES KL   A +A  E+ RG  +L  AG
Sbjct  177  AESEKLQRVATVAEEELIRGRMKLRQAG  204



>ref|XP_010508215.1| PREDICTED: uncharacterized protein LOC104784826 [Camelina sativa]
Length=271

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 88/148 (59%), Gaps = 4/148 (3%)
 Frame = +2

Query  158  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +T+ E+ DS I +  ARL Q  +TS+ H     D L +++S+Y  YE  +F K+KD V +
Sbjct  57   KTITETVDSTIDASKARLSQIRDTSAAHTSQTIDSLREIASEYNVYEQMVFGKIKDGVNV  116

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  HP + G +A   G+  ++  RRF++ NT+  F SEEA  ++A+  VKELR S+D + 
Sbjct  117  AASHPVISGTLAFGVGVFALKKTRRFVYFNTVRMFVSEEALLSRADLKVKELRQSMDRLT  176

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
             +S KL   A +A  E+ RG  +L  AG
Sbjct  177  AQSEKLERVATMAEEELIRGRMKLRQAG  204



>ref|XP_004229779.1| PREDICTED: uncharacterized protein LOC101267648 [Solanum lycopersicum]
Length=266

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 106/201 (53%), Gaps = 21/201 (10%)
 Frame = +2

Query  44   MASDVPSTEIDETSSPAPAATPQQ---RDK--------PW--HAYISEDLPRTVQEST-D  181
            MA+   S+E +  +SP+P+  P++    DK        PW  +A     L R   E T +
Sbjct  1    MAAIAESSEAN-VNSPSPSLPPERVNHEDKSNTWGEAVPWIDNALQQAQLARKTAEDTFE  59

Query  182  SAI-----RSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAV  346
            +AI     R  R+   TSS H     D L  L S+Y  YED  F K+K+ + +A  HP  
Sbjct  60   NAIVVTKSRLNRIL-TTSSAHFNQTLDTLQDLKSEYSVYEDLAFGKIKEGLLLAASHPLA  118

Query  347  VGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLF  526
              G  +  G++ ++ PRRFL+ + +  F  EEA  ++A+  VKEL+ S+DL+K ES KL 
Sbjct  119  TTGAVLGVGVLVLKRPRRFLYYSAMRLFVREEALLSRADAKVKELQKSIDLLKAESAKLE  178

Query  527  ERAALAHTEMKRGHSELMNAG  589
             +A  A  EM RG ++L  AG
Sbjct  179  NQAIQAEGEMIRGRTKLRQAG  199



>emb|CDX83410.1| BnaA03g20960D [Brassica napus]
Length=223

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 86/147 (59%), Gaps = 4/147 (3%)
 Frame = +2

Query  161  TVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  328
            T+ E+ DS I ++R      ++TS  H     D L +++S+Y  YE+ +F K+K+ V +A
Sbjct  10   TIVETLDSTINASRTRLSQLRDTSKAHTSQTIDSLREIASEYSVYENMVFAKIKEGVNVA  69

Query  329  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  508
              HP + G +A   G+  ++  RRF++ NTL  F SEEA  ++A+  VKELR S+D +  
Sbjct  70   ASHPLISGSLAFGVGIFALKKTRRFVYYNTLRMFSSEEALLSRADLRVKELRQSMDRLTA  129

Query  509  ESGKLFERAALAHTEMKRGHSELMNAG  589
            ES KL   + +A  E+ RG  +L  AG
Sbjct  130  ESEKLERISTVAEDELIRGRMKLRQAG  156



>gb|KJB09928.1| hypothetical protein B456_001G175600 [Gossypium raimondii]
Length=273

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 91/162 (56%), Gaps = 7/162 (4%)
 Frame = +2

Query  125  PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAY  283
            PW     E      + ++++ + AI+++R      ++TSS H     + L  + SQ   Y
Sbjct  45   PWMDSAVEQALLYQKIIEQNVNDAIKASRSRLSEIRSTSSAHFNLTIESLKDVKSQLDVY  104

Query  284  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAE  463
            ED  F KVK+ + IA  +P + GG AV  G + ++ PR  L+  TL  F+SEE+  +KA+
Sbjct  105  EDLAFGKVKEGINIAASNPLITGGAAVGLGFLVLKRPRHLLYYKTLRLFQSEESLISKAD  164

Query  464  KNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
              VKELR S+D +K ES KL   A++A  E+ RG ++L  AG
Sbjct  165  IRVKELRQSIDRLKAESEKLERSASVAEDELIRGRTKLRQAG  206



>ref|XP_006294795.1| hypothetical protein CARUB_v10023846mg [Capsella rubella]
 gb|EOA27693.1| hypothetical protein CARUB_v10023846mg [Capsella rubella]
Length=207

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 85/144 (59%), Gaps = 4/144 (3%)
 Frame = +2

Query  158  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +T+ E+ DS I +  ARL Q  +TS  H     D L +++S+Y  YE  +F K+KD V +
Sbjct  57   KTITETVDSTIDASKARLSQIRDTSVAHTSQTIDSLREIASEYNVYEQMVFGKIKDGVNV  116

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  HP + G +A   G+  ++  RRF++ NT+  F SEEA  ++A+  VKELR S+D + 
Sbjct  117  AASHPLISGTLAFGVGIFALKKTRRFVYYNTVRMFLSEEALLSRADLKVKELRQSMDRLT  176

Query  506  KESGKLFERAALAHTEMKRGHSEL  577
             ES KL   A +A  E+ RG  +L
Sbjct  177  AESEKLQRVATVAEEELIRGRMKL  200



>gb|AFK47092.1| unknown [Lotus japonicus]
Length=262

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 109/197 (55%), Gaps = 17/197 (9%)
 Frame = +2

Query  44   MASDVPSTEIDETSSPAPA--ATPQQR-----DKPWHAY-ISEDL--PRTVQESTDSAIR  193
            MA+ V S+E D T  PAP   +T   R       P+  Y + + L   +   ++ +SAI 
Sbjct  1    MATVVESSESD-TPPPAPGNHSTTSNRPTLDPTTPFIDYAVGQALLYQKAFNDAVESAID  59

Query  194  SAR----LFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  361
            +++      ++TSS H +     L    SQY AYED LF K+K+ V +A  HP +  G A
Sbjct  60   ASKSRFSQIRSTSSAHFQQTLYALDDFKSQYNAYEDLLFGKIKEGVLVASSHPVITCGAA  119

Query  362  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  541
             ATGL+  + PRR L+ NT+  F +EE   ++A   VKELR S+DL+K E G+ +E++AL
Sbjct  120  AATGLMVFKRPRRILYYNTMRLFLNEETLISRASAEVKELRKSIDLLKAE-GEKWEKSAL  178

Query  542  -AHTEMKRGHSELMNAG  589
             A  +   G ++L  AG
Sbjct  179  HAEEQFLHGRTKLRQAG  195



>gb|AFK39373.1| unknown [Lotus japonicus]
Length=262

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 109/197 (55%), Gaps = 17/197 (9%)
 Frame = +2

Query  44   MASDVPSTEIDETSSPAPA--ATPQQR-----DKPWHAY-ISEDL--PRTVQESTDSAIR  193
            MA+ V S+E D T  PAP   +T   R       P+  Y + + L   +   ++ +SAI 
Sbjct  1    MATVVESSESD-TPPPAPGNHSTTSNRPTLDPTTPFIDYAVGQALLYQKAFNDAVESAID  59

Query  194  SAR----LFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIA  361
            +++      ++TSS H +     L    SQY AYED LF K+K+ V +A  HP +  G A
Sbjct  60   ASKSRFSQIRSTSSAHFQQTLYALDDFKSQYNAYEDLLFGKIKEGVLVASSHPVITCGAA  119

Query  362  VATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL  541
             ATGL+  + PRR L+ NT+  F +EE   ++A   VKELR S+DL+K E G+ +E++AL
Sbjct  120  AATGLMVFKRPRRILYYNTMRLFLNEETLISRASAEVKELRKSIDLLKAE-GEKWEKSAL  178

Query  542  -AHTEMKRGHSELMNAG  589
             A  +   G ++L  AG
Sbjct  179  HAEEQFLHGRTKLGQAG  195



>ref|XP_006397686.1| hypothetical protein EUTSA_v10001582mg [Eutrema salsugineum]
 gb|ESQ39139.1| hypothetical protein EUTSA_v10001582mg [Eutrema salsugineum]
Length=275

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 99/186 (53%), Gaps = 9/186 (5%)
 Frame = +2

Query  44   MASDVPSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSAR----LFQ  211
            + S +PS++I  T+    A+      +    Y      +T+ E+ DS I ++R      +
Sbjct  28   LTSSIPSSKIAATTVENAASWIDDTMRQALVY-----QKTIVETLDSTIDASRSRLSQIR  82

Query  212  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRG  391
            +TS  H     D L  ++S+Y  YE  +F K+K+ V +A  HP + G +A   G+  ++ 
Sbjct  83   DTSLAHTSQTIDSLKDIASEYNVYEHMVFGKIKEGVNVAASHPLISGTLAFGVGIFALKK  142

Query  392  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHS  571
             RRF++ NT+  F SEEA  ++A+  VKELR S+D +  ES KL   A +A  E+ RG  
Sbjct  143  TRRFVYYNTIRMFLSEEALLSRADLRVKELRQSMDRLTAESEKLERVATVAEDELIRGRM  202

