BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF020I14

Length=575
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP06636.1|  unnamed protein product                                269   1e-84   Coffea canephora [robusta coffee]
gb|KDO44657.1|  hypothetical protein CISIN_1g0124231mg                  258   8e-84   Citrus sinensis [apfelsine]
ref|NP_001275129.1|  uncharacterized protein LOC102577536               266   3e-83   Solanum tuberosum [potatoes]
ref|XP_004246418.1|  PREDICTED: probable ADP-ribosylation factor ...    265   4e-83   Solanum lycopersicum
gb|KDO44660.1|  hypothetical protein CISIN_1g0124231mg                  258   7e-83   Citrus sinensis [apfelsine]
gb|KDO44658.1|  hypothetical protein CISIN_1g0124231mg                  259   1e-82   Citrus sinensis [apfelsine]
ref|XP_009611524.1|  PREDICTED: probable ADP-ribosylation factor ...    264   1e-82   Nicotiana tomentosiformis
ref|XP_011094839.1|  PREDICTED: probable ADP-ribosylation factor ...    264   2e-82   Sesamum indicum [beniseed]
ref|XP_009787987.1|  PREDICTED: probable ADP-ribosylation factor ...    264   2e-82   Nicotiana sylvestris
ref|XP_006429046.1|  hypothetical protein CICLE_v10012277mg             258   2e-82   
gb|AGF95103.1|  aspartate aminotransferase                              253   2e-82   Prunus persica
gb|KDO44656.1|  hypothetical protein CISIN_1g0124231mg                  258   4e-82   Citrus sinensis [apfelsine]
ref|XP_006341048.1|  PREDICTED: probable ADP-ribosylation factor ...    263   4e-82   Solanum tuberosum [potatoes]
ref|XP_007027081.1|  ARF-GAP domain 7 isoform 2                         260   5e-82   
gb|EYU41704.1|  hypothetical protein MIMGU_mgv1a005908mg                261   2e-81   Erythranthe guttata [common monkey flower]
ref|XP_011094837.1|  PREDICTED: probable ADP-ribosylation factor ...    261   2e-81   Sesamum indicum [beniseed]
ref|XP_010253247.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    260   4e-81   
ref|XP_007027080.1|  ARF-GAP domain 7 isoform 1                         260   5e-81   
ref|XP_010111496.1|  ADP-ribosylation factor GTPase-activating pr...    258   5e-81   
ref|XP_006339030.1|  PREDICTED: probable ADP-ribosylation factor ...    259   7e-81   Solanum tuberosum [potatoes]
ref|XP_006480784.1|  PREDICTED: probable ADP-ribosylation factor ...    259   1e-80   Citrus sinensis [apfelsine]
ref|XP_004249530.1|  PREDICTED: probable ADP-ribosylation factor ...    259   1e-80   Solanum lycopersicum
ref|XP_009804190.1|  PREDICTED: probable ADP-ribosylation factor ...    258   1e-80   Nicotiana sylvestris
ref|XP_002527750.1|  arf gtpase-activating protein, putative            258   2e-80   Ricinus communis
gb|EPS67752.1|  hypothetical protein M569_07021                         256   5e-80   Genlisea aurea
gb|KJB16885.1|  hypothetical protein B456_002G255000                    257   7e-80   Gossypium raimondii
ref|XP_010253251.1|  PREDICTED: probable ADP-ribosylation factor ...    257   7e-80   Nelumbo nucifera [Indian lotus]
ref|XP_008366719.1|  PREDICTED: probable ADP-ribosylation factor ...    256   1e-79   
gb|KHG27901.1|  ADP-ribosylation factor GTPase-activating AGD7 -l...    256   1e-79   Gossypium arboreum [tree cotton]
ref|XP_010111495.1|  ADP-ribosylation factor GTPase-activating pr...    253   1e-79   
ref|XP_002262606.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    256   2e-79   Vitis vinifera
ref|XP_003521336.1|  PREDICTED: probable ADP-ribosylation factor ...    256   3e-79   Glycine max [soybeans]
ref|XP_008345448.1|  PREDICTED: probable ADP-ribosylation factor ...    255   3e-79   
ref|XP_007205139.1|  hypothetical protein PRUPE_ppa005179mg             255   4e-79   Prunus persica
gb|KDP20155.1|  hypothetical protein JCGZ_00032                         254   5e-79   Jatropha curcas
ref|XP_009621199.1|  PREDICTED: probable ADP-ribosylation factor ...    254   7e-79   Nicotiana tomentosiformis
ref|XP_008241285.1|  PREDICTED: probable ADP-ribosylation factor ...    254   9e-79   
ref|XP_009416249.1|  PREDICTED: probable ADP-ribosylation factor ...    254   9e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB76702.1|  hypothetical protein B456_012G102200                    254   1e-78   Gossypium raimondii
ref|XP_003554321.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    254   2e-78   Glycine max [soybeans]
ref|XP_009374672.1|  PREDICTED: probable ADP-ribosylation factor ...    253   2e-78   Pyrus x bretschneideri [bai li]
gb|KEH42388.1|  ADP-ribosylation factor GTPase-activating protein...    253   3e-78   Medicago truncatula
gb|KHG23489.1|  ADP-ribosylation factor GTPase-activating protein...    252   5e-78   Gossypium arboreum [tree cotton]
ref|XP_002309050.1|  PDE1 SUPPRESSOR 1 family protein                   252   6e-78   Populus trichocarpa [western balsam poplar]
dbj|BAE71192.1|  putative Asp1                                          252   8e-78   Trifolium pratense [peavine clover]
gb|EYU26574.1|  hypothetical protein MIMGU_mgv11b004906mg               251   1e-77   Erythranthe guttata [common monkey flower]
ref|XP_008810804.1|  PREDICTED: LOW QUALITY PROTEIN: ADP-ribosyla...    245   1e-77   
ref|XP_011019883.1|  PREDICTED: probable ADP-ribosylation factor ...    251   2e-77   Populus euphratica
ref|XP_010037851.1|  PREDICTED: probable ADP-ribosylation factor ...    250   2e-77   Eucalyptus grandis [rose gum]
ref|XP_004302746.1|  PREDICTED: probable ADP-ribosylation factor ...    250   3e-77   Fragaria vesca subsp. vesca
ref|XP_009338772.1|  PREDICTED: probable ADP-ribosylation factor ...    250   3e-77   Pyrus x bretschneideri [bai li]
ref|XP_002322896.2|  hypothetical protein POPTR_0016s11100g             245   4e-77   
ref|XP_007144453.1|  hypothetical protein PHAVU_007G157400g             250   5e-77   Phaseolus vulgaris [French bean]
gb|KHG23490.1|  ADP-ribosylation factor GTPase-activating protein...    250   7e-77   Gossypium arboreum [tree cotton]
ref|XP_006846038.1|  hypothetical protein AMTR_s00012p00025360          248   1e-76   Amborella trichopoda
gb|KGN58883.1|  hypothetical protein Csa_3G734360                       248   2e-76   Cucumis sativus [cucumbers]
ref|XP_004137765.1|  PREDICTED: LOW QUALITY PROTEIN: ADP-ribosyla...    248   2e-76   
ref|XP_004167174.1|  PREDICTED: probable ADP-ribosylation factor ...    248   2e-76   
ref|XP_010920665.1|  PREDICTED: probable ADP-ribosylation factor ...    248   2e-76   Elaeis guineensis
ref|XP_010529843.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    248   3e-76   Tarenaya hassleriana [spider flower]
ref|XP_008795047.1|  PREDICTED: probable ADP-ribosylation factor ...    247   3e-76   Phoenix dactylifera
ref|XP_007162658.1|  hypothetical protein PHAVU_001G1694000g            248   4e-76   Phaseolus vulgaris [French bean]
ref|XP_008442564.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    247   5e-76   Cucumis melo [Oriental melon]
ref|XP_003542460.1|  PREDICTED: probable ADP-ribosylation factor ...    247   6e-76   Glycine max [soybeans]
ref|XP_003537172.1|  PREDICTED: probable ADP-ribosylation factor ...    247   7e-76   Glycine max [soybeans]
ref|XP_004495006.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    246   2e-75   Cicer arietinum [garbanzo]
ref|XP_010922379.1|  PREDICTED: probable ADP-ribosylation factor ...    243   1e-74   Elaeis guineensis
ref|XP_010509321.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    243   2e-74   
ref|XP_006410942.1|  hypothetical protein EUTSA_v10016645mg             242   2e-74   Eutrema salsugineum [saltwater cress]
ref|XP_009402324.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    242   2e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010427029.1|  PREDICTED: probable ADP-ribosylation factor ...    243   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010937673.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    242   3e-74   Elaeis guineensis
ref|XP_010505344.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    242   4e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010517025.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    242   4e-74   Camelina sativa [gold-of-pleasure]
ref|XP_004253319.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    241   4e-74   
ref|XP_006403662.1|  hypothetical protein EUTSA_v10010333mg             242   5e-74   Eutrema salsugineum [saltwater cress]
ref|XP_002881515.1|  hypothetical protein ARALYDRAFT_482750             241   6e-74   
gb|ABD32193.1|  Arf GTPase activating protein                           241   7e-74   Medicago truncatula
ref|NP_181291.1|  ADP-ribosylation factor GTPase-activating prote...    241   8e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KJB36746.1|  hypothetical protein B456_006G174500                    237   8e-74   Gossypium raimondii
ref|XP_004493890.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    240   8e-74   Cicer arietinum [garbanzo]
gb|KJB36745.1|  hypothetical protein B456_006G174500                    235   1e-73   Gossypium raimondii
ref|XP_006294027.1|  hypothetical protein CARUB_v10023020mg             241   2e-73   
ref|XP_003625498.1|  ADP-ribosylation factor GTPase-activating pr...    240   2e-73   
ref|XP_010907061.1|  PREDICTED: probable ADP-ribosylation factor ...    239   4e-73   
ref|XP_010504141.1|  PREDICTED: probable ADP-ribosylation factor ...    239   7e-73   Camelina sativa [gold-of-pleasure]
ref|XP_009116065.1|  PREDICTED: probable ADP-ribosylation factor ...    238   1e-72   Brassica rapa
ref|XP_010678052.1|  PREDICTED: probable ADP-ribosylation factor ...    238   1e-72   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB36744.1|  hypothetical protein B456_006G174500                    238   1e-72   Gossypium raimondii
ref|XP_002877936.1|  hypothetical protein ARALYDRAFT_485760             238   1e-72   
emb|CDX79739.1|  BnaC03g20750D                                          238   1e-72   
gb|KJB36743.1|  hypothetical protein B456_006G174500                    238   1e-72   Gossypium raimondii
ref|XP_010515873.1|  PREDICTED: probable ADP-ribosylation factor ...    238   2e-72   Camelina sativa [gold-of-pleasure]
gb|KHF98429.1|  ADP-ribosylation factor GTPase-activating AGD7 -l...    237   2e-72   Gossypium arboreum [tree cotton]
ref|XP_006291063.1|  hypothetical protein CARUB_v10017178mg             238   2e-72   
emb|CDX78196.1|  BnaA09g33910D                                          237   3e-72   
emb|CDY30849.1|  BnaC04g27040D                                          235   1e-71   Brassica napus [oilseed rape]
ref|NP_190939.1|  putative ADP-ribosylation factor GTPase-activat...    235   1e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CDY07784.1|  BnaA03g17270D                                          234   2e-71   Brassica napus [oilseed rape]
gb|AAG17006.1|AF184146_1  ARF GAP-like zinc finger-containing pro...    234   2e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73533.1|  BnaC08g24700D                                          234   3e-71   
ref|XP_009409527.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    236   3e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009133186.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    234   4e-71   Brassica rapa
ref|XP_009139382.1|  PREDICTED: probable ADP-ribosylation factor ...    233   5e-71   Brassica rapa
ref|XP_009386541.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    232   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002984338.1|  hypothetical protein SELMODRAFT_445864             231   4e-70   Selaginella moellendorffii
ref|XP_002972763.1|  hypothetical protein SELMODRAFT_441959             230   1e-69   
emb|CDY18435.1|  BnaA04g21520D                                          226   3e-68   Brassica napus [oilseed rape]
ref|NP_001150760.1|  DNA binding protein                                225   8e-68   Zea mays [maize]
emb|CDY69342.1|  BnaCnng63080D                                          225   9e-68   Brassica napus [oilseed rape]
ref|XP_004984751.1|  PREDICTED: probable ADP-ribosylation factor ...    225   1e-67   Setaria italica
ref|XP_008654261.1|  PREDICTED: probable ADP-ribosylation factor ...    224   1e-67   Zea mays [maize]
ref|XP_009141672.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    224   1e-67   Brassica rapa
ref|XP_002465464.1|  hypothetical protein SORBIDRAFT_01g039320          223   7e-67   Sorghum bicolor [broomcorn]
ref|XP_009143481.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    222   2e-66   Brassica rapa
ref|NP_001049726.1|  Os03g0278400                                       221   3e-66   
gb|EAY89468.1|  hypothetical protein OsI_11000                          221   3e-66   Oryza sativa Indica Group [Indian rice]
dbj|BAJ88349.1|  predicted protein                                      219   2e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001772457.1|  predicted protein                                  221   3e-65   
ref|XP_003558222.1|  PREDICTED: probable ADP-ribosylation factor ...    219   4e-65   Brachypodium distachyon [annual false brome]
emb|CDX74953.1|  BnaA05g06990D                                          218   4e-65   
gb|EMS46940.1|  putative ADP-ribosylation factor GTPase-activatin...    218   8e-65   Triticum urartu
ref|XP_008671989.1|  PREDICTED: LOW QUALITY PROTEIN: probable ADP...    212   1e-63   
ref|XP_006651253.1|  PREDICTED: LOW QUALITY PROTEIN: probable ADP...    209   1e-61   Oryza brachyantha
ref|XP_001761895.1|  predicted protein                                  208   4e-61   
ref|XP_009409624.1|  PREDICTED: probable ADP-ribosylation factor ...    201   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010267329.1|  PREDICTED: probable ADP-ribosylation factor ...    199   6e-58   Nelumbo nucifera [Indian lotus]
ref|XP_009381844.1|  PREDICTED: probable ADP-ribosylation factor ...    199   7e-58   
ref|XP_010100237.1|  ADP-ribosylation factor GTPase-activating pr...    186   4e-56   
emb|CBI23433.3|  unnamed protein product                                185   4e-53   Vitis vinifera
emb|CAN72855.1|  hypothetical protein VITISV_043217                     186   9e-53   Vitis vinifera
ref|XP_010646583.1|  PREDICTED: probable ADP-ribosylation factor ...    186   9e-53   Vitis vinifera
gb|KIZ06703.1|  putative ADP-ribosylation factor GTPase-activatin...    184   1e-51   Monoraphidium neglectum
ref|XP_001695178.1|  ARF-GAP protein                                    175   3e-48   Chlamydomonas reinhardtii
ref|XP_001417919.1|  predicted protein                                  162   7e-45   Ostreococcus lucimarinus CCE9901
ref|XP_007514120.1|  predicted protein                                  162   1e-43   Bathycoccus prasinos
ref|XP_008605893.1|  hypothetical protein SDRG_02105                    158   7e-43   Saprolegnia diclina VS20
ref|XP_011397681.1|  ADP-ribosylation factor GTPase-activating pr...    163   7e-43   Auxenochlorella protothecoides
gb|KDO25807.1|  hypothetical protein SPRG_08750                         158   8e-43   Saprolegnia parasitica CBS 223.65
ref|XP_005848600.1|  hypothetical protein CHLNCDRAFT_14348              147   1e-41   Chlorella variabilis
emb|CBK19893.2|  unnamed protein product                                156   2e-41   Blastocystis hominis
ref|XP_008860901.1|  hypothetical protein H310_00060                    154   3e-41   Aphanomyces invadans
ref|XP_009830090.1|  hypothetical protein H257_06531                    154   5e-41   Aphanomyces astaci