Query  572  ELMNAG  589
            +L  AG
Sbjct  203  KLRQAG  208



>ref|XP_010518116.1| PREDICTED: uncharacterized protein LOC104793462 [Camelina sativa]
Length=271

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 85/148 (57%), Gaps = 4/148 (3%)
 Frame = +2

Query  158  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +T+ E+ DS I +  ARL Q  +TS  H     D L +++ +Y  YE  +F K+KD V +
Sbjct  57   KTITETVDSTIDASKARLSQIRDTSVAHTSQTIDSLREIACEYNVYEQMVFGKIKDGVNV  116

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  HP + G +A   G+  +R  RR ++ NT+  F SEEA  ++A+  VKELR S+D + 
Sbjct  117  AASHPVISGTLAFGVGIFALRKTRRLVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLT  176

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
             +S KL   A +A  E+ RG  +L  AG
Sbjct  177  AQSEKLERVATMAEEELIRGRMKLRQAG  204



>ref|XP_010692135.1| PREDICTED: uncharacterized protein LOC104905332 [Beta vulgaris 
subsp. vulgaris]
Length=266

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 102/187 (55%), Gaps = 14/187 (7%)
 Frame = +2

Query  59   PSTEIDETSSPAPAATPQQRDKPW------HAYISEDLPRTVQESTDSAIRSARL----F  208
            P T+ D  S      + +Q + PW       A I++   +TV+++ DS I +A      F
Sbjct  17   PLTKSDNYSVEKALKSLEQTN-PWIQQAIQQAVIAQ---KTVEQTFDSTISAAHSRFSRF  72

Query  209  QNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMR  388
            ++T S H +   + +  + +++  YE   F KVK+   +A  HP +  G A   G + ++
Sbjct  73   RSTGSAHFQQTIESVKDVKAEFDVYEAKFFAKVKEGAFMAASHPFIATGAATGLGFLALK  132

Query  389  GPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGH  568
            GPRRFL+  TL  F +EEA   +A+  VKEL+ S    K E+ KL +RA++A  EMKRG 
Sbjct  133  GPRRFLYYRTLRLFSTEEALLARADAKVKELKQSFQSFKAETEKLEKRASMAEEEMKRGR  192

Query  569  SELMNAG  589
            ++L +AG
Sbjct  193  TKLRHAG  199



>gb|KJB09931.1| hypothetical protein B456_001G175600 [Gossypium raimondii]
Length=275

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 92/164 (56%), Gaps = 9/164 (5%)
 Frame = +2

Query  125  PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAY  283
            PW     E      + ++++ + AI+++R      ++TSS H     + L  + SQ   Y
Sbjct  45   PWMDSAVEQALLYQKIIEQNVNDAIKASRSRLSEIRSTSSAHFNLTIESLKDVKSQLDVY  104

Query  284  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMR--GPRRFLFRNTLGRFRSEEAQFNK  457
            ED  F KVK+ + IA  +P + GG AV  G + ++  GPR  L+  TL  F+SEE+  +K
Sbjct  105  EDLAFGKVKEGINIAASNPLITGGAAVGLGFLLLQCPGPRHLLYYKTLRLFQSEESLISK  164

Query  458  AEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            A+  VKELR S+D +K ES KL   A++A  E+ RG ++L  AG
Sbjct  165  ADIRVKELRQSIDRLKAESEKLERSASVAEDELIRGRTKLRQAG  208



>ref|XP_009385849.1| PREDICTED: uncharacterized protein LOC103973101 [Musa acuminata 
subsp. malaccensis]
Length=281

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 87/154 (56%), Gaps = 6/154 (4%)
 Frame = +2

Query  143  SEDLPRTVQESTDSAIRS-----ARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKV  307
            +EDL R+V  + DSA +S     +R+  + SS  L   +  +      Y A E+    K+
Sbjct  62   AEDLKRSVTAAADSAFQSVGSVLSRIVSD-SSESLEEAKVKIAWAKDHYAAAEEVALAKI  120

Query  308  KDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRL  487
            KD +  A  HPA+  GIA   GL+ ++GPRRFL RNT   F SEE+  + A+  VKEL+ 
Sbjct  121  KDGIVDAALHPALSCGIAAGLGLVLLKGPRRFLIRNTRRIFVSEESMLSSAQVKVKELQQ  180

Query  488  SVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            SV+L+  ES KL +RA  A  +MKRG   L+  G
Sbjct  181  SVNLVTNESKKLEDRATRAVEDMKRGQKRLIEEG  214



>ref|XP_009776946.1| PREDICTED: uncharacterized protein LOC104226615 [Nicotiana sylvestris]
Length=274

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 86/149 (58%), Gaps = 6/149 (4%)
 Frame = +2

Query  158  RTVQESTDSAI-----RSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVE  322
            +TV+ + ++AI     R  RL   TSS H     D L  L S+Y  YED +F K+++ + 
Sbjct  60   KTVENTLENAIVVTKSRLDRLL-TTSSVHFNQTLDSLQDLKSEYSVYEDLVFGKIREGLL  118

Query  323  IAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLM  502
            +A  HP    G  +  G++ ++ PRRFL+ + +  F SEEA  ++A+  VKEL+ S+D +
Sbjct  119  LAASHPLTTTGAVLGVGVLGLKRPRRFLYYSAMRLFVSEEALLSRADAKVKELQKSIDFL  178

Query  503  KKESGKLFERAALAHTEMKRGHSELMNAG  589
            K ES KL  RA  A  EM RG ++L  AG
Sbjct  179  KAESAKLENRAVQAEGEMIRGRTKLRQAG  207



>ref|XP_010506443.1| PREDICTED: uncharacterized protein LOC104783057 isoform X1 [Camelina 
sativa]
Length=271

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 86/148 (58%), Gaps = 4/148 (3%)
 Frame = +2

Query  158  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +T+ E+ DS I +  ARL Q  +TS  H     D L +++S+Y  YE  +F K+KD V +
Sbjct  57   KTITETLDSTIDASKARLSQIRDTSVAHTSQTLDSLREIASEYNVYEQMVFGKIKDGVNV  116

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  HP + G +A   G+  ++  RR ++ NT+  F SEEA  ++A+  VKELR S+D + 
Sbjct  117  AASHPVISGTLAFGVGIFALKKTRRLVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLT  176

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
             +S KL   A +A  E+ RG  +L  AG
Sbjct  177  AQSEKLERVATMAEEELIRGRMKLRQAG  204



>ref|XP_006375267.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
 gb|ERP53064.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
Length=259

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 92/169 (54%), Gaps = 16/169 (9%)
 Frame = +2

Query  107  PQQRDKPW------HAYISEDLPRTVQESTDSAIRSA--RLFQNTSSGHLRSLQDFLPQL  262
            P +   PW       A I +   + +Q S D+AI ++  R  + TS+      Q    Q 
Sbjct  38   PVEETAPWIDNAMQQALIYQ---KNIQYSLDTAIEASKSRFSEITSTS-----QAHFSQT  89

Query  263  SSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEE  442
             S+   YE  LF KVK+E+ +A  HP +   +AV  GL+ ++ PR+ L+  TL  F SEE
Sbjct  90   ISEIGVYEGKLFGKVKEEINVAASHPLITSAVAVGLGLVALKRPRQILYYKTLRLFTSEE  149

Query  443  AQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            A  ++A+  VKEL+ S+ L+K ES  L  RA+LA  E+ RG ++L  AG
Sbjct  150  ALLSQADAKVKELQQSISLLKAESENLKRRASLAEEELIRGRTKLRQAG  198



>ref|XP_009142315.1| PREDICTED: uncharacterized protein LOC103866188 [Brassica rapa]
Length=279

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 99/186 (53%), Gaps = 9/186 (5%)
 Frame = +2

Query  44   MASDVPSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSA--RLFQ--  211
            + S +PS +I  T+    A+   +  +    Y       T+ E+ DS I ++  RL Q  
Sbjct  32   LLSSIPSAKIATTTVENAASWIDETMRQALVY-----QNTIVETLDSKIDASKSRLAQIR  86

Query  212  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRG  391
            +TS  H     D + ++ S+Y  YE  +F K+KD V +A  HP V GG+A   G+  ++ 
Sbjct  87   DTSIAHTSQTIDSIREIVSEYNVYEHMVFAKIKDGVNVAASHPLVSGGLAFGVGIFALKK  146

Query  392  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHS  571
             RRF++ N +  F +EEA  ++A+  VKELR S+D +  ES KL   A +A  E+ RG  
Sbjct  147  TRRFVYYNAVRMFSTEEALLSRADLRVKELRQSLDRLTAESEKLERVATVAEDELIRGRM  206

Query  572  ELMNAG  589
            +L  AG
Sbjct  207  KLRQAG  212



>gb|KEH22363.1| hypothetical protein MTR_7g445370 [Medicago truncatula]
Length=276

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 101/195 (52%), Gaps = 26/195 (13%)
 Frame = +2

Query  83   SSPAPAAT------PQQRD-KPWHAYISEDL---PRTVQESTDSAI--RSARLFQ--NTS  220
            S+PAP         PQ  D KP+  Y    +    +T  ++ DSAI   ++R  Q  +TS
Sbjct  15   STPAPTVNQSTTTNPQTLDVKPFIDYAVGHVLYYQKTFNDAVDSAIDASTSRFSQIRSTS  74

Query  221  SGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRR  400
            S H     D+L    SQY AYE+ LF K+K+ V +A  HP +  G   + GL+ ++ PRR
Sbjct  75   SAHFHQSLDYLDDFKSQYNAYEELLFGKIKEGVLVAASHPVITSGATASMGLLVLKRPRR  134

Query  401  FLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKL----------FERAALAHT  550
            FL+ N    F SEE+  +KA + VKELR S+DL+K E  ++          + R +  H 
Sbjct  135  FLYYNMQRLFVSEESLVSKASEEVKELRQSIDLLKSEVERMEGARFAIAFRYPRKSALHA  194

Query  551  EMK--RGHSELMNAG  589
            E +   G ++L  AG
Sbjct  195  EEQFLHGRTKLRQAG  209



>emb|CDY37025.1| BnaA04g26030D [Brassica napus]
Length=279

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 99/186 (53%), Gaps = 9/186 (5%)
 Frame = +2

Query  44   MASDVPSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSA--RLFQ--  211
            + S +PS +I  T+    A+   +  +    Y       T+ E+ DS I ++  RL Q  
Sbjct  32   LLSSIPSAKIATTTVENAASWIDETMRQALVY-----QNTIVETLDSKIDASKSRLAQIR  86

Query  212  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRG  391
            +TS  H     D + ++ S+Y  YE  +F K+KD V +A  HP V GG+A   G+  ++ 
Sbjct  87   DTSIAHTSQTIDSIREIVSEYNVYEHLVFAKIKDGVNVAASHPLVSGGLAFGVGIFALKK  146

Query  392  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHS  571
             RRF++ N +  F +EEA  ++A+  VKELR S+D +  ES KL   A +A  E+ RG  
Sbjct  147  TRRFVYYNAVRMFSTEEALLSRADLRVKELRQSLDRLTAESEKLERVATVAEDELIRGRM  206

Query  572  ELMNAG  589
            +L  AG
Sbjct  207  KLRQAG  212



>ref|XP_011033296.1| PREDICTED: uncharacterized protein LOC105131821, partial [Populus 
euphratica]
Length=217

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 85/148 (57%), Gaps = 7/148 (5%)
 Frame = +2

Query  152  LPRTVQESTDSAIRSA--RLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            LP+ +Q+S D+AI ++  R  + TS+      Q    Q  S+   YE  LF KVK+E+ +
Sbjct  8    LPKNIQDSLDTAIEASKSRFSEITSTS-----QAHFSQTISEIGVYEGKLFGKVKEEINV  62

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  HP +   +AV  GL+  + PR+ L+  TL    SEEA  ++A+  VKEL+ S+ L+K
Sbjct  63   AASHPLITSAVAVGLGLVAHKRPRQILYYKTLRLLTSEEALLSQADAKVKELQQSISLLK  122

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
             ES     RA+LA  E+ RG ++L  AG
Sbjct  123  AESENSKRRASLAEEELIRGRTKLRQAG  150



>ref|XP_009133693.1| PREDICTED: uncharacterized protein LOC103858149 [Brassica rapa]
Length=275

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 106/209 (51%), Gaps = 31/209 (15%)
 Frame = +2

Query  47   ASDVPSTEIDETSSPA-PAATPQQRDKPWHAYI-SEDLPRTVQES----TDSAIRSARLF  208
            AS   S+E+++  SP  P ++P Q   P  + I S ++  T  E+     D A+R A ++
Sbjct  3    ASAESSSEMEDAHSPTIPQSSPSQ---PLLSTIPSANIAATTVENAASWIDDAMRQALVY  59

Query  209  QNT----------------------SSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVE  322
            QNT                      S  H     D L +++S+Y  YE  +F K+K+ V 
Sbjct  60   QNTIVETLNSTIDASRTRLSQIRDTSIAHTSQTIDSLREIASEYSVYEHMVFTKIKEGVN  119

Query  323  IAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLM  502
            +A  HP + G +A   G+  ++  RRF++ NTL  F SEEA  ++A+  VKELR S+D +
Sbjct  120  VAASHPLISGSLAFGVGIFALKKTRRFVYYNTLRMFSSEEALLSRADLRVKELRQSMDRL  179

Query  503  KKESGKLFERAALAHTEMKRGHSELMNAG  589
              ES KL   + +A  E+ RG  +L  AG
Sbjct  180  TAESEKLERISTVAEDELIRGRMKLRQAG  208



>gb|KHG03984.1| Alanine--tRNA ligase [Gossypium arboreum]
Length=266

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 93/162 (57%), Gaps = 7/162 (4%)
 Frame = +2

Query  125  PW-HAYISEDL--PRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAY  283
            PW  + + + L   + ++++ + AI+++R      ++TSS H     + L  + SQ   Y
Sbjct  38   PWIDSAVEQALLYQKIIEQNVNDAIKASRSRLSEIRSTSSAHFNLTIESLKDVKSQLDVY  97

Query  284  EDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAE  463
            ED  F KVK+ + IA  +P +  G AV  G + ++ PR  L+  TL  F+SEE+  +KA+
Sbjct  98   EDLAFGKVKEGINIAASNPLITVGAAVGLGFLVLKRPRHLLYYKTLRLFQSEESLISKAD  157

Query  464  KNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
              VKELR S+D +K ES KL   A++A  E+ RG ++L  AG
Sbjct  158  IRVKELRQSIDRLKAESEKLERSASVAEDELIRGRTKLRQAG  199



>ref|XP_008459726.1| PREDICTED: uncharacterized protein LOC103498769 [Cucumis melo]
Length=265

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 98/178 (55%), Gaps = 8/178 (4%)
 Frame = +2

Query  77   ETSSPAPAATPQQRDKPWHAYISED---LPRTVQESTDSAIRSA--RLFQ--NTSSGHLR  235
            E+SS  P +  +   KPW  Y ++      R +  S +SAI ++  RL Q  +TS  H +
Sbjct  22   ESSSSKPQSL-EDLAKPWAEYAAQQALLYQRAIDHSLESAIEASKSRLSQIRSTSYPHFQ  80

Query  236  SLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRN  415
               D   +  S+  AYE+ +F K++D + +A  HP +  G+A   G +  + PR FL+  
Sbjct  81   KAIDSFWEAKSELAAYENLVFGKIRDGILVAASHPLISCGVATGMGFLVFKKPRSFLYYK  140

Query  416  TLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            T+  F +EE+  +KA+  VKELR S+D +K ES +L +R   A  E+ RG ++L  AG
Sbjct  141  TVRLFMNEESLLSKADAKVKELRQSIDRIKVESERLEKRTLQAEEELIRGRTKLRQAG  198



>gb|KFK37300.1| hypothetical protein AALP_AA4G239300 [Arabis alpina]
Length=272

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 86/148 (58%), Gaps = 4/148 (3%)
 Frame = +2

Query  158  RTVQESTDSAIRSA--RLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +T+ ++ DS I ++  RL Q  +TS  H     D L +++S+Y  YE  +F K+KD V +
Sbjct  58   KTISDTLDSTIDASKSRLTQIRDTSIAHTSQTIDSLREIASEYSVYEHMVFGKIKDGVNV  117

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  +P + G +A   G+  ++  RRF++ NTL    SEEA F++A+  VKELR S+D + 
Sbjct  118  AASYPVLSGALAFGVGIFALKKTRRFVYHNTLRMVMSEEALFSRADLKVKELRQSMDRLI  177

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
             ES KL   A +A  E  RG  +L  AG
Sbjct  178  AESDKLERVATVAEEEFIRGRLKLRQAG  205



>ref|XP_006347915.1| PREDICTED: uncharacterized protein LOC102584275 [Solanum tuberosum]
Length=266

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 88/163 (54%), Gaps = 9/163 (6%)
 Frame = +2

Query  125  PW--HAYISEDLPRTVQEST-DSAI-----RSARLFQNTSSGHLRSLQDFLPQLSSQYKA  280
            PW  +A     L R   E T ++AI     R  R+   TSS H     D L  L S+Y  
Sbjct  38   PWIDNAVQQAQLARKTAEDTFENAIVVTKSRLNRIL-TTSSAHFNQTLDTLQDLKSEYSV  96

Query  281  YEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKA  460
            YED  F K+K+ + +A  HP    G  +  G++ ++ PRRFL+ + +  F  EEA  ++A
Sbjct  97   YEDLAFGKIKEGLLLAASHPLATTGAVLGVGVLGLKRPRRFLYYSAMRLFVREEALLSRA  156

Query  461  EKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            +  VKEL+ S+DL+K ES KL  +A  A  EM RG ++L  AG
Sbjct  157  DAKVKELQKSIDLLKAESAKLENQAIQAEGEMIRGRTKLRQAG  199



>ref|XP_010445295.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Camelina sativa]
Length=318

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 75/147 (51%), Gaps = 50/147 (34%)
 Frame = +2

Query  149  DLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIA  328
            DL + V+ESTDSA+RSAR F+  S+ H RS+Q                            
Sbjct  50   DLNQAVKESTDSAMRSARSFRENSTSHFRSIQ----------------------------  81

Query  329  REHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKK  508
                                   R   R TLGRF+SEEAQF +AEK+V+EL +S DLMKK
Sbjct  82   ----------------------TRIDIRQTLGRFQSEEAQFLRAEKHVQELNMSADLMKK  119