ref|XP_002768563.1|  ADP-ribosylation factor GTPase-activating pr...    147   6e-41   Perkinsus marinus ATCC 50983
emb|CEF97847.1|  Arf GTPase activating protein                          155   6e-41   Ostreococcus tauri
ref|XP_005645766.1|  Arf GTPase activating protein                      144   1e-40   Coccomyxa subellipsoidea C-169
ref|XP_005536673.1|  similar to ADP ribosylation factor 1 GTPase ...    151   4e-40   Cyanidioschyzon merolae strain 10D
dbj|GAM26213.1|  hypothetical protein SAMD00019534_093880               152   8e-40   Acytostelium subglobosum LB1
ref|XP_002997471.1|  conserved hypothetical protein                     150   1e-39   Phytophthora infestans T30-4
gb|ETO61900.1|  hypothetical protein F444_20132                         150   2e-39   Phytophthora parasitica P1976
ref|XP_001634175.1|  predicted protein                                  143   2e-39   Nematostella vectensis
ref|XP_009517356.1|  hypothetical protein PHYSODRAFT_358803             150   2e-39   Phytophthora sojae
ref|XP_008914204.1|  hypothetical protein PPTG_17983                    150   2e-39   Phytophthora parasitica INRA-310
gb|EWM30510.1|  adp-ribosylation factor gtpase-activating protein...    150   7e-39   Nannochloropsis gaditana
ref|XP_002507574.1|  predicted protein                                  148   7e-39   Micromonas commoda
gb|ETP31173.1|  hypothetical protein F442_19946                         148   1e-38   Phytophthora parasitica P10297
ref|XP_002783407.1|  ADP-ribosylation factor GTPase-activating pr...    148   1e-38   Perkinsus marinus ATCC 50983
ref|XP_002778044.1|  ADP-ribosylation factor GTPase-activating pr...    148   1e-38   Perkinsus marinus ATCC 50983
ref|XP_003288862.1|  hypothetical protein DICPUDRAFT_153151             148   3e-38   Dictyostelium purpureum
ref|XP_002947250.1|  hypothetical protein VOLCADRAFT_103335             146   8e-38   Volvox carteri f. nagariensis
ref|XP_640542.1|  Arf GTPase activating protein                         147   1e-37   Dictyostelium discoideum AX4
ref|XP_002432407.1|  ADP-ribosylation factor GTPase-activating pr...    145   1e-37   Pediculus humanus corporis [human body lice]
emb|CBK21352.2|  unnamed protein product                                140   2e-37   Blastocystis hominis
gb|AFR94315.1|  ADP-ribosylation factor GTPase-activating protein 1     144   2e-37   Cryptococcus neoformans var. grubii H99
dbj|GAN06267.1|  ARF GTPase activator                                   144   3e-37   Mucor ambiguus
emb|CCI46063.1|  unnamed protein product                                143   3e-37   Albugo candida
ref|XP_773500.1|  hypothetical protein CNBI1140                         144   4e-37   Cryptococcus neoformans var. neoformans B-3501A
ref|XP_568103.1|  ARF GTPase activator                                  143   5e-37   Cryptococcus neoformans var. neoformans JEC21
pdb|3DWD|A  Chain A, Crystal Structure Of The Arfgap Domain Of Hu...    136   9e-37   Homo sapiens [man]
ref|XP_002765599.1|  ADP-ribosylation factor GTPase-activating pr...    143   9e-37   Perkinsus marinus ATCC 50983
ref|XP_010720794.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   1e-36   Meleagris gallopavo [common turkey]
ref|XP_008182223.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   1e-36   Acyrthosiphon pisum
gb|EFA86569.1|  Arf GTPase activating protein                           144   1e-36   Heterostelium album PN500
ref|XP_007248441.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   1e-36   
ref|XP_007248439.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    142   1e-36   
ref|XP_001950272.2|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   2e-36   Acyrthosiphon pisum
gb|EDL07365.1|  ADP-ribosylation factor GTPase activating protein...    135   2e-36   Mus musculus [mouse]
gb|EPB81233.1|  hypothetical protein HMPREF1544_12056                   142   2e-36   Mucor circinelloides f. circinelloides 1006PhL
gb|EDL88775.1|  ADP-ribosylation factor GTPase activating protein...    135   2e-36   Rattus norvegicus [brown rat]
ref|XP_008155396.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    142   2e-36   
ref|XP_007248438.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    142   2e-36   
ref|XP_002169146.2|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   2e-36   
ref|XP_009481135.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   2e-36   Pelecanus crispus
ref|XP_007475631.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   2e-36   Monodelphis domestica
ref|XP_008561395.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-36   Galeopterus variegatus [Malayan flying lemur]
ref|XP_007248440.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   2e-36   
ref|XP_010187255.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   2e-36   Mesitornis unicolor
gb|EFB27915.1|  hypothetical protein PANDA_015322                       136   2e-36   Ailuropoda melanoleuca
gb|KFQ24554.1|  ADP-ribosylation factor GTPase-activating protein 1     137   2e-36   Mesitornis unicolor
ref|XP_011473811.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   2e-36   Oryzias latipes [Japanese rice fish]
ref|XP_005711999.1|  unnamed protein product                            141   2e-36   Chondrus crispus [carageen]
gb|KFP51575.1|  ADP-ribosylation factor GTPase-activating protein 1     137   2e-36   Cathartes aura
ref|XP_007475630.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   2e-36   Monodelphis domestica
ref|XP_008561394.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   3e-36   Galeopterus variegatus [Malayan flying lemur]
ref|XP_011473810.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   3e-36   Oryzias latipes [Japanese rice fish]
ref|XP_001368073.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   3e-36   Monodelphis domestica
gb|KIR36581.1|  ADP-ribosylation factor GTPase-activating protein 1     141   3e-36   Cryptococcus gattii VGII MMRL2647
ref|XP_007248436.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   3e-36   
ref|XP_007475629.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   3e-36   Monodelphis domestica
ref|XP_001661085.1|  AAEL010834-PA                                      142   3e-36   
ref|XP_004069187.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   3e-36   Oryzias latipes [Japanese rice fish]
ref|XP_011473812.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   3e-36   Oryzias latipes [Japanese rice fish]
gb|KFP37360.1|  ADP-ribosylation factor GTPase-activating protein 1     137   3e-36   Chlamydotis macqueenii
ref|XP_008561393.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   3e-36   Galeopterus variegatus [Malayan flying lemur]
gb|KGB78795.1|  ARF GTPase activator                                    141   3e-36   Cryptococcus gattii VGII R265
gb|KIR38984.1|  ADP-ribosylation factor GTPase-activating protein 1     141   3e-36   Cryptococcus gattii VGII Ram5
ref|XP_011473809.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   3e-36   Oryzias latipes [Japanese rice fish]
ref|XP_009561374.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    136   4e-36   Cuculus canorus
ref|XP_006021706.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   4e-36   
gb|KIR46360.1|  ADP-ribosylation factor GTPase-activating protein 1     141   4e-36   Cryptococcus gattii CA1280
ref|XP_004586004.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   4e-36   Ochotona princeps [southern American pika]
gb|KFO77782.1|  ADP-ribosylation factor GTPase-activating protein 1     136   4e-36   Cuculus canorus
gb|ELT90952.1|  hypothetical protein CAPTEDRAFT_222395                  141   4e-36   Capitella teleta
gb|KIR59556.1|  ADP-ribosylation factor GTPase-activating protein 1     141   4e-36   Cryptococcus gattii CA1873
ref|XP_004586003.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   4e-36   Ochotona princeps [southern American pika]
ref|XP_011473806.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   4e-36   
emb|CBJ25986.1|  conserved unknown protein                              141   4e-36   Ectocarpus siliculosus
ref|XP_005911153.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   4e-36   Bos mutus
ref|XP_006040558.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   4e-36   Bubalus bubalis [domestic water buffalo]
ref|XP_004586002.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   4e-36   Ochotona princeps [southern American pika]
ref|XP_006040559.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   4e-36   Bubalus bubalis [domestic water buffalo]
ref|XP_005688339.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   4e-36   
ref|XP_002174427.1|  GTPase activating protein                          139   4e-36   Schizosaccharomyces japonicus yFS275
ref|XP_008108396.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   5e-36   Anolis carolinensis [Carolina anole]
ref|XP_005177691.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   5e-36   Musca domestica
ref|XP_003421812.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   5e-36   
ref|XP_010125893.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   5e-36   Chlamydotis macqueenii
ref|XP_006021705.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   5e-36   
emb|CEP08064.1|  hypothetical protein                                   140   5e-36   Parasitella parasitica
ref|XP_005688338.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   5e-36   
ref|XP_008199322.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   5e-36   Tribolium castaneum [rust-red flour beetle]
ref|XP_008108395.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   5e-36   Anolis carolinensis [Carolina anole]
ref|XP_005177690.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    141   5e-36   Musca domestica
ref|XP_004014459.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   5e-36   
ref|XP_005911151.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   5e-36   Bos mutus
ref|XP_005688336.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   
ref|XP_002021171.1|  GL24958                                            140   6e-36   
ref|XP_006040556.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   Bubalus bubalis [domestic water buffalo]
ref|XP_008108394.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   Anolis carolinensis [Carolina anole]
ref|XP_005688337.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   
ref|XP_008318298.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   
ref|XP_010834887.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   Bison bison bison
ref|XP_006040555.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   Bubalus bubalis [domestic water buffalo]
ref|XP_008199318.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   Tribolium castaneum [rust-red flour beetle]
ref|XP_010599443.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   
ref|XP_005911152.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   Bos mutus
gb|ABG81468.1|  ADP-ribosylation factor GTPase activating protein 1     140   6e-36   Bos taurus [bovine]
ref|XP_005688335.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   
ref|XP_008318295.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006040557.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   Bubalus bubalis [domestic water buffalo]
ref|XP_008318297.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006040554.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   6e-36   
ref|XP_005911150.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   7e-36   Bos mutus
ref|XP_008108393.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   7e-36   Anolis carolinensis [Carolina anole]
ref|XP_006040553.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   7e-36   Bubalus bubalis [domestic water buffalo]
ref|XP_011231263.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-36   Ailuropoda melanoleuca
gb|ELR44953.1|  ADP-ribosylation factor GTPase-activating protein 1     140   7e-36   Bos mutus
ref|XP_003220727.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   7e-36   Anolis carolinensis [Carolina anole]
ref|XP_008318299.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   7e-36   
gb|ETN61933.1|  arf gtpase-activating protein                           141   7e-36   Anopheles darlingi [American malaria mosquito]
ref|XP_008108390.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   7e-36   Anolis carolinensis [Carolina anole]
ref|XP_008108391.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   8e-36   Anolis carolinensis [Carolina anole]
ref|XP_008108392.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   8e-36   Anolis carolinensis [Carolina anole]
emb|CDW56542.1|  ArfGap domain containing protein                       137   8e-36   Trichuris trichiura
ref|XP_003973707.1|  PREDICTED: LOW QUALITY PROTEIN: ADP-ribosyla...    139   8e-36   
ref|XP_002781378.1|  ADP-ribosylation factor GTPase-activating pr...    139   9e-36   Perkinsus marinus ATCC 50983
ref|XP_011053108.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   9e-36   Acromyrmex echinatior
gb|KIR85194.1|  ADP-ribosylation factor GTPase-activating protein 1     140   9e-36   Cryptococcus gattii VGIV IND107
ref|XP_003757653.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   9e-36   Sarcophilus harrisii
ref|XP_003757654.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   9e-36   
ref|XP_006683264.1|  hypothetical protein BATDEDRAFT_93026              139   9e-36   Batrachochytrium dendrobatidis JAM81
ref|XP_005804334.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   9e-36   Xiphophorus maculatus
ref|XP_004932864.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    135   1e-35   Bombyx mori [silk moth]
emb|CAF96839.1|  unnamed protein product                                140   1e-35   Tetraodon nigroviridis
ref|XP_005688334.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   1e-35   
gb|EGI66270.1|  ADP-ribosylation factor GTPase-activating protein 1     139   1e-35   Acromyrmex echinatior
ref|XP_011053106.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   1e-35   Acromyrmex echinatior
ref|XP_005804332.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   1e-35   
ref|XP_005804333.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   1e-35   Xiphophorus maculatus
ref|XP_003193317.1|  ARF GTPase activator                               139   1e-35   
ref|XP_002047141.1|  GJ13268                                            140   1e-35   
ref|XP_003757655.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   1e-35   
ref|XP_002593299.1|  hypothetical protein BRAFLDRAFT_123642             140   1e-35   
gb|KIR53910.1|  ADP-ribosylation factor GTPase-activating protein 1     139   1e-35   
gb|KJE03779.1|  ADP-ribosylation factor GTPase-activating protein 1     139   1e-35   
gb|KFR10173.1|  ADP-ribosylation factor GTPase-activating protein 1     139   1e-35   
ref|XP_006896942.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   1e-35   
ref|XP_006820874.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   1e-35   
ref|XP_008408163.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   1e-35   
ref|XP_006769592.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   1e-35   
ref|XP_004841103.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   1e-35   
ref|XP_009932174.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   1e-35   
ref|XP_008282879.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   1e-35   
ref|XP_006769591.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   1e-35   
ref|XP_005885625.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   1e-35   
ref|XP_004841104.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   2e-35   
ref|XP_005885622.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_005885623.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
gb|AAH52922.1|  Arfgap1 protein                                         135   2e-35   
ref|XP_002007543.1|  GI12330                                            140   2e-35   
ref|XP_008496026.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_007561289.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_004908202.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_008408160.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_006820873.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   2e-35   
ref|XP_008408161.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_006769590.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_009932173.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_004352415.1|  Arf GTPase activating protein                      140   2e-35   
ref|XP_006769589.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_008282877.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_006769588.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_008408162.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_004545115.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   2e-35   
ref|XP_005885620.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_008408158.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_006784443.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   2e-35   
ref|XP_008496024.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_008408159.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_006107584.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_006107583.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_006769587.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_007561288.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_005885621.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_009053101.1|  hypothetical protein LOTGIDRAFT_202235             135   2e-35   
ref|XP_005469446.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_004841100.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_006784440.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_006784441.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   2e-35   
ref|XP_005885618.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
gb|EHB17797.1|  ADP-ribosylation factor GTPase-activating protein 1     139   2e-35   
ref|XP_004545113.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   2e-35   
ref|XP_006784438.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_004545110.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_004545112.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   2e-35   
ref|XP_005469445.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
ref|XP_005885619.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   2e-35   
dbj|BAP72691.1|  ADP-ribosylation factor GTPase-activating protei...    138   2e-35   
ref|XP_001353393.2|  GA18052                                            139   2e-35   
ref|XP_006784439.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   2e-35   
ref|XP_005469447.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   2e-35   
dbj|BAO41242.1|  ADP-ribosylation factor GTPase-activating protei...    138   2e-35   
ref|XP_004841101.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   2e-35   
ref|XP_005422211.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   3e-35   
ref|XP_005309612.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_006132580.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   3e-35   
ref|XP_005309610.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_005971074.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_005309613.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_008408156.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   3e-35   
gb|KGL73679.1|  ADP-ribosylation factor GTPase-activating protein 1     138   3e-35   
ref|XP_005422212.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_004545114.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_005309611.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_006784442.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_005885626.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_316505.3|  AGAP006462-PA                                         139   3e-35   
ref|XP_001688877.1|  AGAP006462-PB                                      139   3e-35   
gb|EDL88772.1|  ADP-ribosylation factor GTPase activating protein...    135   3e-35   
ref|XP_005214650.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|NP_001261761.1|  ADP-ribosylation factor GTPase activating pr...    139   3e-35   
ref|XP_010225614.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_005309609.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_009910924.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    139   3e-35   
ref|XP_004526903.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_004545111.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_001983752.1|  GH16066                                            139   3e-35   
ref|XP_008176826.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_005971073.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
gb|ELK25838.1|  ADP-ribosylation factor GTPase-activating protein 1     139   3e-35   
gb|KFP75120.1|  ADP-ribosylation factor GTPase-activating protein 1     138   3e-35   
ref|NP_001068732.1|  ADP-ribosylation factor GTPase-activating pr...    138   3e-35   
ref|XP_009910923.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_004545109.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_002084644.1|  GD12722                                            139   3e-35   
ref|XP_005885624.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_005971072.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_007059934.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|XP_008176825.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   3e-35   
ref|NP_524040.2|  ADP-ribosylation factor GTPase activating prote...    139   4e-35   
ref|XP_003062566.1|  predicted protein                                  131   4e-35   
gb|EFN89487.1|  ADP-ribosylation factor GTPase-activating protein 1     137   4e-35   
gb|AAB64300.1|  putative ARF1 GTPase activating protein                 139   4e-35   
ref|XP_005214647.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   4e-35   
gb|KFW03940.1|  ADP-ribosylation factor GTPase-activating protein 1     138   4e-35   
ref|XP_008176822.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   4e-35   
ref|XP_004526902.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   4e-35   
ref|XP_007909529.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   4e-35   
gb|KFW02048.1|  ADP-ribosylation factor GTPase-activating protein 1     138   4e-35   
gb|EFX78795.1|  hypothetical protein DAPPUDRAFT_212918                  139   4e-35   
ref|XP_007909543.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   4e-35   
ref|XP_005971071.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   4e-35   
ref|XP_007909537.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   4e-35   
ref|XP_009865316.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   4e-35   
gb|KFO15213.1|  ADP-ribosylation factor GTPase-activating protein 1     138   4e-35   
ref|XP_005214644.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   4e-35   
ref|XP_007909516.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   4e-35   
gb|KFR06783.1|  ADP-ribosylation factor GTPase-activating protein 1     138   4e-35   
ref|XP_010148520.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   4e-35   
gb|KFV58405.1|  ADP-ribosylation factor GTPase-activating protein 1     138   4e-35   
ref|XP_009214044.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   4e-35   
ref|XP_001972531.1|  GG13833                                            138   5e-35   
ref|XP_010148519.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   5e-35   
gb|KFV58128.1|  ADP-ribosylation factor GTPase-activating protein 1     138   5e-35   
ref|XP_005569626.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   5e-35   
pdb|3O47|A  Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Pro...    136   5e-35   
gb|KFV72896.1|  ADP-ribosylation factor GTPase-activating protein 1     138   5e-35   
ref|XP_007909523.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   5e-35   
ref|XP_011257776.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   5e-35   
ref|XP_002094582.1|  GE20123                                            138   5e-35   
ref|XP_011183750.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   5e-35   
gb|KFP64800.1|  ADP-ribosylation factor GTPase-activating protein 1     137   5e-35   
ref|XP_002030269.1|  GM24658                                            138   5e-35   
ref|XP_007909509.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   5e-35   
ref|XP_010309491.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   5e-35   
gb|KFP19975.1|  ADP-ribosylation factor GTPase-activating protein 1     137   5e-35   
ref|XP_009572886.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   5e-35   
gb|KFU90357.1|  ADP-ribosylation factor GTPase-activating protein 1     137   5e-35   
gb|KFB35133.1|  AGAP006462-PA-like protein                              139   5e-35   
ref|XP_009214043.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   5e-35   
ref|XP_011183749.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   5e-35   
gb|KFQ69648.1|  ADP-ribosylation factor GTPase-activating protein 1     137   5e-35   
gb|KFQ16005.1|  ADP-ribosylation factor GTPase-activating protein 1     137   5e-35   
gb|KFM03910.1|  ADP-ribosylation factor GTPase-activating protein 1     137   5e-35   
ref|XP_009214042.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   5e-35   
gb|KFW95138.1|  ADP-ribosylation factor GTPase-activating protein 1     137   5e-35   
gb|KFQ88328.1|  ADP-ribosylation factor GTPase-activating protein 1     137   5e-35   
gb|KFW69098.1|  ADP-ribosylation factor GTPase-activating protein 1     137   6e-35   
gb|KFP99236.1|  ADP-ribosylation factor GTPase-activating protein 1     137   6e-35   
ref|XP_007666940.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_009214041.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
gb|KGM00046.1|  ADP-ribosylation factor GTPase-activating protein 1     137   6e-35   
ref|XP_009214038.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|NP_001248155.1|  ADP-ribosylation factor GTPase-activating pr...    137   6e-35   
ref|XP_011338313.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_009214039.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_009669251.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
gb|AAH67611.1|  Arfgap3 protein                                         138   6e-35   
ref|XP_011140806.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_003704826.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_007666938.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_009669228.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_003904552.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_007666939.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_005569625.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_001955995.1|  GF24981                                            138   6e-35   
ref|XP_009471685.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_009572885.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    138   6e-35   
ref|XP_007666937.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_009510717.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_009970965.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_009471683.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_009214040.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_008009449.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_005000441.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_011338312.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_009970964.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_009669221.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|NP_991160.1|  ADP-ribosylation factor GTPase activating prote...    138   6e-35   
ref|XP_010288674.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   6e-35   
ref|XP_005569621.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009698041.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
gb|KFP84881.1|  ADP-ribosylation factor GTPase-activating protein 1     137   7e-35   
ref|XP_009669235.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_003462854.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009641986.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009669208.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_003462853.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_007666936.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009815650.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_007666931.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009996908.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
gb|KFO53275.1|  ADP-ribosylation factor GTPase-activating protein 1     137   7e-35   
ref|XP_009272178.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_002065881.1|  GK20569                                            138   7e-35   
ref|XP_007666932.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_010395162.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
gb|KFQ45457.1|  ADP-ribosylation factor GTPase-activating protein 1     137   7e-35   
ref|XP_009214031.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_008009418.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009669243.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009325088.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009996909.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009979348.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009510716.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_005569623.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_008686388.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009957255.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009891743.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009325086.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
gb|KFP04031.1|  ADP-ribosylation factor GTPase-activating protein 1     137   7e-35   
ref|XP_001506479.2|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_006639598.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009272177.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_009979347.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_002198392.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_010395163.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|NP_001026028.1|  ADP-ribosylation factor GTPase-activating pr...    137   7e-35   
ref|XP_009214037.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   7e-35   
ref|XP_010745219.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    137   8e-35   