Query  509  ESGKLFERAALAHTEMKRGHSELMNAG  589
            ES KL ERA LA  +MK G SELMN+G
Sbjct  120  ESKKLLERATLAEKDMKCGLSELMNSG  146



>emb|CDX95625.1| BnaC03g25060D [Brassica napus]
Length=371

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 100/186 (54%), Gaps = 9/186 (5%)
 Frame = +2

Query  44   MASDVPSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSARL----FQ  211
            + S +PS  I  T+    A+     D    A + ++   T+ E+ DS I ++R      +
Sbjct  123  LLSTIPSANIAATTVENAASWID--DAMRQALVYQN---TIVETLDSTIDASRTRLSQIR  177

Query  212  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRG  391
            +TS  H     D L +++S++  YE  +F K+K+ V +A  HP + G +A   G+  ++ 
Sbjct  178  DTSIAHTSQTIDSLREIASEFSVYEHMVFAKIKEGVNVAASHPLMSGSLAFGVGIFALKK  237

Query  392  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHS  571
             RRF++ NTL  F SEEA  ++A+  VKELR S+D +  ES KL   + +A  E+ RG  
Sbjct  238  TRRFVYYNTLRMFSSEEALLSRADLRVKELRQSMDRLTAESEKLERISTVAEDELIRGRM  297

Query  572  ELMNAG  589
            +L  AG
Sbjct  298  KLRQAG  303



>ref|XP_004514234.1| PREDICTED: uncharacterized protein LOC101491840 [Cicer arietinum]
Length=262

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 72/128 (56%), Gaps = 0/128 (0%)
 Frame = +2

Query  206  FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFM  385
             ++TSS H      +L    SQY AYED LF K+K+ V +A  HP +  G   + GL+  
Sbjct  68   IRSTSSAHFHQTLHYLDDFKSQYDAYEDLLFGKIKEGVLVAASHPVITCGATASVGLLVF  127

Query  386  RGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRG  565
            + PRR L+ NT   F SEE+  ++A   VKELR S+D++K E  K+ + A  A  +   G
Sbjct  128  KRPRRMLYYNTKRLFVSEESLVSRASAEVKELRQSIDILKSEVEKMEKSALHAEEQFLHG  187

Query  566  HSELMNAG  589
             ++L  AG
Sbjct  188  RTKLRQAG  195



>ref|XP_008796934.1| PREDICTED: uncharacterized protein LOC103712238 isoform X2 [Phoenix 
dactylifera]
Length=244

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 86/151 (57%), Gaps = 4/151 (3%)
 Frame = +2

Query  149  DLPRTVQESTDSAIRSA--RLFQNTSSGH--LRSLQDFLPQLSSQYKAYEDALFQKVKDE  316
            D+ +T+ ++TD+ +R+A  RL    S+    L+  +  +  +  QY   E+ +F K+K+ 
Sbjct  51   DVKKTLGDATDATLRAAESRLVHAVSASKSSLQEARGMMEWVQGQYAVGEELVFGKIKEG  110

Query  317  VEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVD  496
            V +A  HP +  GIA   GL+  + PRRFL  N    F S E+  + A+ NV ELR SV+
Sbjct  111  VIVASSHPNLSLGIAGTAGLVLFKRPRRFLIWNVRRIFVSNESLLSDAQANVNELRQSVN  170

Query  497  LMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            L+K ES KL ERA  A  EM+ G  +L+  G
Sbjct  171  LVKNESKKLEERALKAEQEMREGRMKLIEEG  201



>ref|XP_011093293.1| PREDICTED: uncharacterized protein LOC105173298 [Sesamum indicum]
Length=261

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 81/148 (55%), Gaps = 4/148 (3%)
 Frame = +2

Query  158  RTVQESTDSAIRSAR----LFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +TV+ + +SAI + R       NTSS H     D    L S Y  YED  F K+K+   +
Sbjct  47   KTVESTVESAIEATRSRIDRILNTSSAHFNQTIDSFQDLKSDYSQYEDIAFGKIKEGCLL  106

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  HP +  G  +  G + ++  R+F + NT+    SEE   ++A+  VK+LR S+DL+K
Sbjct  107  AASHPLITTGAVLGVGFLGLKRTRQFFYYNTMRLLFSEETLLSRADAKVKQLRQSIDLLK  166

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
             ES KL ++A  A  ++ RG ++L  AG
Sbjct  167  AESEKLEKKAMQAEEDVVRGRTKLRQAG  194



>ref|XP_008796933.1| PREDICTED: uncharacterized protein LOC103712238 isoform X1 [Phoenix 
dactylifera]
Length=245

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 86/152 (57%), Gaps = 5/152 (3%)
 Frame = +2

Query  149  DLPRTVQESTDSAIRSA--RLFQNTSSGH--LRSLQDFLPQLSSQYKAYEDALFQKVKDE  316
            D+ +T+ ++TD+ +R+A  RL    S+    L+  +  +  +  QY   E+ +F K+K+ 
Sbjct  51   DVKKTLGDATDATLRAAESRLVHAVSASKSSLQEARGMMEWVQGQYAVGEELVFGKIKEG  110

Query  317  VEIAREHPAVVGGIAVATGLIFMRG-PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  493
            V +A  HP +  GIA   GL+  +  PRRFL  N    F S E+  + A+ NV ELR SV
Sbjct  111  VIVASSHPNLSLGIAGTAGLVLFKSRPRRFLIWNVRRIFVSNESLLSDAQANVNELRQSV  170

Query  494  DLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            +L+K ES KL ERA  A  EM+ G  +L+  G
Sbjct  171  NLVKNESKKLEERALKAEQEMREGRMKLIEEG  202



>ref|XP_007140975.1| hypothetical protein PHAVU_008G156600g [Phaseolus vulgaris]
 gb|ESW12969.1| hypothetical protein PHAVU_008G156600g [Phaseolus vulgaris]
Length=180

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 68/122 (56%), Gaps = 4/122 (3%)
 Frame = +2

Query  170  ESTDSAIRSAR----LFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREH  337
            +  DS I +A+      ++TS  H     D L  L SQY AYED LF K+K+ V +A   
Sbjct  51   DGVDSTIDAAKSRFAQIRSTSYAHFNQTLDSLDDLKSQYNAYEDLLFGKIKEGVLVAASR  110

Query  338  PAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESG  517
            P +  G A A GL  ++ PRR L+ NTL  F  EE+  ++A   VKELR S+ L+K E  
Sbjct  111  PLITCGAAAALGLTVLKRPRRDLYYNTLRLFLKEESMISRAHAEVKELRQSIQLLKAEGE  170

Query  518  KL  523
            KL
Sbjct  171  KL  172



>ref|XP_010506444.1| PREDICTED: uncharacterized protein LOC104783057 isoform X2 [Camelina 
sativa]
Length=267

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 83/148 (56%), Gaps = 8/148 (5%)
 Frame = +2

Query  158  RTVQESTDSAIRS--ARLFQ--NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +T+ E+ DS I +  ARL Q  +TS  H     D L +++S+Y  YE  +F K+KD V +
Sbjct  57   KTITETLDSTIDASKARLSQIRDTSVAHTSQTLDSLREIASEYNVYEQMVFGKIKDGVNV  116

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  HP + G +A   G+  ++  RR ++ NT+  F    A  ++A+  VKELR S+D + 
Sbjct  117  AASHPVISGTLAFGVGIFALKKTRRLVYYNTVRMF----ALLSRADLKVKELRQSMDRLT  172

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
             +S KL   A +A  E+ RG  +L  AG
Sbjct  173  AQSEKLERVATMAEEELIRGRMKLRQAG  200



>gb|EYU42370.1| hypothetical protein MIMGU_mgv1a023111mg [Erythranthe guttata]
Length=240

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 83/148 (56%), Gaps = 4/148 (3%)
 Frame = +2

Query  158  RTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +T++ + ++AI + R        TSS HL    D L +L S+   YED +F K+K+   +
Sbjct  26   KTIEITVENAIEATRSRVDRLLTTSSAHLNQTIDSLQELKSECSTYEDIVFGKMKEGFLL  85

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A   P V  G+ +  G++ ++  R+FL  +T+  F SEE   ++    VKELR S+DL+K
Sbjct  86   ASSRPFVATGVVLGVGVLSLKRTRQFLSHSTMRLFLSEEIMLSRTNAKVKELRQSIDLLK  145

Query  506  KESGKLFERAALAHTEMKRGHSELMNAG  589
             ES KL +RA  A   + RG ++L  AG
Sbjct  146  VESEKLEKRALQAEENLVRGRTKLKQAG  173



>ref|XP_009337245.1| PREDICTED: uncharacterized protein LOC103929743 [Pyrus x bretschneideri]
 ref|XP_009337246.1| PREDICTED: uncharacterized protein LOC103929743 [Pyrus x bretschneideri]
 ref|XP_009337247.1| PREDICTED: uncharacterized protein LOC103929743 [Pyrus x bretschneideri]
Length=262

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 95/172 (55%), Gaps = 10/172 (6%)
 Frame = +2

Query  104  TPQQRDK---PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFL  253
            +PQ  D+   PW  Y  E      + V+E+ +SAI ++R      + TS+ H     + L
Sbjct  24   SPQTLDQLGTPWVDYAVEQARIYQKNVEETFESAIAASRSHLSEIRATSAAHFSQTINSL  83