>emb|CDP06636.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLR+LQSQ GNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRELQSQLGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQLRKMELGGNDNFN+FISQYG+PK+TDIVTKYNTKAASVYRDRIQALA+GKPW
Sbjct  61   MDSWSEIQLRKMELGGNDNFNNFISQYGIPKQTDIVTKYNTKAASVYRDRIQALAEGKPW  120

Query  534  RDPPVVKETLKGG  572
            RDPP  KETL GG
Sbjct  121  RDPPPFKETLSGG  133



>gb|KDO44657.1| hypothetical protein CISIN_1g0124231mg, partial [Citrus sinensis]
Length=201

 Score =   258 bits (660),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLRDLQSQPGNKICVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F+SQYG+PKETDIVTKYNT AAS+YRDRIQA+A+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNERLNTFLSQYGIPKETDIVTKYNTNAASIYRDRIQAIAEGRPW  120

Query  534  RDPPVVKETLKGG  572
            RDPPVVKETL  G
Sbjct  121  RDPPVVKETLNAG  133



>ref|NP_001275129.1| uncharacterized protein LOC102577536 [Solanum tuberosum]
 gb|ABA46771.1| unknown [Solanum tuberosum]
Length=468

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQ+QPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQAQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ+RKMELGGN++FN F+ QYG+PKETDIVTKYNTKAA+VYRDRIQ+LA+GKPW
Sbjct  61   MDSWSEIQIRKMELGGNESFNKFVLQYGIPKETDIVTKYNTKAATVYRDRIQSLAEGKPW  120

Query  534  RDPPVVKETLKGGA  575
            RDPPVVKE L+G A
Sbjct  121  RDPPVVKEVLRGSA  134



>ref|XP_004246418.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Solanum lycopersicum]
Length=467

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQ+QPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQAQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ+RKMELGGN++FN F+ QYG+PKETDIVTKYNTKAA+VYRDRIQ+LA+GKPW
Sbjct  61   MDSWSEIQIRKMELGGNESFNKFVLQYGIPKETDIVTKYNTKAATVYRDRIQSLAEGKPW  120

Query  534  RDPPVVKETLKGGA  575
            RDPPVVKE L+G A
Sbjct  121  RDPPVVKEVLRGSA  134



>gb|KDO44660.1| hypothetical protein CISIN_1g0124231mg [Citrus sinensis]
Length=276

 Score =   258 bits (660),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLRDLQSQPGNKICVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F+SQYG+PKETDIVTKYNT AAS+YRDRIQA+A+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNERLNTFLSQYGIPKETDIVTKYNTNAASIYRDRIQAIAEGRPW  120

Query  534  RDPPVVKETLKGG  572
            RDPPVVKETL  G
Sbjct  121  RDPPVVKETLNAG  133



>gb|KDO44658.1| hypothetical protein CISIN_1g0124231mg, partial [Citrus sinensis]
 gb|KDO44659.1| hypothetical protein CISIN_1g0124231mg, partial [Citrus sinensis]
Length=301

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLRDLQSQPGNKICVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F+SQYG+PKETDIVTKYNT AAS+YRDRIQA+A+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNERLNTFLSQYGIPKETDIVTKYNTNAASIYRDRIQAIAEGRPW  120

Query  534  RDPPVVKETLKGG  572
            RDPPVVKETL  G
Sbjct  121  RDPPVVKETLNAG  133



>ref|XP_009611524.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana tomentosiformis]
 ref|XP_009611525.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana tomentosiformis]
Length=464

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            M++SRRLRDLQ+QPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MSSSRRLRDLQAQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ+RKMELGGND+ N F++QYG+PKETDIVTKYNTKAASVYRDRIQ+LA+GKPW
Sbjct  61   MDSWSEIQIRKMELGGNDSLNKFMAQYGIPKETDIVTKYNTKAASVYRDRIQSLAEGKPW  120

Query  534  RDPPVVKETLKG  569
            RDPPVVKE+L G
Sbjct  121  RDPPVVKESLNG  132



>ref|XP_011094839.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Sesamum indicum]
Length=471

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MA+SRRLR+LQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MASSRRLRELQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWS+IQL+KMELGGN+ FNSF+SQYG+PKETDIVTKYNTKAAS+YRDRIQALA+G+PW
Sbjct  61   MDSWSDIQLKKMELGGNERFNSFVSQYGIPKETDIVTKYNTKAASIYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLK  566
             DPPVVKETLK
Sbjct  121  SDPPVVKETLK  131



>ref|XP_009787987.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana sylvestris]
 ref|XP_009787988.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana sylvestris]
Length=464

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            M++SRRLRDLQ+QPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MSSSRRLRDLQAQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ+RKMELGGND+ N F++QYG+PKETDIVTKYNTKAASVYRDRIQ+LA+GKPW
Sbjct  61   MDSWSEIQIRKMELGGNDSLNKFMAQYGIPKETDIVTKYNTKAASVYRDRIQSLAEGKPW  120

Query  534  RDPPVVKETLKG  569
            RDPPVVKE L G
Sbjct  121  RDPPVVKEALNG  132



>ref|XP_006429046.1| hypothetical protein CICLE_v10012277mg [Citrus clementina]
 gb|ESR42286.1| hypothetical protein CICLE_v10012277mg [Citrus clementina]
Length=310

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLRDLQSQPGNKICVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F+SQYG+PKETDIVTKYNT AAS+YRDRIQA+A+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNERLNTFLSQYGIPKETDIVTKYNTNAASIYRDRIQAIAEGRPW  120

Query  534  RDPPVVKETLKGG  572
            RDPPVVKETL  G
Sbjct  121  RDPPVVKETLNAG  133



>gb|AGF95103.1| aspartate aminotransferase, partial [Prunus persica]
Length=145

 Score =   253 bits (645),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++ YGV KETDIVTKYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNEQLNAFLASYGVSKETDIVTKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKGG  572
            RDPPVVKETL  G
Sbjct  121  RDPPVVKETLGFG  133



>gb|KDO44656.1| hypothetical protein CISIN_1g0124231mg [Citrus sinensis]
Length=318

 Score =   258 bits (659),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLRDLQSQPGNKICVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F+SQYG+PKETDIVTKYNT AAS+YRDRIQA+A+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNERLNTFLSQYGIPKETDIVTKYNTNAASIYRDRIQAIAEGRPW  120

Query  534  RDPPVVKETLKGG  572
            RDPPVVKETL  G
Sbjct  121  RDPPVVKETLNAG  133



>ref|XP_006341048.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 isoform X1 [Solanum tuberosum]
 ref|XP_006341049.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 isoform X2 [Solanum tuberosum]
 ref|XP_006341050.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 isoform X3 [Solanum tuberosum]
 ref|XP_006341051.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 isoform X4 [Solanum tuberosum]
Length=467

 Score =   263 bits (671),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MA+SRRLRDLQ+QPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MASSRRLRDLQAQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ+RKMELGGN++FN F+ QYG+PKETDIVTKYNTKAA+VYRDRIQ+LA+GKPW
Sbjct  61   MDSWSEIQIRKMELGGNESFNKFVLQYGIPKETDIVTKYNTKAATVYRDRIQSLAEGKPW  120

Query  534  RDPPVVKETLKGGA  575
            RDPPVVKE L G A
Sbjct  121  RDPPVVKEVLGGSA  134



>ref|XP_007027081.1| ARF-GAP domain 7 isoform 2 [Theobroma cacao]
 gb|EOY07583.1| ARF-GAP domain 7 isoform 2 [Theobroma cacao]
Length=397

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLRDLQSQPGNK CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATRRLRDLQSQPGNKTCVDCNQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  NSF++QYG+PKETDIVTKYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMESGGNEQLNSFLAQYGIPKETDIVTKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKGGA  575
            RDPPVVKETL GG 
Sbjct  121  RDPPVVKETLNGGG  134



>gb|EYU41704.1| hypothetical protein MIMGU_mgv1a005908mg [Erythranthe guttata]
Length=465

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLR+LQSQ GNK+CVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRELQSQAGNKVCVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQL+KMELGGN+ FN+FISQYG+PKETDIV+KYNTKAASVYRDRIQ+LA+GKPW
Sbjct  61   MDSWSEIQLKKMELGGNEKFNNFISQYGIPKETDIVSKYNTKAASVYRDRIQSLAEGKPW  120

Query  534  RDPPVVKETLK  566
            RDPPV KETL+
Sbjct  121  RDPPVEKETLR  131



>ref|XP_011094837.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Sesamum indicum]
Length=468

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MD+WSEIQL+KME GGN+ FNSFI+QYG+PKETDIV KY+T AASVYRDRIQALA+GK W
Sbjct  61   MDAWSEIQLKKMEFGGNEKFNSFIAQYGIPKETDIVAKYHTNAASVYRDRIQALAEGKSW  120

Query  534  RDPPVVKETLK  566
            RDPPVVKETLK
Sbjct  121  RDPPVVKETLK  131



>ref|XP_010253247.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Nelumbo nucifera]
 ref|XP_010253248.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Nelumbo nucifera]
 ref|XP_010253249.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Nelumbo nucifera]
 ref|XP_010253250.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Nelumbo nucifera]
Length=463

 Score =   260 bits (664),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLRDLQSQPGNKICVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARRLRDLQSQPGNKICVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQL+KME GGN+  N+F+SQYG+PKETDIVTKYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQLKKMEAGGNEQLNAFLSQYGIPKETDIVTKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
            RDPPVVKETL
Sbjct  121  RDPPVVKETL  130



>ref|XP_007027080.1| ARF-GAP domain 7 isoform 1 [Theobroma cacao]
 gb|EOY07582.1| ARF-GAP domain 7 isoform 1 [Theobroma cacao]
Length=467

 Score =   260 bits (664),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLRDLQSQPGNK CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATRRLRDLQSQPGNKTCVDCNQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  NSF++QYG+PKETDIVTKYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMESGGNEQLNSFLAQYGIPKETDIVTKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKGGA  575
            RDPPVVKETL GG 
Sbjct  121  RDPPVVKETLNGGG  134



>ref|XP_010111496.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Morus 
notabilis]
 gb|EXC31019.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Morus 
notabilis]
Length=416

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLR+LQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRNLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGND  N+F++QYG+PKETDIVTKYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMESGGNDRLNAFLAQYGIPKETDIVTKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
            RDPPVVKE L
Sbjct  121  RDPPVVKEAL  130



>ref|XP_006339030.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Solanum tuberosum]
Length=459

 Score =   259 bits (662),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQ+Q GNK+CVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQAQTGNKVCVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQLRKMELGGND  N F++QYG+PKETDIVTKYNTK+ASVYRDRIQ LA+GKPW
Sbjct  61   MDSWSEIQLRKMELGGNDKLNKFMNQYGIPKETDIVTKYNTKSASVYRDRIQNLAEGKPW  120

Query  534  RDPPVVKETLKG  569
            +DPPVVKE++KG
Sbjct  121  QDPPVVKESVKG  132



>ref|XP_006480784.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like isoform X1 [Citrus sinensis]
 ref|XP_006480785.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like isoform X2 [Citrus sinensis]
Length=464

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLRDLQSQPGNKICVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F+SQYG+PKETDIVTKYNT AAS+YRDRIQA+A+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNERLNTFLSQYGIPKETDIVTKYNTNAASIYRDRIQAIAEGRPW  120

Query  534  RDPPVVKETLKGG  572
            RDPPVVKETL  G
Sbjct  121  RDPPVVKETLNAG  133



>ref|XP_004249530.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Solanum lycopersicum]
Length=459

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQ+Q GNK+CVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQAQTGNKVCVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQLRKMELGGN+  N F+SQYG+PKETDIVTKYNTK+ASVYRDRIQ LA+GKPW
Sbjct  61   MDSWSEIQLRKMELGGNEKLNKFMSQYGIPKETDIVTKYNTKSASVYRDRIQNLAEGKPW  120

Query  534  RDPPVVKETLKG  569
            +DPPVVKE++KG
Sbjct  121  QDPPVVKESVKG  132



>ref|XP_009804190.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana sylvestris]
Length=454

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQ+QPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQAQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQL+KMELGGNDN N F++QYG+ KETDIVTKYNT AASVYRDRIQ+LA+GKPW
Sbjct  61   MDSWSEIQLKKMELGGNDNLNKFMAQYGIRKETDIVTKYNTNAASVYRDRIQSLAEGKPW  120

Query  534  RDPPVVKE  557
            RDPPVVKE
Sbjct  121  RDPPVVKE  128



>ref|XP_002527750.1| arf gtpase-activating protein, putative [Ricinus communis]
 gb|EEF34663.1| arf gtpase-activating protein, putative [Ricinus communis]
Length=457

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F+SQYGVPKETDIV KYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNEKLNAFLSQYGVPKETDIVAKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
            RDPPVVKET+
Sbjct  121  RDPPVVKETI  130



>gb|EPS67752.1| hypothetical protein M569_07021, partial [Genlisea aurea]
Length=443

 Score =   256 bits (655),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA RRLRDLQSQPGNKICVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAQRRLRDLQSQPGNKICVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQLRKME GGND FN+F++QY + KET+IV+KYNT AASVYRDRIQALADGKPW
Sbjct  61   MDSWSEIQLRKMEAGGNDRFNNFMAQYEISKETEIVSKYNTNAASVYRDRIQALADGKPW  120

Query  534  RDPPVVKETLK  566
            RDPPVVKE LK
Sbjct  121  RDPPVVKEALK  131



>gb|KJB16885.1| hypothetical protein B456_002G255000 [Gossypium raimondii]
 gb|KJB16886.1| hypothetical protein B456_002G255000 [Gossypium raimondii]
 gb|KJB16887.1| hypothetical protein B456_002G255000 [Gossypium raimondii]
Length=469

 Score =   257 bits (656),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQPGNK CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPGNKTCVDCNQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++QYG+PKETDIV KYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMESGGNERLNAFLAQYGIPKETDIVAKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKGGA  575
            RDPPVVKE L GG 
Sbjct  121  RDPPVVKENLNGGG  134



>ref|XP_010253251.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nelumbo nucifera]
Length=466