Query  254  PQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFR  433
              + S   AYE+ LF K+K+ V +A  +P +  G+A   G + ++ PRR L+   L  F 
Sbjct  84   EDIKSNCGAYEELLFGKIKEGVHVAASNPMITAGVATGLGFLLLKRPRRLLYHKALRLFV  143

Query  434  SEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            SEE+  ++A+  VKELR S+DL+K ES KL +RA  A  E+ RG ++L   G
Sbjct  144  SEESLLSRADAKVKELRHSIDLLKAESEKLEKRALHAEEELTRGRTKLRQTG  195



>emb|CDY48625.1| BnaC09g20600D [Brassica napus]
Length=105

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +2

Query  146  EDLPRTVQESTDSAIRSARLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +DL RTV++STDS  RSAR  +  S+   RS+QDF+P   +QYK YE   F KV + +  
Sbjct  19   DDLQRTVKKSTDSIRRSARSLRENSTSQFRSIQDFIPHALNQYKTYETVFFSKVTEVLRN  78

Query  326  AREHPAVVGGIAVATGLIFMRGPR  397
            A+EHPA   GI +  GL+ +RG +
Sbjct  79   AKEHPAAAAGIGLTAGLVLLRGCK  102



>ref|XP_010934947.1| PREDICTED: uncharacterized protein LOC105054975 isoform X1 [Elaeis 
guineensis]
Length=261

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 87/161 (54%), Gaps = 7/161 (4%)
 Frame = +2

Query  128  WHAYISE---DLPRTVQESTDSAIRSAR--LFQNTSSGH--LRSLQDFLPQLSSQYKAYE  286
            W  Y  +   DL +T+ ++TD+A  +A   L    S+    L+  +  +  +  QY   E
Sbjct  34   WVEYAVQQALDLKKTLGDATDAAFGAAESSLVHAVSASKSSLQEARGMMEWVKGQYTVGE  93

Query  287  DALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEK  466
            + +F K+K+ V +A  HP++  GIA   GL+  + PRRF+  N    F S E+  + A+ 
Sbjct  94   ELVFGKIKEGVIVAASHPSLSLGIAGTAGLVLFKRPRRFVIWNVRRIFVSNESLLSDAQA  153

Query  467  NVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
             V ELR SV+L+K ES KL ERA  A  EM+ G  +L+  G
Sbjct  154  KVNELRQSVNLVKNESKKLEERALKAEEEMREGRMKLIEEG  194



>ref|XP_010934948.1| PREDICTED: uncharacterized protein LOC105054975 isoform X2 [Elaeis 
guineensis]
Length=246

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 87/161 (54%), Gaps = 7/161 (4%)
 Frame = +2

Query  128  WHAYISE---DLPRTVQESTDSAIRSAR--LFQNTSSGH--LRSLQDFLPQLSSQYKAYE  286
            W  Y  +   DL +T+ ++TD+A  +A   L    S+    L+  +  +  +  QY   E
Sbjct  34   WVEYAVQQALDLKKTLGDATDAAFGAAESSLVHAVSASKSSLQEARGMMEWVKGQYTVGE  93

Query  287  DALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEK  466
            + +F K+K+ V +A  HP++  GIA   GL+  + PRRF+  N    F S E+  + A+ 
Sbjct  94   ELVFGKIKEGVIVAASHPSLSLGIAGTAGLVLFKRPRRFVIWNVRRIFVSNESLLSDAQA  153

Query  467  NVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
             V ELR SV+L+K ES KL ERA  A  EM+ G  +L+  G
Sbjct  154  KVNELRQSVNLVKNESKKLEERALKAEEEMREGRMKLIEEG  194



>ref|XP_009631125.1| PREDICTED: uncharacterized protein LOC104120950 [Nicotiana tomentosiformis]
Length=191

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 77/132 (58%), Gaps = 4/132 (3%)
 Frame = +2

Query  158  RTVQESTDSAI--RSARL--FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            +TV+ + ++AI    +RL     TSS H     D L  L S+Y  YED +F K+++ + +
Sbjct  56   KTVESTLENAIVVTKSRLDRILTTSSAHFNQTLDSLQDLKSEYSVYEDLVFGKIREGLLL  115

Query  326  AREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMK  505
            A  HP    G  +  G++ ++ PRRFL+ + +  F SEEA  ++A+  VKEL+ S+D +K
Sbjct  116  AASHPLTTTGAVLGVGVLGLKRPRRFLYYSAMRLFVSEEALLSRADAKVKELQKSIDFLK  175

Query  506  KESGKLFERAAL  541
             ES KL  R+ L
Sbjct  176  AESAKLEVRSFL  187



>emb|CDY27396.1| BnaC04g50090D [Brassica napus]
Length=237

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 88/164 (54%), Gaps = 9/164 (5%)
 Frame = +2

Query  44   MASDVPSTEIDETSSPAPAATPQQRDKPWHAYISEDLPRTVQESTDSAIRSA--RLFQ--  211
            + S +PS +I  T+    A+   +  +    Y S     T+ E+ DS I ++  RL Q  
Sbjct  32   LLSSIPSAKIATTTVENAASWINETMRQALVYQS-----TIVETLDSKIDASKSRLAQIR  86

Query  212  NTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRG  391
            +TS  H     D + ++ S+Y  YE  +F K+KD V +A  HP V GG+A   G+  ++ 
Sbjct  87   DTSIAHTSQTIDSIREIVSEYNVYEHMVFAKIKDGVNVAASHPLVSGGLAFGVGIFALKK  146

Query  392  PRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKL  523
             RR ++ N +  F +EEA  ++A+  VKELR S+D +  ES KL
Sbjct  147  TRRLVYYNAVRMFSTEEALLSRADLRVKELRQSLDRLTAESEKL  190



>ref|XP_008375716.1| PREDICTED: uncharacterized protein LOC103438950 [Malus domestica]
Length=262

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 103/192 (54%), Gaps = 14/192 (7%)
 Frame = +2

Query  56   VPSTEIDE----TSSPAPAATPQQRDK---PWHAYISED---LPRTVQESTDSAIRSARL  205
            VP T  +E    + S + + +PQ  D+   PW  Y  E      + V+E+ +SA+ ++R 
Sbjct  4    VPETSSEENPTLSHSNSISHSPQPLDQLATPWVDYAVEQARIYQKNVEETFESAVAASRS  63

Query  206  ----FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATG  373
                 + TS+ H     + L  + S   AYE+ LF K+K+ V +A  +P +  G+A   G
Sbjct  64   RLSEIRATSAAHFSQTINSLEDIKSNCXAYEELLFGKIKEGVHVAASNPMITAGVATGLG  123

Query  374  LIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTE  553
             + ++ PRR L+   L  F SEE+  ++A+  VKELR S+DL+K ES KL +RA  A  E
Sbjct  124  FLLLKRPRRLLYHKALRLFVSEESLLSRADAKVKELRHSIDLLKAESEKLEKRALHAEEE  183

Query  554  MKRGHSELMNAG  589
              RG ++L   G
Sbjct  184  XTRGRTKLRQTG  195



>ref|XP_009339857.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
 ref|XP_009339858.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
 ref|XP_009339859.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
 ref|XP_009339860.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
Length=262

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 94/172 (55%), Gaps = 10/172 (6%)
 Frame = +2

Query  104  TPQQRDK---PWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFL  253
            +PQ  D+   PW  Y  E      + V+E+ +SAI ++R      + TS+ H     + L
Sbjct  24   SPQTLDQLATPWVDYAVEQARIYQKNVEETFESAIAASRSRLSEIRATSAAHFSQTINSL  83

Query  254  PQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFR  433
              + S   AYE+ LF K+K+ V +A  +P    G+A   G + ++ PRR L+   L  F 
Sbjct  84   EDIKSNCGAYEELLFGKIKEGVHVAASNPMKTAGVATGLGFLLLKRPRRLLYHKALRLFV  143

Query  434  SEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            SEE+  ++A+  VKELR S+DL+K ES KL +RA  A  E+ RG ++L   G
Sbjct  144  SEESLLSRADAKVKELRHSIDLLKAESEKLEKRALHAEEELTRGRTKLRQTG  195



>gb|KGN46560.1| hypothetical protein Csa_6G108580 [Cucumis sativus]
Length=209

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 70/117 (60%), Gaps = 0/117 (0%)
 Frame = +2

Query  239  LQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNT  418
            L+D   +  S+  AYE+ +F K++D + +A  HP +  G+A   G +  + PR FL+  T
Sbjct  26   LKDSFWEAKSELAAYENLVFGKIRDGILVAASHPLISCGVATGMGFLVFKKPRNFLYYKT  85

Query  419  LGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            +  F +EE+  +KA+  VKELR S+D +K ES +L +R   A  E+ RG ++L  AG
Sbjct  86   IRLFVNEESLLSKADAKVKELRQSIDRIKVESERLEKRTLQAEDELIRGRTKLRQAG  142



>ref|XP_004171485.1| PREDICTED: uncharacterized LOC101214960, partial [Cucumis sativus]
Length=186

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 68/115 (59%), Gaps = 0/115 (0%)
 Frame = +2

Query  245  DFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLG  424
            D   +  S+  AYE+ +F K++D + +A  HP +  G+A   G +  + PR FL+  T+ 
Sbjct  5    DSFWEAKSELAAYENLVFGKIRDGILVAASHPLISCGVATGMGFLVFKKPRNFLYYKTIR  64