 Score =   257 bits (656),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQL+KME GGN+ FN+F+SQYG+PKETDI TKYNT AASVYRDRIQA+A+G+PW
Sbjct  61   MDSWSEIQLKKMEAGGNEQFNAFLSQYGIPKETDIATKYNTNAASVYRDRIQAVAEGRPW  120

Query  534  RDPPVVKETL  563
            R PPVVK+TL
Sbjct  121  RGPPVVKDTL  130



>ref|XP_008366719.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Malus domestica]
 ref|XP_008366720.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Malus domestica]
Length=473

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++ YGVPKETDIVTKYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNEQLNAFLASYGVPKETDIVTKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
            RDPPVVKE L
Sbjct  121  RDPPVVKEAL  130



>gb|KHG27901.1| ADP-ribosylation factor GTPase-activating AGD7 -like protein 
[Gossypium arboreum]
Length=469

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQPGNK CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPGNKTCVDCNQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++QYG+PKETDIV KYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMESGGNERLNAFLAQYGIPKETDIVAKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKGGA  575
            RDPPVVKE L GG 
Sbjct  121  RDPPVVKENLNGGG  134



>ref|XP_010111495.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Morus 
notabilis]
 gb|EXC31018.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Morus 
notabilis]
Length=376

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLR+LQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRNLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGND  N+F++QYG+PKETDIVTKYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMESGGNDRLNAFLAQYGIPKETDIVTKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
             DPPVVKE L
Sbjct  121  GDPPVVKEAL  130



>ref|XP_002262606.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Vitis vinifera]
Length=465

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQP NKICVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPANKICVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  NSF++QYG+ KETDIVTKYNTKAAS+YRDRIQALA+G+PW
Sbjct  61   MDSWSEIQVKKMESGGNERLNSFLAQYGIKKETDIVTKYNTKAASIYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKGG  572
            RDPPVVKET+  G
Sbjct  121  RDPPVVKETIGAG  133



>ref|XP_003521336.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Glycine max]
Length=486

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQP NKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPANKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGND  N+F++QYG+PKETDIV KYN+ AA+VYRDRIQALADG+PW
Sbjct  61   MDSWSEIQIKKMEAGGNDKLNAFLTQYGIPKETDIVAKYNSNAAAVYRDRIQALADGRPW  120

Query  534  RDPPVVKETLKGGA  575
            RDPPVVKE ++  A
Sbjct  121  RDPPVVKEAVRSSA  134



>ref|XP_008345448.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Malus domestica]
Length=471

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++ YGVPKETDIVTKYNT +ASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNEKLNAFLASYGVPKETDIVTKYNTNSASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
            RDPPVV+ET+
Sbjct  121  RDPPVVQETI  130



>ref|XP_007205139.1| hypothetical protein PRUPE_ppa005179mg [Prunus persica]
 gb|EMJ06338.1| hypothetical protein PRUPE_ppa005179mg [Prunus persica]
Length=473

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++ YGV KETDIVTKYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNEQLNAFLASYGVSKETDIVTKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
            RDPPVVKETL
Sbjct  121  RDPPVVKETL  130



>gb|KDP20155.1| hypothetical protein JCGZ_00032 [Jatropha curcas]
Length=465

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++QYG+ KETDIVTKYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNERLNAFLAQYGISKETDIVTKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
            RDPPVVKET+
Sbjct  121  RDPPVVKETV  130



>ref|XP_009621199.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana tomentosiformis]
Length=457

 Score =   254 bits (649),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQ+QPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQAQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQL+KMELGGN N N F++QYG+ KETDIVTKYNTKAASVYRDRIQ+LA+GKPW
Sbjct  61   MDSWSEIQLKKMELGGNGNLNKFMAQYGIRKETDIVTKYNTKAASVYRDRIQSLAEGKPW  120

Query  534  RDPPVVKE  557
            +DPPVVKE
Sbjct  121  QDPPVVKE  128



>ref|XP_008241285.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Prunus mume]
 ref|XP_008241292.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Prunus mume]
Length=473

 Score =   254 bits (649),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++ YGV KETDIVTKYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNEQLNAFLASYGVSKETDIVTKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKGG  572
            RDPPVVKE+L  G
Sbjct  121  RDPPVVKESLGFG  133



>ref|XP_009416249.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Musa acuminata subsp. malaccensis]
Length=460

 Score =   254 bits (648),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLR+LQ+QPGNK CVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRELQTQPGNKTCVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQL+KME GGND  N+F+++YGVPKETDIV KYNT+AA+VYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQLKKMEAGGNDRLNAFVARYGVPKETDIVAKYNTRAAAVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKGGA  575
            +DPPVVKETL  GA
Sbjct  121  QDPPVVKETLGSGA  134



>gb|KJB76702.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76703.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76704.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76705.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76706.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76707.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
Length=462

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLR LQSQPGN+ CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATRRLRGLQSQPGNRTCVDCNQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN++ N+F++QYG+PKETDIVTKYN+ AAS+YRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMESGGNEDLNAFLAQYGIPKETDIVTKYNSNAASIYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKGGA  575
            RDPPV+KETL GG+
Sbjct  121  RDPPVMKETLNGGS  134



>ref|XP_003554321.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Glycine max]
Length=489

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQP NKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPANKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGND  N+F+ QYG+PKETDIV KYN+ AASVYRDRIQALADG+PW
Sbjct  61   MDSWSEIQIKKMEAGGNDKLNAFLLQYGIPKETDIVAKYNSNAASVYRDRIQALADGRPW  120

Query  534  RDPPVVKETLK  566
            RDPPVVKE ++
Sbjct  121  RDPPVVKEAVR  131



>ref|XP_009374672.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Pyrus x bretschneideri]
 ref|XP_009374673.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Pyrus x bretschneideri]
Length=471

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++ YGVPKETDIVTKYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNEQLNAFLASYGVPKETDIVTKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
            RDP VVKE L
Sbjct  121  RDPQVVKEAL  130



>gb|KEH42388.1| ADP-ribosylation factor GTPase-activating protein AGD10 [Medicago 
truncatula]
Length=481

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MD+WSEIQ++KME GGNDN N+F+++Y +PKETDIVTKYNT AASVYRDRIQAL++G+ W
Sbjct  61   MDAWSEIQIKKMEAGGNDNLNAFLAKYSIPKETDIVTKYNTNAASVYRDRIQALSEGRSW  120

Query  534  RDPPVVKETL  563
            RDPPVVKE L
Sbjct  121  RDPPVVKENL  130



>gb|KHG23489.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Gossypium 
arboreum]
Length=462

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLRDLQSQPGN+ CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATRRLRDLQSQPGNRTCVDCNQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++QYG+PKETDIVTKYN+ AAS+YRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMESGGNEELNAFLAQYGIPKETDIVTKYNSNAASIYRDRIQALAEGRSW  120

Query  534  RDPPVVKETLKGGA  575
            RDPPVVKE+L GG+
Sbjct  121  RDPPVVKESLNGGS  134



>ref|XP_002309050.1| PDE1 SUPPRESSOR 1 family protein [Populus trichocarpa]
 gb|EEE92573.1| PDE1 SUPPRESSOR 1 family protein [Populus trichocarpa]
Length=471

 Score =   252 bits (643),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLR+LQSQP NKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRELQSQPANKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGND  N+F++QYG+PKETDIV KYNT AASVYRDRIQ LADG+ W
Sbjct  61   MDSWSEIQIKKMESGGNDKLNAFLAQYGIPKETDIVAKYNTNAASVYRDRIQTLADGRSW  120

Query  534  RDPPVVKETL  563
            RDPPVVKET+
Sbjct  121  RDPPVVKETI  130



>dbj|BAE71192.1| putative Asp1 [Trifolium pratense]
 dbj|BAE71286.1| putative Asp1 [Trifolium pratense]
Length=477

 Score =   252 bits (643),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLR+LQSQPGNKICVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRELQSQPGNKICVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MD+WSEIQ++KME GGNDN N+F+++Y +PKETDIVTKYNT AASVYRDRIQA+++G+PW
Sbjct  61   MDAWSEIQIKKMEAGGNDNLNAFLARYSIPKETDIVTKYNTNAASVYRDRIQAMSEGRPW  120

Query  534  RDPPVVKETL  563
            RDPPVVKE  
Sbjct  121  RDPPVVKENF  130



>gb|EYU26574.1| hypothetical protein MIMGU_mgv11b004906mg [Erythranthe guttata]
Length=461

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLR+LQSQ GNKICVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRELQSQSGNKICVDCTQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQL+KME GGN+ FN+FIS YG+PKETDIV KYNT AASVYRDR+QAL++GKPW
Sbjct  61   MDSWSEIQLKKMENGGNEKFNNFISHYGIPKETDIVAKYNTNAASVYRDRVQALSEGKPW  120

Query  534  RDPPVVKETLK  566
            RDPPVVKE  K
Sbjct  121  RDPPVVKEASK  131



>ref|XP_008810804.1| PREDICTED: LOW QUALITY PROTEIN: ADP-ribosylation factor GTPase-activating 
protein AGD7-like [Phoenix dactylifera]
Length=281

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            ASRRLR+LQ+QPGNK CVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  5    ASRRLRELQAQPGNKTCVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  64

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SWSEIQL+KME GGND  N F++QYGV KETDI  KYNTKAA+VYRDRIQALA+G+PWRD
Sbjct  65   SWSEIQLKKMEAGGNDRLNGFLAQYGVLKETDIPAKYNTKAAAVYRDRIQALAEGRPWRD  124

Query  540  PPVVKETLKGGA  575
            PPVVKETL  G 
Sbjct  125  PPVVKETLTTGG  136



>ref|XP_011019883.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Populus euphratica]
Length=468

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLR+LQSQP NKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRELQSQPANKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGND  N+F++QYG+PKETDIV KY+T AASVYRDRIQALADG+ W
Sbjct  61   MDSWSEIQIKKMESGGNDKLNAFLAQYGIPKETDIVAKYDTYAASVYRDRIQALADGRSW  120

Query  534  RDPPVVKETL  563
            RDPP+VKET+
Sbjct  121  RDPPIVKETI  130



>ref|XP_010037851.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Eucalyptus grandis]
 ref|XP_010037852.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Eucalyptus grandis]
 gb|KCW49632.1| hypothetical protein EUGRSUZ_K03154 [Eucalyptus grandis]
 gb|KCW49633.1| hypothetical protein EUGRSUZ_K03154 [Eucalyptus grandis]
Length=466

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQP NK CVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPANKTCVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME+GGN+  N+F++QYG+PKETDIV KYNTKAA VYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEVGGNERLNAFLAQYGIPKETDIVAKYNTKAAGVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
            RDPPVVKE++
Sbjct  121  RDPPVVKESV  130



>ref|XP_004302746.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Fragaria vesca subsp. vesca]
Length=461

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++ YGV KETDIVTKYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMESGGNERLNAFLAGYGVSKETDIVTKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKET  560
            RDPPVVKE+
Sbjct  121  RDPPVVKES  129



>ref|XP_009338772.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Pyrus x bretschneideri]
Length=471

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASR L DLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRGLGDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++ YGVPKETDIVTKYNT AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNEQLNAFLASYGVPKETDIVTKYNTNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
            RDPPVV+ET+
Sbjct  121  RDPPVVQETI  130



>ref|XP_002322896.2| hypothetical protein POPTR_0016s11100g [Populus trichocarpa]
 gb|EEF04657.2| hypothetical protein POPTR_0016s11100g [Populus trichocarpa]
Length=316

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLR+LQSQP NKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRELQSQPANKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ+++ME GGND  N+F++QYG+PKETDIV KY+T AAS+YRDRIQ+LA+G+ W
Sbjct  61   MDSWSEIQIKRMESGGNDKLNAFLAQYGIPKETDIVAKYSTNAASIYRDRIQSLAEGRSW  120

Query  534  RDPPVVKETL  563
            RDPPVVKET+
Sbjct  121  RDPPVVKETI  130



>ref|XP_007144453.1| hypothetical protein PHAVU_007G157400g [Phaseolus vulgaris]
 gb|ESW16447.1| hypothetical protein PHAVU_007G157400g [Phaseolus vulgaris]
Length=482

 Score =   250 bits (638),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  177  AASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  356
            AASRRLRDLQSQ  NKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM
Sbjct  3    AASRRLRDLQSQAANKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  62

Query  357  DSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWR  536
            DSWSE+Q++KME GGND  N+F++QY +PKETDIVTKYNT AA+VYRDRIQA+ADG+PWR
Sbjct  63   DSWSEVQIKKMEAGGNDKLNAFLAQYSIPKETDIVTKYNTNAAAVYRDRIQAIADGRPWR  122

Query  537  DPPVVKETLKGG  572
            DPPVVKE L  G
Sbjct  123  DPPVVKENLAAG  134



>gb|KHG23490.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Gossypium 
arboreum]
Length=510

 Score =   250 bits (639),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLRDLQSQPGN+ CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATRRLRDLQSQPGNRTCVDCNQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++QYG+PKETDIVTKYN+ AAS+YRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMESGGNEELNAFLAQYGIPKETDIVTKYNSNAASIYRDRIQALAEGRSW  120