Query  425  RFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
             F +EE+  +KA+  VKELR S+D +K ES +L +R   A  E+ RG ++L  AG
Sbjct  65   LFVNEESLLSKADAKVKELRQSIDRIKVESERLEKRTLQAEDELIRGRTKLRQAG  119



>ref|XP_006375268.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
 gb|ERP53065.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
Length=187

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = +2

Query  107  PQQRDKPW------HAYISEDLPRTVQESTDSAIRSA--RLFQNTSSGHLRSLQDFLPQL  262
            P +   PW       A I +   + +Q S D+AI ++  R  + TS+      Q    Q 
Sbjct  38   PVEETAPWIDNAMQQALIYQ---KNIQYSLDTAIEASKSRFSEITSTS-----QAHFSQT  89

Query  263  SSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEE  442
             S+   YE  LF KVK+E+ +A  HP +   +AV  GL+ ++ PR+ L+  TL  F SEE
Sbjct  90   ISEIGVYEGKLFGKVKEEINVAASHPLITSAVAVGLGLVALKRPRQILYYKTLRLFTSEE  149

Query  443  AQFNKAEKNVKELRLSVDLMKKESGKL  523
            A  ++A+  VKEL+ S+ L+K ES  L
Sbjct  150  ALLSQADAKVKELQQSISLLKAESENL  176



>ref|XP_006423787.1| hypothetical protein CICLE_v10029731mg [Citrus clementina]
 gb|ESR37027.1| hypothetical protein CICLE_v10029731mg [Citrus clementina]
Length=77

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  389  GPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGH  568
            GPRRFLFR+T  R RSEEA F +AEKNV +L LS +LMKKES  L ERAALA  +M RG 
Sbjct  14   GPRRFLFRHTFDRLRSEEAMFVRAEKNVNKLNLSGELMKKESKTLLERAALAEKDMIRGE  73

Query  569  SEL  577
            +EL
Sbjct  74   TEL  76



>ref|XP_004140609.1| PREDICTED: uncharacterized protein LOC101214960 [Cucumis sativus]
Length=284

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 96/197 (49%), Gaps = 27/197 (14%)
 Frame = +2

Query  77   ETSSPAPAATPQQRDKPWHAYISED---LPRTVQESTDSAIR--SARLFQ--NTSSGHLR  235
            ++SSP P +  +   KPW  Y ++      R +  S +SAI    +RL Q  +TS  H +
Sbjct  22   QSSSPKPQSL-EDLAKPWAEYAAQQALLYQRAIDHSLESAIEVSKSRLSQIRSTSFPHFQ  80

Query  236  SLQDFLPQLSSQYKAYEDALFQKVKDEVEI-------------------AREHPAVVGGI  358
               D   +  S+  AYE+ +F K++    I                   A  HP +  G+
Sbjct  81   KAVDSFWEAKSELAAYENLVFGKIRGLFLIYHCDGKLTLPSFVFSFSFVAASHPLISCGV  140

Query  359  AVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAA  538
            A   G +  + PR FL+  T+  F +EE+  +KA+  VKELR S+D +K ES +L +R  
Sbjct  141  ATGMGFLVFKKPRNFLYYKTIRLFVNEESLLSKADAKVKELRQSIDRIKVESERLEKRTL  200

Query  539  LAHTEMKRGHSELMNAG  589
             A  E+ RG ++L  AG
Sbjct  201  QAEDELIRGRTKLRQAG  217



>ref|XP_001771369.1| predicted protein [Physcomitrella patens]
 gb|EDQ63759.1| predicted protein [Physcomitrella patens]
Length=342

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 94/167 (56%), Gaps = 6/167 (4%)
 Frame = +2

Query  107  PQQRDKPWHAYI--SEDLPRTVQESTDSAIRSAR----LFQNTSSGHLRSLQDFLPQLSS  268
            P+  ++ W  Y   ++ L +    STD  I  AR       + SS +  + Q +  +   
Sbjct  52   PENAEETWKFYSMQAQTLGKRALSSTDETIEVARNQMKQLTDASSQYFAAAQGYAARAQQ  111

Query  269  QYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQ  448
            +Y  YE   F+K+K+ V  A ++P    G+   T ++ +R  RR L+R T+GRF++E+A 
Sbjct  112  EYNYYESLFFKKLKEGVHTAAQNPNATCGVLGVTTILALRTSRRMLYRYTIGRFQNEQAL  171

Query  449  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
              +AE  VKE+R +VDL++ E+ KL ERA LA  E+ RG S+L N+G
Sbjct  172  LARAETKVKEMRQTVDLLRNETKKLEERARLAEEELLRGRSKLKNSG  218



>ref|XP_007220768.1| hypothetical protein PRUPE_ppa024369mg [Prunus persica]
 gb|EMJ21967.1| hypothetical protein PRUPE_ppa024369mg [Prunus persica]
Length=175

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 7/122 (6%)
 Frame = +2

Query  110  QQRDKPWHAYISED---LPRTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSS  268
            +Q   PW  Y  E      +T++E+ +SAI ++R      ++TS+ H     + L  + S
Sbjct  52   EQSATPWIDYAVEQARVYQKTIEETFESAIEASRSRLSEIRSTSAAHFSQTINSLEDIKS  111

Query  269  QYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQ  448
             Y  YED  F K+K+ V IA  HP + GG+A   GL+ ++ PRR L+  TL  F SEE +
Sbjct  112  DYGTYEDMFFGKIKEGVLIAASHPMITGGVAAGLGLLVLKRPRRLLYHKTLRLFVSEEVR  171

Query  449  FN  454
             +
Sbjct  172  MD  173



>emb|CDP09483.1| unnamed protein product [Coffea canephora]
Length=272

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 87/170 (51%), Gaps = 9/170 (5%)
 Frame = +2

Query  104  TPQQRDKPWHAYI---SEDLPRTVQESTDSAIR--SARL--FQNTSSGHLRSLQDFLPQL  262
            T ++   PW  Y    ++   +T+      AI    +RL   + TSS H     D L   
Sbjct  37   TLEETASPWIDYALKQAQAAQKTIGHHLQDAIEVTKSRLDRIRTTSSAHFNQTLDSLQDA  96

Query  263  SSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEE  442
             S + AYED    K+++   +A  +P +  G   A GL+ ++ PRR L+      F SE+
Sbjct  97   KSDFNAYEDLAIGKIREGFNLAAANPFIAAGSIFAVGLLGLKTPRRILYYKLRRLFASEQ  156

Query  443  AQFNKAEKNVKELRLSVDLMKKESGKLFERAAL-AHTEMKRGHSELMNAG  589
               +KA+  VKELR S +++K E+ KL E+AAL A  EM RG ++L  AG
Sbjct  157  VLLSKADAKVKELRQSFEVLKAEAEKL-EKAALQAEEEMTRGRTKLRQAG  205



>ref|XP_002983323.1| hypothetical protein SELMODRAFT_445444 [Selaginella moellendorffii]
 gb|EFJ15665.1| hypothetical protein SELMODRAFT_445444 [Selaginella moellendorffii]
Length=403

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 85/151 (56%), Gaps = 4/151 (3%)
 Frame = +2

Query  152  LPRTVQESTDSAIRSA----RLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEV  319
            L   + E+TD A+R+A       Q++S+      +D   +   +Y+ YE+  F  +KD V
Sbjct  187  LKNGMSETTDVAVRAACNQLSELQDSSTTQYYYAKDMFWRFKREYREYENVFFSTLKDGV  246

Query  320  EIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDL  499
            + A   P +   +A     +F+R PRR LF+ TLGRFRS+EA    A+K V ELR +++L
Sbjct  247  KAATASPGMAAMVATGAAFLFLRRPRRLLFKYTLGRFRSQEAMAASAQKKVVELREALEL  306

Query  500  MKKESGKLFERAALAHTEMKRGHSELMNAGT  592
             K E  KL ER  LA  E  RG S++ NAG+
Sbjct  307  QKNEKRKLEERFRLAEDEFLRGQSKMANAGS  337



>ref|XP_002987624.1| hypothetical protein SELMODRAFT_447060 [Selaginella moellendorffii]
 gb|EFJ11199.1| hypothetical protein SELMODRAFT_447060 [Selaginella moellendorffii]
Length=403

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 85/151 (56%), Gaps = 4/151 (3%)
 Frame = +2

Query  152  LPRTVQESTDSAIRSA----RLFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEV  319
            L   + E+TD A+R+A       Q++S+      +D   +   +Y+ YE+  F  +KD V
Sbjct  187  LKNGMSETTDVAVRAACNQLSELQDSSTTQYYYAKDMFWRFKREYREYENVFFSTLKDGV  246

Query  320  EIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDL  499
            + A   P +   +A     +F+R PRR LF+ TLGRFRS+EA    A+K V ELR +++L
Sbjct  247  KAATVSPGMAAMVATGAAFLFLRRPRRLLFKYTLGRFRSQEAMAASAQKKVVELREALEL  306

Query  500  MKKESGKLFERAALAHTEMKRGHSELMNAGT  592
             K E  KL ER  LA  E  RG S++ NAG+
Sbjct  307  QKNERRKLEERFRLAEDEFLRGQSKMANAGS  337



>gb|EPS62058.1| hypothetical protein M569_12732, partial [Genlisea aurea]
Length=221

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 78/152 (51%), Gaps = 12/152 (8%)
 Frame = +2