Query  534  RDPPVVKETLKGGA  575
            RDPPVVKE+L GG+
Sbjct  121  RDPPVVKESLNGGS  134



>ref|XP_006846038.1| hypothetical protein AMTR_s00012p00025360 [Amborella trichopoda]
 gb|ERN07713.1| hypothetical protein AMTR_s00012p00025360 [Amborella trichopoda]
Length=455

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASR LR LQSQPGNKICVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRMLRGLQSQPGNKICVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MD+WSEIQL+KME+GGND FN+F++QYG+PKETDI+ KYN+ AAS+YRDR+QALA+GK W
Sbjct  61   MDAWSEIQLKKMEIGGNDKFNNFLAQYGIPKETDIIPKYNSNAASIYRDRVQALAEGKAW  120

Query  534  RDPPVVKETL  563
            +DPPVVKE++
Sbjct  121  KDPPVVKESM  130



>gb|KGN58883.1| hypothetical protein Csa_3G734360 [Cucumis sativus]
Length=468

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQS+PGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSRPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F+SQYG+PKETDIVTKYNT AA VYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMEAGGNEQLNAFLSQYGIPKETDIVTKYNTSAAGVYRDRIQALAEGRSW  120

Query  534  RDPPVVKETL  563
            +DPP VKE +
Sbjct  121  KDPPAVKENI  130



>ref|XP_004137765.1| PREDICTED: LOW QUALITY PROTEIN: ADP-ribosylation factor GTPase-activating 
protein AGD7-like [Cucumis sativus]
Length=457

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQS+PGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSRPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F+SQYG+PKETDIVTKYNT AA VYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMEAGGNEQLNAFLSQYGIPKETDIVTKYNTSAAGVYRDRIQALAEGRSW  120

Query  534  RDPPVVKETL  563
            +DPP VKE +
Sbjct  121  KDPPAVKENI  130



>ref|XP_004167174.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Cucumis sativus]
Length=471

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQS+PGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSRPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F+SQYG+PKETDIVTKYNT AA VYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMEAGGNEQLNAFLSQYGIPKETDIVTKYNTSAAGVYRDRIQALAEGRSW  120

Query  534  RDPPVVKETL  563
            +DPP VKE +
Sbjct  121  KDPPAVKENI  130



>ref|XP_010920665.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Elaeis guineensis]
Length=465

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            ASRRLRDLQ+QPGNK CVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  5    ASRRLRDLQAQPGNKTCVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  64

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SWSEIQL+KME GGND  N+F++QYGVPKETDI  KYNTKAA++YRDRIQALA+G+PWRD
Sbjct  65   SWSEIQLKKMEAGGNDRLNAFLAQYGVPKETDISAKYNTKAAAIYRDRIQALAEGRPWRD  124

Query  540  PPVVKETL  563
            PP VKE L
Sbjct  125  PPAVKEIL  132



>ref|XP_010529843.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Tarenaya hassleriana]
Length=464

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLR LQSQP NK+CVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARRLRALQSQPENKVCVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++QYG+PKETDIV KYN+ AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNERLNNFLAQYGIPKETDIVAKYNSNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
            RDPPVVKET+
Sbjct  121  RDPPVVKETI  130



>ref|XP_008795047.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Phoenix dactylifera]
Length=466

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            ASRRLRDLQ+QPGNK CVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  5    ASRRLRDLQAQPGNKTCVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  64

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SWSEIQL+KME GGND  N+F++QYGVPKETDI  KYNTKAA++YRDRIQALA+G+PWRD
Sbjct  65   SWSEIQLKKMEAGGNDRLNAFLAQYGVPKETDISAKYNTKAAAIYRDRIQALAEGRPWRD  124

Query  540  PPVVKETL  563
            PP VKE L
Sbjct  125  PPAVKEIL  132



>ref|XP_007162658.1| hypothetical protein PHAVU_001G1694000g [Phaseolus vulgaris]
 ref|XP_007162659.1| hypothetical protein PHAVU_001G1694000g [Phaseolus vulgaris]
 gb|ESW34652.1| hypothetical protein PHAVU_001G1694000g [Phaseolus vulgaris]
 gb|ESW34653.1| hypothetical protein PHAVU_001G1694000g [Phaseolus vulgaris]
Length=485

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            ASRRLRDLQSQ  NKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  2    ASRRLRDLQSQAANKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  61

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SWSEIQ++KME GGND  NSF+ QYG+ KETDIV KYN+ AASVYRDRIQA+ADG+PWRD
Sbjct  62   SWSEIQIKKMEAGGNDKLNSFLKQYGIAKETDIVAKYNSNAASVYRDRIQAIADGRPWRD  121

Query  540  PPVVKETLK  566
            PPVVKET++
Sbjct  122  PPVVKETIR  130



>ref|XP_008442564.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Cucumis melo]
 ref|XP_008442565.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Cucumis melo]
Length=466

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLRDLQS+PGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRDLQSRPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N+F++QYG+PKETDIVTKYNT AA VYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMEAGGNEQLNAFLAQYGIPKETDIVTKYNTSAAGVYRDRIQALAEGRSW  120

Query  534  RDPPVVKETL  563
            +DPP VKE +
Sbjct  121  KDPPAVKENI  130



>ref|XP_003542460.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Glycine max]
Length=481

 Score =   247 bits (631),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  177  AASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  356
            AASRRLRDLQS+ GNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM
Sbjct  3    AASRRLRDLQSEAGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  62

Query  357  DSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWR  536
            DSWS+IQ++KME GGND  N+F++QY +PKETDIVTKYNT AASVYRDRIQA+A+G+PWR
Sbjct  63   DSWSDIQIKKMEAGGNDKLNAFLAQYSIPKETDIVTKYNTNAASVYRDRIQAIAEGRPWR  122

Query  537  DPPVVKETL  563
            DPPV+KE L
Sbjct  123  DPPVLKENL  131



>ref|XP_003537172.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Glycine max]
Length=479

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  177  AASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  356
            AASRRLRDLQS  GNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM
Sbjct  3    AASRRLRDLQSSAGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  62

Query  357  DSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWR  536
            DSWS+IQ++KME GGND  N+F++QY +PKETDIVTKYNT AASVYR+RIQA+A+G+PWR
Sbjct  63   DSWSDIQIKKMEAGGNDKLNAFLAQYSIPKETDIVTKYNTNAASVYRNRIQAIAEGRPWR  122

Query  537  DPPVVKETLKGG  572
            DPPVVKE L  G
Sbjct  123  DPPVVKENLSAG  134



>ref|XP_004495006.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like isoform X1 [Cicer arietinum]
Length=482

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLR+LQSQPGNKICVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRELQSQPGNKICVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MD+WS+IQ++KME GGNDN N+F+++Y + KETDI+TKYNT AASVYRDRIQA+A+G+ W
Sbjct  61   MDAWSDIQIKKMEAGGNDNLNAFLARYSISKETDIITKYNTNAASVYRDRIQAIAEGRSW  120

Query  534  RDPPVVKETLKGG  572
            RDPPVVKE +  G
Sbjct  121  RDPPVVKENVAAG  133



>ref|XP_010922379.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Elaeis guineensis]
Length=452

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  183  SRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDS  362
            SRRLR+LQSQ GNK CVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDS
Sbjct  7    SRRLRELQSQAGNKTCVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDS  66

Query  363  WSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDP  542
            WSEIQL+KME GGND  N+F++QYGVPK TDIV KYNTKAA+VYRDRIQALA+G+PW+DP
Sbjct  67   WSEIQLKKMEAGGNDRLNAFLAQYGVPKGTDIVAKYNTKAAAVYRDRIQALAEGRPWQDP  126

Query  543  PVVKETL  563
            PVVKETL
Sbjct  127  PVVKETL  133



>ref|XP_010509321.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Camelina sativa]
Length=456

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLR LQSQP NK+CVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARRLRTLQSQPENKVCVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KM+ GGND  N F++QYG+ KETDI++KYN+ AASVYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMDAGGNDCLNKFLAQYGISKETDIISKYNSNAASVYRDRIQALAEGRQW  120

Query  534  RDPPVVKETLKGG  572
            RDPPVVKE++ GG
Sbjct  121  RDPPVVKESVGGG  133



>ref|XP_006410942.1| hypothetical protein EUTSA_v10016645mg [Eutrema salsugineum]
 gb|ESQ52395.1| hypothetical protein EUTSA_v10016645mg [Eutrema salsugineum]
Length=453

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLR LQSQP NK+CVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARRLRTLQSQPENKVCVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N F++QYG+ KETDIV KYN+ AASVYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMEAGGNERLNKFLAQYGISKETDIVAKYNSNAASVYRDRIQALAEGRQW  120

Query  534  RDPPVVKETLKGGA  575
            RDPPVVKE+  GG 
Sbjct  121  RDPPVVKESNGGGG  134



>ref|XP_009402324.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Musa acuminata subsp. malaccensis]
Length=459

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  177  AASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  356
            +ASRRLR LQSQPGNK CVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM
Sbjct  5    SASRRLRQLQSQPGNKTCVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  64

Query  357  DSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWR  536
            DSWSEIQL+KME GGND  N+F+++YGVPKETDIV KYNT+ A+VYRDRIQALA+G+ W+
Sbjct  65   DSWSEIQLKKMEAGGNDRLNAFLARYGVPKETDIVAKYNTRGAAVYRDRIQALAEGRSWQ  124

Query  537  DPPVVKETLKGGA  575
            DP +VKE+L  GA
Sbjct  125  DPSIVKESLNSGA  137



>ref|XP_010427029.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Camelina sativa]
Length=468

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MA +R+LR LQSQP NK+CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MATARQLRSLQSQPENKVCVDCAQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N F +QYG+ KETDI++KYN+ AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNERLNKFFAQYGIAKETDIISKYNSNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKGGA  575
            +DPPVVKE++ GGA
Sbjct  121  KDPPVVKESVGGGA  134



>ref|XP_010937673.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Elaeis guineensis]
Length=464

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            ASRRLR+LQ+QPGNK CVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  5    ASRRLRELQAQPGNKTCVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  64

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SWSEIQL+KME GGND  N F++QYGVPKETDI  KYNT AA+VYRDRIQALA+G+ WRD
Sbjct  65   SWSEIQLKKMEAGGNDRLNGFLAQYGVPKETDIPAKYNTNAAAVYRDRIQALAEGRAWRD  124

Query  540  PPVVKETL  563
            PPVVKE+L
Sbjct  125  PPVVKESL  132



>ref|XP_010505344.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Camelina sativa]
Length=459

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLR LQSQP NK+CVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARRLRTLQSQPENKVCVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KM+ GGND  N F++QYG+ KETDI+ KYN+ AASVYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMDAGGNDCLNKFLAQYGISKETDIIAKYNSNAASVYRDRIQALAEGRQW  120

Query  534  RDPPVVKETLKGGA  575
            RDPPVVKE++ GG 
Sbjct  121  RDPPVVKESVGGGG  134



>ref|XP_010517025.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Camelina sativa]
Length=460

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLR LQSQP NK+CVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARRLRTLQSQPENKVCVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KM+ GGND  N F++QYG+ KETDI+ KYN+ AASVYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMDAGGNDCLNKFLAQYGISKETDIIAKYNSNAASVYRDRIQALAEGRQW  120

Query  534  RDPPVVKETLKGGA  575
            RDPPVVKE++ GG 
Sbjct  121  RDPPVVKESVGGGG  134



>ref|XP_004253319.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Solanum lycopersicum]
Length=437

 Score =   241 bits (615),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLR LQSQP NK+CVDCSQKNPQWAS+SYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARRLRTLQSQPENKVCVDCSQKNPQWASISYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KM+ GGN+  N+F++QYG+ KETDI++KYN+ AASVYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMDAGGNERLNNFLAQYGISKETDIISKYNSNAASVYRDRIQALAEGRQW  120

Query  534  RDPPVVKETLKGG  572
            RDPP+VKE++ GG
Sbjct  121  RDPPIVKESVGGG  133



>ref|XP_006403662.1| hypothetical protein EUTSA_v10010333mg [Eutrema salsugineum]
 gb|ESQ45115.1| hypothetical protein EUTSA_v10010333mg [Eutrema salsugineum]
Length=476

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+R+LR LQSQP NK+CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARQLRTLQSQPDNKVCVDCAQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N F++QYG+ KETDI++KYN+ AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNERLNKFLAQYGIRKETDIISKYNSNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
            RDPPVVKET+
Sbjct  121  RDPPVVKETI  130



>ref|XP_002881515.1| hypothetical protein ARALYDRAFT_482750 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57774.1| hypothetical protein ARALYDRAFT_482750 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLR LQSQP NK+CVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARRLRTLQSQPENKVCVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KM+ GGN+  N F++QYG+ KETDI++KYN+ AASVYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMDAGGNERLNKFLAQYGISKETDIISKYNSNAASVYRDRIQALAEGRQW  120

Query  534  RDPPVVKETLKGGA  575
            RDPP+VKE++ GG 
Sbjct  121  RDPPIVKESVGGGG  134



>gb|ABD32193.1| Arf GTPase activating protein [Medicago truncatula]
 gb|ACJ85591.1| unknown [Medicago truncatula]
 gb|AFK49050.1| unknown [Medicago truncatula]
 gb|AES81716.2| ADP-ribosylation factor GTPase-activating protein AGD10 [Medicago 
truncatula]
Length=443

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLR+LQS+P NKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRELQSEPSNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWS++Q++KME GGN N N+F+SQYG+ KETDI+TKYN+ AAS+YRDRIQA+A+G+ W
Sbjct  61   MDSWSDLQIKKMEAGGNRNLNTFLSQYGISKETDIITKYNSNAASIYRDRIQAIAEGRSW  120

Query  534  RDPPVVKE  557
            RDPPVVKE
Sbjct  121  RDPPVVKE  128



>ref|NP_181291.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Arabidopsis 
thaliana]
 ref|NP_001031503.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Arabidopsis 
thaliana]
 sp|O80925.1|AGD7_ARATH RecName: Full=ADP-ribosylation factor GTPase-activating protein 
AGD7; Short=ARF GAP AGD7; AltName: Full=Protein ARF-GAP DOMAIN 
7; Short=AtAGD7; AltName: Full=Protein PDE1 SUPPRESSOR 
1 [Arabidopsis thaliana]
 gb|AAL32010.1|AF436828_1 At2g37550/F13M22.5 [Arabidopsis thaliana]
 gb|AAC23626.1| putative ADP ribosylation factor 1 GTPase activating protein 
[Arabidopsis thaliana]
 dbj|BAA75744.1| Asp1 [Arabidopsis thaliana]
 gb|AAK59488.1| putative ADP ribosylation factor 1 GTPase activating protein 
[Arabidopsis thaliana]
 gb|AAL34251.1| putative ADP ribosylation factor 1 GTPase activating protein 
[Arabidopsis thaliana]
 gb|AAM65362.1| At2g37550/F13M22.5 [Arabidopsis thaliana]
 gb|AEC09414.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Arabidopsis 
thaliana]
 gb|AEC09415.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Arabidopsis 
thaliana]
Length=456

 Score =   241 bits (615),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLR LQSQP NK+CVDCSQKNPQWAS+SYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARRLRTLQSQPENKVCVDCSQKNPQWASISYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KM+ GGN+  N+F++QYG+ KETDI++KYN+ AASVYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMDAGGNERLNNFLAQYGISKETDIISKYNSNAASVYRDRIQALAEGRQW  120

Query  534  RDPPVVKETLKGG  572
            RDPP+VKE++ GG
Sbjct  121  RDPPIVKESVGGG  133



>gb|KJB36746.1| hypothetical protein B456_006G174500 [Gossypium raimondii]
Length=319

 Score =   237 bits (604),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            M A RRL  LQSQPGNK CVDCSQ+NP WASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MVAMRRLSFLQSQPGNKTCVDCSQRNPTWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  NSF++Q+G+PKETDIVTKYN+ AA VYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMESGGNERLNSFLAQHGIPKETDIVTKYNSNAAGVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKG  569
            +DPP+V+ETL G
Sbjct  121  QDPPLVRETLNG  132



>ref|XP_004493890.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Cicer arietinum]
Length=433

 Score =   240 bits (613),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLR+LQS+  NKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRELQSEALNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSE+Q++KME GGN N NSF++QYG+PKETDI+TKYN+ AAS+YRDRIQA+A+G+ W
Sbjct  61   MDSWSELQIKKMESGGNRNLNSFLAQYGIPKETDIITKYNSNAASIYRDRIQAIAEGRSW  120

Query  534  RDPPVVKE  557
            RDPPVVKE
Sbjct  121  RDPPVVKE  128



>gb|KJB36745.1| hypothetical protein B456_006G174500 [Gossypium raimondii]
Length=289

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            M A RRL  LQSQPGNK CVDCSQ+NP WASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MVAMRRLSFLQSQPGNKTCVDCSQRNPTWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  NSF++Q+G+PKETDIVTKYN+ AA VYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMESGGNERLNSFLAQHGIPKETDIVTKYNSNAAGVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKG  569
            +DPP+V+ETL G
Sbjct  121  QDPPLVRETLNG  132



>ref|XP_006294027.1| hypothetical protein CARUB_v10023020mg, partial [Capsella rubella]
 ref|XP_006294028.1| hypothetical protein CARUB_v10023020mg, partial [Capsella rubella]
 gb|EOA26925.1| hypothetical protein CARUB_v10023020mg, partial [Capsella rubella]
 gb|EOA26926.1| hypothetical protein CARUB_v10023020mg, partial [Capsella rubella]
Length=516

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  162  RSKRMAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFV  341
            R+  MAA+RRLR LQSQP NK+CVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFV
Sbjct  56   RTGIMAAARRLRALQSQPENKVCVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFV  115

Query  342  RSVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            RSVTMDSWSEIQ++KM++GGN+  N F++QYG+ KETD++ KYN+ AASVYRDRIQALA+
Sbjct  116  RSVTMDSWSEIQIKKMDVGGNECLNKFLAQYGIAKETDVIAKYNSNAASVYRDRIQALAE  175

Query  522  GKPWRDPPVVKETLKGGA  575
            G+ WRDPPVVKE++ GG 
Sbjct  176  GRQWRDPPVVKESVGGGG  193



>ref|XP_003625498.1| ADP-ribosylation factor GTPase-activating protein [Medicago truncatula]
Length=474

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAASRRLR+LQS+P NKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAASRRLRELQSEPSNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWS++Q++KME GGN N N+F+SQYG+ KETDI+TKYN+ AAS+YRDRIQA+A+G+ W
Sbjct  61   MDSWSDLQIKKMEAGGNRNLNTFLSQYGISKETDIITKYNSNAASIYRDRIQAIAEGRSW  120

Query  534  RDPPVVKE  557
            RDPPVVKE
Sbjct  121  RDPPVVKE  128



>ref|XP_010907061.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Elaeis guineensis]
Length=459

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            ASRRLR+LQ Q GNK CVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  5    ASRRLRELQYQAGNKTCVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  64

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SW++IQL+KME GGND  N+F+SQYGVPK+TDIV KYN KAA+VYRDRIQALA+G+PW+D
Sbjct  65   SWTDIQLKKMEAGGNDRLNAFLSQYGVPKDTDIVVKYNIKAAAVYRDRIQALAEGRPWQD  124

Query  540  PPVVKETL  563
            PPVVKETL
Sbjct  125  PPVVKETL  132



>ref|XP_010504141.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Camelina sativa]
Length=467

 Score =   239 bits (609),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+R+LR LQSQP NK+CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARQLRSLQSQPENKVCVDCAQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N F +QYG+ KETDI++KYN+ AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNERLNKFFAQYGIAKETDIISKYNSNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
            +DPPVVKE +
Sbjct  121  KDPPVVKEAV  130



>ref|XP_009116065.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Brassica rapa]
Length=454

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  177  AASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  356
            AA+R+LR LQSQP NK+CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVTM
Sbjct  3    AAARKLRTLQSQPDNKVCVDCAQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVTM  62

Query  357  DSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWR  536
            DSWSEIQ++KME GGN+  NSF++QYG+ KETDIV+KYN+ AA+VYR+RIQALA+GKPW 
Sbjct  63   DSWSEIQIKKMEAGGNERLNSFLAQYGIAKETDIVSKYNSNAAAVYRNRIQALAEGKPWS  122

Query  537  DPPVVKETLKG  569
            DPPVVKE + G
Sbjct  123  DPPVVKEAVGG  133



>ref|XP_010678052.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Beta vulgaris subsp. vulgaris]
Length=471

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +3

Query  177  AASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  356
             ASRRLRDLQSQ GNK CVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVTM
Sbjct  3    GASRRLRDLQSQSGNKTCVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVTM  62

Query  357  DSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWR  536
            DSWSEIQL+KME GGND  N+F SQYG+PKETDIV KYN+ AASVYR+RI ALA+G+ WR
Sbjct  63   DSWSEIQLKKMESGGNDKLNAFFSQYGIPKETDIVPKYNSNAASVYRERISALAEGRSWR  122

Query  537  DPPVVKET  560
            DPPVVKE+
Sbjct  123  DPPVVKES  130



>gb|KJB36744.1| hypothetical protein B456_006G174500 [Gossypium raimondii]
Length=445

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            M A RRL  LQSQPGNK CVDCSQ+NP WASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MVAMRRLSFLQSQPGNKTCVDCSQRNPTWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  NSF++Q+G+PKETDIVTKYN+ AA VYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMESGGNERLNSFLAQHGIPKETDIVTKYNSNAAGVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKG  569
            +DPP+V+ETL G
Sbjct  121  QDPPLVRETLNG  132



>ref|XP_002877936.1| hypothetical protein ARALYDRAFT_485760 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54195.1| hypothetical protein ARALYDRAFT_485760 [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+R+LR LQSQP NK+CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARQLRTLQSQPENKVCVDCAQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N F +QYG+ KETDI++KYN+ AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMEAGGNERLNKFFAQYGIAKETDIISKYNSNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLK  566
             DPPVVKE  K
Sbjct  121  NDPPVVKEANK  131



>emb|CDX79739.1| BnaC03g20750D [Brassica napus]
Length=453

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLR LQSQP NK+CVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARRLRTLQSQPENKVCVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N F++ YGV KETDIV+KYN+ AASVYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMESGGNERLNKFLALYGVSKETDIVSKYNSNAASVYRDRIQALAEGRQW  120

Query  534  RDPPVVKETL  563
            RDPPVVKE++
Sbjct  121  RDPPVVKESV  130



>gb|KJB36743.1| hypothetical protein B456_006G174500 [Gossypium raimondii]
Length=449

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            M A RRL  LQSQPGNK CVDCSQ+NP WASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MVAMRRLSFLQSQPGNKTCVDCSQRNPTWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  NSF++Q+G+PKETDIVTKYN+ AA VYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMESGGNERLNSFLAQHGIPKETDIVTKYNSNAAGVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKG  569
            +DPP+V+ETL G
Sbjct  121  QDPPLVRETLNG  132



>ref|XP_010515873.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Camelina sativa]
Length=467

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+R+LR LQSQP NK+CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARQLRSLQSQPENKVCVDCAQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMEL-GGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKP  530
            MDSWSEIQ++KME  GGN+  N F +QYG+ KETDI++KYN+ AASVYRDRIQALA+G+P
Sbjct  61   MDSWSEIQIKKMEAGGGNERLNKFFAQYGIAKETDIISKYNSNAASVYRDRIQALAEGRP  120

Query  531  WRDPPVVKETLKGGA  575
            W+DPPVVKE + GG 
Sbjct  121  WKDPPVVKEAVGGGG  135



>gb|KHF98429.1| ADP-ribosylation factor GTPase-activating AGD7 -like protein 
[Gossypium arboreum]
Length=461

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            M A RRL  LQSQPGNK CVDCSQ+NP WASVSYGVFMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MVAMRRLSVLQSQPGNKTCVDCSQRNPTWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  NSF++QYG+PKETDIVTKYN+ AA VYRDRIQALA+G+PW
Sbjct  61   MDSWSEIQIKKMESGGNERLNSFLAQYGIPKETDIVTKYNSNAAGVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLKG  569
            +DP +V+ETL G
Sbjct  121  QDPALVRETLNG  132



>ref|XP_006291063.1| hypothetical protein CARUB_v10017178mg [Capsella rubella]
 gb|EOA23961.1| hypothetical protein CARUB_v10017178mg [Capsella rubella]
Length=468

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+R+LR LQSQP NK+CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARQLRTLQSQPENKVCVDCAQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWS IQ++KME GGN+  N+F +QYG+ KETDI++KYN+ AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSAIQIKKMEAGGNERLNNFFAQYGIAKETDIISKYNSNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETL  563
            RDPPVVKE +
Sbjct  121  RDPPVVKEAI  130



>emb|CDX78196.1| BnaA09g33910D [Brassica napus]
Length=445

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  177  AASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  356
            AA+R+LR LQSQP NK+CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVTM
Sbjct  3    AAARKLRTLQSQPDNKVCVDCAQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVTM  62

Query  357  DSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWR  536
            DSWSEIQ++KME GGN+  NSF++QYG+ KETDIV+KYN+ AA+VYR+R+QALA+GKPW 
Sbjct  63   DSWSEIQIKKMEAGGNERLNSFLAQYGIAKETDIVSKYNSNAAAVYRNRVQALAEGKPWS  122

Query  537  DPPVVKETLK  566
            DPPVVKE  K
Sbjct  123  DPPVVKEAKK  132



>emb|CDY30849.1| BnaC04g27040D [Brassica napus]
Length=448

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+R+LR LQS P NK+CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARQLRALQSHPENKVCVDCAQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  NSF+SQYG+ KETDI++KYN+ AASVYRDRIQALA+GK W
Sbjct  61   MDSWSEIQIKKMEAGGNERLNSFLSQYGIAKETDIISKYNSNAASVYRDRIQALAEGKAW  120