Query  158  RTVQESTDSAIRSAR----LFQNTSSGHL----RSLQDFLPQLSSQYKAYEDALFQKVKD  313
            RT+  + ++ I + R     F  T+S H      S QDF      +Y  YE     K+K+
Sbjct  7    RTIANTVENTIEATRSRLDRFLTTASIHFDQTAESFQDF----KFEYHKYEAVALGKIKE  62

Query  314  EVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSV  493
               +A  HP +  G  +  G I ++G R++ + NTL  F +EE   ++A+  VK+L+ S 
Sbjct  63   SFVVASSHPYLTTGAVLGLGFISLKGTRQYFYYNTLRFFVTEEKLVSRADAKVKQLKQSF  122

Query  494  DLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            D +K E  KL +RA  A  ++ RG ++L  AG
Sbjct  123  DALKLEGEKLEKRALEAEEDLLRGRTKLKQAG  154



>ref|XP_011396980.1| hypothetical protein F751_1359 [Auxenochlorella protothecoides]
 gb|KFM24094.1| hypothetical protein F751_1359 [Auxenochlorella protothecoides]
Length=254

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 58/112 (52%), Gaps = 0/112 (0%)
 Frame = +2

Query  242  QDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTL  421
            +D   Q   QYK  E A F  +K+ V    ++      +A+    I +RGPRRFL+R+TL
Sbjct  70   KDLYSQAELQYKQGEAAAFGYLKEGVRTVVDNKETSIAMAIGVAAIGLRGPRRFLWRHTL  129

Query  422  GRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  577
            GR RSEEA F  AE     L   V+    E  KL ER  LA  E  RG S+L
Sbjct  130  GRLRSEEAVFKSAELRSVVLAEKVEGQALELKKLQERLGLAQAEYTRGLSKL  181



>ref|XP_006659070.1| PREDICTED: uncharacterized protein LOC102721384 [Oryza brachyantha]
Length=282

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = +2

Query  251  LPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRF  430
            L  + ++Y A+E  +F K+K+ V +A EHP +  G     G++  + PR +L +     F
Sbjct  103  LEWIKNEYMAHEQMVFGKIKESVIVAIEHPRIAAGSTTIAGIVLFKRPRSYLIQRVRRIF  162

Query  431  RSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
             S+E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + L   G
Sbjct  163  VSKETLLSGIQAEVNHMRQTVNLVSNESQKLMDRAATAEKRFQKGWNTLREEG  215



>ref|NP_001144763.1| uncharacterized protein LOC100277822 [Zea mays]
 gb|ACG42816.1| hypothetical protein [Zea mays]
Length=278

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = +2

Query  251  LPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRF  430
            L    ++Y A+E  +F K+K+ V +A  HP +  G A   G+I  + PR +L +     F
Sbjct  99   LEWFKTEYSAHEQIVFGKIKEGVVMAIMHPGIAAGSATLAGIILFKRPRSYLIQRVRHMF  158

Query  431  RSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
             S+E   +  +  V  +R +V+L+  E  KL +RAA A    ++G + L   G
Sbjct  159  VSKETLLSGVQAEVNHMRQTVNLVSNERQKLLDRAATAEKRFQKGWNTLSEEG  211



>gb|AFW66822.1| hypothetical protein ZEAMMB73_141697 [Zea mays]
Length=278

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = +2

Query  251  LPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRF  430
            L    ++Y A+E  +F K+K+ V +A  HP +  G A   G+I  + PR +L +     F
Sbjct  99   LEWFKTEYSAHEQIVFGKIKEGVVMAIMHPGIAAGSATLAGIILFKRPRSYLIQRVRHMF  158

Query  431  RSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
             S+E   +  +  V  +R +V+L+  E  KL +RAA A    ++G + L   G
Sbjct  159  VSKETLLSGVQAEVNHMRQTVNLVSNERQKLLDRAATAEKRFQKGWNTLREEG  211



>gb|EEC75159.1| hypothetical protein OsI_11373 [Oryza sativa Indica Group]
Length=195

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +2

Query  386  RGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRG  565
            R PRRFL+RNTLGRF++E+   N AE+++ E + S++ +KK+S    ++ A+  ++++RG
Sbjct  61   RSPRRFLYRNTLGRFKTEKDLLNDAEQSMMEYKTSIEQLKKDSKYTLDKIAVGESDLQRG  120

Query  566  HSELMNAG  589
             ++L + G
Sbjct  121  QTDLRSTG  128



>dbj|BAJ98005.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=277

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = +2

Query  251  LPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRF  430
            L  +  +Y A E     K+K+ V +A EHP +  G A   G++ ++ PR +L +     F
Sbjct  98   LEWVKKEYFAREQMALGKIKEGVIMAIEHPGIAAGSATVAGIVLLKRPRSYLIQRVRRVF  157

Query  431  RSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
             S+E   +  +  V  +R +V+LM  ES KL +RAA A    ++G + L   G
Sbjct  158  VSKETLLSGIQAEVNHMRQTVNLMSNESQKLMDRAATAEKRFQKGWNTLREEG  210



>emb|CAN64905.1| hypothetical protein VITISV_042831 [Vitis vinifera]
Length=587

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 61/129 (47%), Gaps = 30/129 (23%)
 Frame = +2

Query  206  FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFM  385
            F+    G   SL+D    + S+Y  YED    K+K                         
Sbjct  414  FEPVDGGIEESLKD----VKSEYDVYEDLAVGKIK-------------------------  444

Query  386  RGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRG  565
             GPR FL+ NTL    SEE+   +A+  V ELR S+DL+K ES KL +RA  A  EMKRG
Sbjct  445  -GPRHFLYYNTLRLLVSEESMVARADAKVNELRKSIDLLKAESEKLEKRALQAEDEMKRG  503

Query  566  HSELMNAGT  592
             ++L  AG 
Sbjct  504  RTKLRQAGN  512



>ref|XP_005846915.1| hypothetical protein CHLNCDRAFT_134807 [Chlorella variabilis]
 gb|EFN54813.1| hypothetical protein CHLNCDRAFT_134807 [Chlorella variabilis]
Length=289

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 59/121 (49%), Gaps = 8/121 (7%)
 Frame = +2

Query  239  LQDFLPQLSSQYKAYEDALFQKVKDEVEIAR-EHPAVVGGIAVATGLIFMRGPRRFLFRN  415
            LQ F     + Y+A E    + +K  V   R EHP       VA   + + GPRRFL R+
Sbjct  99   LQRFYDTGLAHYQATEQQALELMKQGVRFVRKEHPEASMATGVAAFFVLLPGPRRFLLRH  158

Query  416  TLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKL-------FERAALAHTEMKRGHSE  574
            T+GRFRSEEA F  AE+    L+   +    E  KL        ER  LA  E +RG ++
Sbjct  159  TIGRFRSEEAMFKSAEQRYAGLKEKAEGHNGELQKLQASTAVTQERLQLAELEYQRGRAK  218

Query  575  L  577
            L
Sbjct  219  L  219



>gb|EMT05527.1| hypothetical protein F775_07413 [Aegilops tauschii]
Length=193

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +2

Query  269  QYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQ  448
            +Y A E     K+K+ V +A EHP +  G A   G++ ++ PR +L +     F S+E  
Sbjct  25   EYFAREQMALGKIKEGVIMAIEHPGIAAGSATVAGIVLLKRPRSYLIQRVRRVFVSKETL  84

Query  449  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  577
             +  +  V  +R +V+LM  ES KL +RAA A    ++G + L
Sbjct  85   LSGIQAEVNHMRQTVNLMSNESQKLMDRAATAEKRFQKGWNTL  127



>gb|EEE56139.1| hypothetical protein OsJ_05019 [Oryza sativa Japonica Group]
Length=257

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 0/109 (0%)
 Frame = +2

Query  260  LSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSE  439
            L  +Y  +E  +F K+K+   +A EHP +  G     G++  + PR +L +     F S+
Sbjct  52   LKKEYTVHEQVVFGKIKEGAIMAIEHPGIAAGSTAIAGIVLFKRPRSYLIQRVRRIFVSK  111

Query  440  EAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNA  586
            E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + L  A
Sbjct  112  ETLLSGIQAGVNHMRQTVNLVSNESQKLLDRAATAEKRFQKGWNTLRQA  160



>ref|NP_001045615.1| Os02g0104800 [Oryza sativa Japonica Group]
 dbj|BAD06279.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD07539.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF07529.1| Os02g0104800 [Oryza sativa Japonica Group]
 dbj|BAG92178.1| unnamed protein product [Oryza sativa Japonica Group]
Length=279

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 56/110 (51%), Gaps = 0/110 (0%)
 Frame = +2

Query  260  LSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSE  439
            L  +Y  +E  +F K+K+   +A EHP +  G     G++  + PR +L +     F S+
Sbjct  103  LKKEYTVHEQVVFGKIKEGAIMAIEHPGIAAGSTAIAGIVLFKRPRSYLIQRVRRIFVSK  162

Query  440  EAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + L   G
Sbjct  163  ETLLSGIQAGVNHMRQTVNLVSNESQKLLDRAATAEKRFQKGWNTLREEG  212



>ref|XP_004951200.1| PREDICTED: uncharacterized protein LOC101766807 [Setaria italica]
Length=280

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = +2

Query  251  LPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRF  430
            L  +  +Y  +E  +F K+K+ V +A  HP +  G A   G++  + PR +L +     F
Sbjct  101  LEWVKKEYSTHEQMVFGKIKEGVIMAIMHPGIAAGSATLAGIVLFKRPRSYLIQRVRRMF  160

Query  431  RSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
             S+E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + L   G
Sbjct  161  VSKETLLSGIQAEVNHMRQTVNLVSNESQKLMDRAATAEKRFQKGWNTLREEG  213



>ref|XP_006375269.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
 gb|ERP53066.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
Length=168

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 60/121 (50%), Gaps = 16/121 (13%)
 Frame = +2

Query  107  PQQRDKPW------HAYISEDLPRTVQESTDSAIRSA--RLFQNTSSGHLRSLQDFLPQL  262
            P +   PW       A I +   + +Q S D+AI ++  R  + TS+      Q    Q 
Sbjct  38   PVEETAPWIDNAMQQALIYQ---KNIQYSLDTAIEASKSRFSEITSTS-----QAHFSQT  89

Query  263  SSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEE  442
             S+   YE  LF KVK+E+ +A  HP +   +AV  GL+ ++ PR+ L+  TL  F SEE
Sbjct  90   ISEIGVYEGKLFGKVKEEINVAASHPLITSAVAVGLGLVALKRPRQILYYKTLRLFTSEE  149

Query  443  A  445
             
Sbjct  150  V  150



>gb|EMS57790.1| hypothetical protein TRIUR3_22595 [Triticum urartu]
Length=122

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  389  GPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGH  568
            GPRRFL+RNTLGRF++E+   N  E+++ E + S++ ++K+S    ++  +  ++++RG 
Sbjct  15   GPRRFLYRNTLGRFKTEKDLLNDVEQSMIEYKTSIESLRKDSKYTLDKVVIGESDLQRGR  74

Query  569  SELMNAG  589
            ++L + G
Sbjct  75   TDLRSTG  81



>ref|XP_003570319.1| PREDICTED: uncharacterized protein LOC100834616 [Brachypodium 
distachyon]
Length=285

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = +2

Query  251  LPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRF  430
            L  +  +Y A E     K+K+ V +A EHP +  G A   G++ ++ PR +L +     F
Sbjct  106  LEWVKKEYLAREQMALGKIKEGVIMAIEHPGIAAGSATVAGIVLLKRPRSYLIQRVRRIF  165

Query  431  RSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
             S+E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + L   G
Sbjct  166  VSKETLLSGIQAEVNHMRQTVNLVSNESQKLMDRAATAEKRFQKGWNTLREEG  218



>gb|EEC72302.1| hypothetical protein OsI_05485 [Oryza sativa Indica Group]
Length=280

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 56/110 (51%), Gaps = 0/110 (0%)
 Frame = +2

Query  260  LSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSE  439
            +  +Y  +E  +F K+K+   +A EHP +  G     G++  + PR +L +     F S+
Sbjct  104  IKKEYTVHEQVVFGKIKEGAIMAIEHPGIAAGSTAIAGIVLFKRPRSYLIQRVRRIFVSK  163

Query  440  EAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
            E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + L   G
Sbjct  164  ETLLSGIQAEVNHMRQTVNLVSNESQKLLDRAATAEKRFQKGWNTLREEG  213



>ref|XP_003078117.1| unnamed protein product [Ostreococcus tauri]
Length=214

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 52/103 (50%), Gaps = 1/103 (1%)
 Frame = +2

Query  284  EDALFQKV-KDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKA  460
            ED  F+   K  V+ AR +P  VGG       + +  PR  L+R+T+GR +SEEA FN  
Sbjct  45   EDEFFRSASKRVVDFARANPVSVGGTVACAVALALPAPRALLWRSTIGRLQSEEALFNAC  104

Query  461  EKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
             +  + L L  +    E  +L E  + A  EMKRG S L  A 
Sbjct  105  VRRSERLTLEAEAASAEIQRLAESVSAAEIEMKRGASNLRAAA  147



>gb|EMT21115.1| hypothetical protein F775_32566 [Aegilops tauschii]
Length=211

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  389  GPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGH  568
            GPRRFL+RNTLGRF++E+   N  E+++ E + S++ ++K+S    ++  +  ++++RG 
Sbjct  100  GPRRFLYRNTLGRFKTEKDLLNDVEQSMIEYKTSIESLRKDSKYTLDKVVIGESDLQRGR  159

Query  569  SELMNAG  589
            ++L + G
Sbjct  160  TDLRSTG  166



>gb|AEJ54427.1| hypothetical protein [Fagopyrum esculentum subsp. ancestrale]
Length=48

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  425  RFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGH  568
            RF+SEE +F KAEKNV EL+LS+DL K ES KL +RAA A  EM++G 
Sbjct  1    RFQSEETKFLKAEKNVNELKLSIDLTKGESKKLLQRAAFAEKEMQQGR  48



>emb|CEF97085.1| unnamed product [Ostreococcus tauri]
Length=245

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 52/103 (50%), Gaps = 1/103 (1%)
 Frame = +2

Query  284  EDALFQKV-KDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKA  460
            ED  F+   K  V+ AR +P  VGG       + +  PR  L+R+T+GR +SEEA FN  
Sbjct  76   EDEFFRSASKRVVDFARANPVSVGGTVACAVALALPAPRALLWRSTIGRLQSEEALFNAC  135

Query  461  EKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
             +  + L L  +    E  +L E  + A  EMKRG S L  A 
Sbjct  136  VRRSERLTLEAEAASAEIQRLAESVSAAEIEMKRGASNLRAAA  178



>ref|XP_001416629.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94922.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=164

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 51/94 (54%), Gaps = 0/94 (0%)
 Frame = +2

Query  308  KDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTLGRFRSEEAQFNKAEKNVKELRL  487
            K  VE  RE+PA     A+    + + GPR  L+R+TLGR +SEEA FN   +  + L L
Sbjct  4    KRVVETVRENPASATAGALTFLALALPGPRALLWRSTLGRLQSEEALFNACVRRSETLAL  63

Query  488  SVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  589
              +    E  +L E A+ A  EMKRG + L +A 
Sbjct  64   DAEAASGEIQRLTEAASAAEVEMKRGAANLKSAA  97



>gb|KHN10117.1| hypothetical protein glysoja_048900 [Glycine soja]
Length=144

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 61/138 (44%), Gaps = 7/138 (5%)
 Frame = +2

Query  44   MASDVPSTEIDETSSPAPAATPQQRDKPWHAYI---SEDLPRTVQESTDSAIRSAR----  202
            M ++ P ++ D  SS            P+  Y    ++   +   ++ DS I +A+    
Sbjct  3    MVAESPESDSDNNSSKTNNPQTLNETAPFLDYALAQAQLYHKAFNDAVDSTIDTAKSRFS  62

Query  203  LFQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIF  382
              ++TSS H     D L  L SQY AYE  LF K+K+ V +A  HP +  G   + GL+ 
Sbjct  63   QIRSTSSAHFHQTLDSLDDLKSQYTAYEGLLFGKIKEGVVVAASHPVITCGATASLGLLV  122

Query  383  MRGPRRFLFRNTLGRFRS  436
            ++   R      +  F S
Sbjct  123  LKSEIRCFLLCCVLIFHS  140



>gb|KDD75675.1| hypothetical protein H632_c557p1 [Helicosporidium sp. ATCC 50920]
Length=259

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 58/112 (52%), Gaps = 0/112 (0%)
 Frame = +2

Query  242  QDFLPQLSSQYKAYEDALFQKVKDEVEIAREHPAVVGGIAVATGLIFMRGPRRFLFRNTL  421
            Q ++ Q        E   F  +K+ V  A EH      +A+A   + + GPRR L+R TL
Sbjct  79   QGYVDQGRGTLAGLEAQAFGLLKEGVRTAYEHQEATAAVALAAAAVLLPGPRRLLWRMTL  138

Query  422  GRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  577
            GR +S EA    AE+  K L  +V   K+E  KL ER ALA  E +RG ++L
Sbjct  139  GRLQSPEAGLRSAEQRAKALSEAVTFQKQEVSKLQERVALAQAEYERGRNKL  190



>gb|KJB09930.1| hypothetical protein B456_001G175600 [Gossypium raimondii]
Length=169

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 49/89 (55%), Gaps = 6/89 (7%)
 Frame = +2

Query  158  RTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            + ++++ + AI+++R      ++TSS H     + L  + SQ   YED  F KVK+ + I
Sbjct  59   KIIEQNVNDAIKASRSRLSEIRSTSSAHFNLTIESLKDVKSQLDVYEDLAFGKVKEGINI  118

Query  326  AREHPAVVGGIAVATGLIFMRG--PRRFL  406
            A  +P + GG AV  G + ++   PR ++
Sbjct  119  AASNPLITGGAAVGLGFLVLKSMVPRLYM  147



>gb|KJB09929.1| hypothetical protein B456_001G175600 [Gossypium raimondii]
Length=154

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +2

Query  158  RTVQESTDSAIRSARL----FQNTSSGHLRSLQDFLPQLSSQYKAYEDALFQKVKDEVEI  325
            + ++++ + AI+++R      ++TSS H     + L  + SQ   YED  F KVK+ + I
Sbjct  59   KIIEQNVNDAIKASRSRLSEIRSTSSAHFNLTIESLKDVKSQLDVYEDLAFGKVKEGINI  118

Query  326  AREHPAVVGGIAVATGLI  379
            A  +P + GG AV  G +
Sbjct  119  AASNPLITGGAAVGLGFL  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160