Query  534  RDPPVVKETL  563
             DPPVVKE +
Sbjct  121  SDPPVVKEGV  130



>ref|NP_190939.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Arabidopsis thaliana]
 ref|NP_001030854.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Arabidopsis thaliana]
 sp|Q9M354.1|AGD6_ARATH RecName: Full=Probable ADP-ribosylation factor GTPase-activating 
protein AGD6; Short=ARF GAP AGD6; AltName: Full=Protein 
ARF-GAP DOMAIN 6; Short=AtAGD6; AltName: Full=Protein ZIGA2 
[Arabidopsis thaliana]
 emb|CAB88333.1| putative protein [Arabidopsis thaliana]
 gb|ABO45696.1| At3g53710 [Arabidopsis thaliana]
 gb|AEE79130.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Arabidopsis thaliana]
 gb|AEE79131.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Arabidopsis thaliana]
Length=459

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+R+LR LQSQP NK+CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATRQLRTLQSQPENKVCVDCAQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWS IQ++KME GGN+  N F +QYG+ KETDI++KYN+ AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSAIQIKKMEAGGNERLNKFFAQYGIAKETDIISKYNSNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLK  566
             DPPVVKE  K
Sbjct  121  NDPPVVKEANK  131



>emb|CDY07784.1| BnaA03g17270D [Brassica napus]
Length=433

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLR LQSQ  NK+CVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARRLRTLQSQAENKVCVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N F++ YG+ KETDIV KYN+ AASVYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMESGGNERLNKFLALYGISKETDIVAKYNSNAASVYRDRIQALAEGRQW  120

Query  534  RDPPVVKETL  563
            RDPPVVKE++
Sbjct  121  RDPPVVKESV  130



>gb|AAG17006.1|AF184146_1 ARF GAP-like zinc finger-containing protein ZIGA2, partial [Arabidopsis 
thaliana]
Length=458

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+R+LR LQSQP NK+CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATRQLRTLQSQPENKVCVDCAQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWS IQ++KME GGN+  N F +QYG+ KETDI++KYN+ AASVYRDRIQALA+G+PW
Sbjct  61   MDSWSAIQIKKMEAGGNERLNKFFAQYGIAKETDIISKYNSNAASVYRDRIQALAEGRPW  120

Query  534  RDPPVVKETLK  566
             DPPVVKE  K
Sbjct  121  NDPPVVKEANK  131



>emb|CDX73533.1| BnaC08g24700D [Brassica napus]
Length=446

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = +3

Query  177  AASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  356
            AA+R+LR LQSQP NK+CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVTM
Sbjct  3    AAARKLRTLQSQPDNKVCVDCAQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVTM  62

Query  357  DSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADG-KPW  533
            DSWSEIQ++KME GGN+  NSF++QYG+ KETDIV+KYN+ AASVYR+RIQALA+G KPW
Sbjct  63   DSWSEIQIKKMEAGGNERLNSFLAQYGIAKETDIVSKYNSNAASVYRNRIQALAEGSKPW  122

Query  534  RDPPVVKETLKG  569
             DPPVVKE + G
Sbjct  123  SDPPVVKEAVGG  134



>ref|XP_009409527.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Musa acuminata subsp. malaccensis]
Length=509

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +3

Query  177  AASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  356
            +A+RRLR++QS+ GN+ CVDC+QKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM
Sbjct  5    SATRRLREIQSRTGNRTCVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  64

Query  357  DSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWR  536
            D+WSE QL+KME GGND  N F++Q GVPKETDIV KYNT+AA+VYRD+I A+ADG+PWR
Sbjct  65   DAWSEAQLKKMEAGGNDRLNGFLAQCGVPKETDIVVKYNTQAAAVYRDQIAAVADGRPWR  124

Query  537  DPPVVKETLKGGA  575
            DPPVVKETL  GA
Sbjct  125  DPPVVKETLGSGA  137



>ref|XP_009133186.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
 ref|XP_009133187.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
 ref|XP_009133188.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
 ref|XP_009133190.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
Length=477

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLR LQSQ  NK+CVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARRLRTLQSQAENKVCVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N F++ YG+ KETDIV KYN+ AASVYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMESGGNERLNKFLALYGISKETDIVAKYNSNAASVYRDRIQALAEGRQW  120

Query  534  RDPPVVKETL  563
            RDPPVVKE++
Sbjct  121  RDPPVVKESV  130



>ref|XP_009139382.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Brassica rapa]
 emb|CDX76193.1| BnaA04g04570D [Brassica napus]
Length=451

 Score =   233 bits (595),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+R+LR LQS P NK+CVDC+QKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARQLRALQSHPENKVCVDCAQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN   NSF+SQYG+ KETDI++KYN+ AASVYRDRIQALA+GK W
Sbjct  61   MDSWSEIQIKKMEAGGNARLNSFLSQYGIAKETDIISKYNSNAASVYRDRIQALAEGKAW  120

Query  534  RDPPVVKETL  563
             DPPVVKE +
Sbjct  121  SDPPVVKEGV  130



>ref|XP_009386541.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Musa acuminata subsp. malaccensis]
Length=449

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +3

Query  183  SRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDS  362
            SRRLR LQSQPGNK CVDC+QKNPQWASVSYGVF+CLECSGKHRGLGVHISFVRSVTMDS
Sbjct  7    SRRLRQLQSQPGNKSCVDCAQKNPQWASVSYGVFICLECSGKHRGLGVHISFVRSVTMDS  66

Query  363  WSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDP  542
            WSEIQL+KME GGND  N+F++ YGV +ETDIV KYNT+AA+VYR+RI ALA+G+PW DP
Sbjct  67   WSEIQLKKMEAGGNDRLNAFLAGYGVSRETDIVPKYNTRAAAVYRERILALAEGRPWTDP  126

Query  543  PVVKETLKGGA  575
            PVVKET   GA
Sbjct  127  PVVKETPDAGA  137



>ref|XP_002984338.1| hypothetical protein SELMODRAFT_445864 [Selaginella moellendorffii]
 gb|EFJ14388.1| hypothetical protein SELMODRAFT_445864 [Selaginella moellendorffii]
Length=456

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 121/134 (90%), Gaps = 2/134 (1%)
 Frame = +3

Query  165  SKRMAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            S+++AA  + R+LQSQPGNK CVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR
Sbjct  3    SRQVAA--KFRELQSQPGNKTCVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADG  524
            SV+MDSWSEIQLRKME GGND  N F+++YG+PKET+IV KYN++AA VYR++IQALA+G
Sbjct  61   SVSMDSWSEIQLRKMEAGGNDALNRFLAEYGIPKETEIVAKYNSRAAEVYREKIQALAEG  120

Query  525  KPWRDPPVVKETLK  566
            + W  PPVVKETLK
Sbjct  121  RSWNAPPVVKETLK  134



>ref|XP_002972763.1| hypothetical protein SELMODRAFT_441959 [Selaginella moellendorffii]
 gb|EFJ25984.1| hypothetical protein SELMODRAFT_441959 [Selaginella moellendorffii]
Length=457

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 121/134 (90%), Gaps = 2/134 (1%)
 Frame = +3

Query  165  SKRMAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            S+++AA  + R+LQSQPGNK CVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR
Sbjct  3    SRQVAA--KFRELQSQPGNKTCVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADG  524
            SV+MDSWSEIQLRKME GGND  N F+++YG+PKET+IV KYN++AA VYR++IQALA+G
Sbjct  61   SVSMDSWSEIQLRKMEAGGNDALNRFLAEYGIPKETEIVAKYNSRAAEVYREKIQALAEG  120

Query  525  KPWRDPPVVKETLK  566
            + W  PPVVKET+K
Sbjct  121  RSWNAPPVVKETVK  134



>emb|CDY18435.1| BnaA04g21520D [Brassica napus]
Length=422

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA++RLR LQSQP NK+CVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATQRLRALQSQPENKVCVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQL+KM+ GGN   N+F+S +G+ KET+IV KY++ AASVYRDRIQ LA+G+PW
Sbjct  61   MDSWSEIQLKKMDSGGNHKLNTFLSLHGISKETEIVAKYSSDAASVYRDRIQTLAEGRPW  120

Query  534  RDPPVV  551
            RDPPV 
Sbjct  121  RDPPVA  126



>ref|NP_001150760.1| DNA binding protein [Zea mays]
 gb|ACG40254.1| DNA binding protein [Zea mays]
Length=453

 Score =   225 bits (574),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            A+RRLR+LQ+Q GNK CVDC+Q+NPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  5    AARRLRELQAQTGNKTCVDCAQRNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  64

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SW+E QLRKME GGND  N+F++  GVPKET  V KYN+ AA+ YRDRI ALA+GKPW D
Sbjct  65   SWTEAQLRKMEAGGNDRLNAFLTARGVPKETSHVAKYNSNAAAAYRDRIAALAEGKPWTD  124

Query  540  PPVVKETLKGGA  575
            PPVVKET   GA
Sbjct  125  PPVVKETPGSGA  136



>emb|CDY69342.1| BnaCnng63080D [Brassica napus]
Length=438

 Score =   225 bits (573),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+RRLR LQSQP NK+CVDCSQKNPQWAS+SYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAARRLRTLQSQPENKVCVDCSQKNPQWASISYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  NSF++QYG+ KET+I  KYN+ AASVYRDRIQALA+G+ W
Sbjct  61   MDSWSEIQIKKMESGGNETLNSFLAQYGIAKETEIAAKYNSNAASVYRDRIQALAEGRQW  120

Query  534  RD  539
            RD
Sbjct  121  RD  122



>ref|XP_004984751.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Setaria italica]
Length=455

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            A+RRLR+LQ+Q GNK CVDC+Q+NPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  5    AARRLRELQAQAGNKTCVDCAQRNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  64

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SW+E QLRKME GGND  N+F++  GVPKET  V KYN+ AA+ YRDRI ALA+G+PW D
Sbjct  65   SWTEAQLRKMEAGGNDRLNAFLTARGVPKETPHVAKYNSNAAAAYRDRIAALAEGRPWTD  124

Query  540  PPVVKETLKGGA  575
            PPVVKET   GA
Sbjct  125  PPVVKETPGSGA  136



>ref|XP_008654261.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Zea mays]
 tpg|DAA44701.1| TPA: putative ARF GTPase-activating domain family protein [Zea 
mays]
Length=454

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            A+RRLR+LQ+Q GNK CVDC+Q+NPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  5    AARRLRELQAQTGNKTCVDCAQRNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  64

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SW+E QLRKME GGND  N+F++  GVPKET  V KYN+ AA+ YRDRI ALA+GKPW D
Sbjct  65   SWTEAQLRKMEAGGNDRLNAFLTARGVPKETPHVAKYNSNAAAAYRDRIAALAEGKPWTD  124

Query  540  PPVVKETLKGGA  575
            PPVVKET   GA
Sbjct  125  PPVVKETPGSGA  136



>ref|XP_009141672.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
Length=450

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA++RLR LQSQP NK+CVDCSQKNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAATQRLRALQSQPENKVCVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQL+KM+ GGN   N+F+S +G+ KET+IV KY++ AASVYRDRIQ LA+G+PW
Sbjct  61   MDSWSEIQLKKMDSGGNHKLNTFLSLHGISKETEIVAKYSSDAASVYRDRIQTLAEGRPW  120

Query  534  RDPPVV  551
            RDPPV 
Sbjct  121  RDPPVA  126



>ref|XP_002465464.1| hypothetical protein SORBIDRAFT_01g039320 [Sorghum bicolor]
 gb|EER92462.1| hypothetical protein SORBIDRAFT_01g039320 [Sorghum bicolor]
Length=457

 Score =   223 bits (568),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            A+RRLR+LQ+Q GNK CVDC+Q+NPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  5    AARRLRELQAQAGNKTCVDCAQRNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  64

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SW+E QLRKME GGND  N+F++  GV KET  V KYN+ AA+VYRDRI ALA+GKPW D
Sbjct  65   SWTEAQLRKMEAGGNDRLNAFLTARGVTKETPHVAKYNSNAAAVYRDRIAALAEGKPWTD  124

Query  540  PPVVKETLKGGA  575
            PPVVKET   GA
Sbjct  125  PPVVKETPGSGA  136



>ref|XP_009143481.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Brassica rapa]
 ref|XP_009143482.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Brassica rapa]
Length=476

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+ RLR LQSQP NK+CVDCSQKNPQWAS+SYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAAIRLRTLQSQPENKVCVDCSQKNPQWASISYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N F++QYG+ KET+IV KYN+ AASVYRDRIQA+A+G+ W
Sbjct  61   MDSWSEIQIKKMESGGNERLNGFLAQYGIAKETEIVAKYNSNAASVYRDRIQAVAEGRQW  120

Query  534  RDP  542
            RDP
Sbjct  121  RDP  123



>ref|NP_001049726.1| Os03g0278400 [Oryza sativa Japonica Group]
 gb|ABF95284.1| ARF GAP-like zinc finger-containing protein ZIGA2, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11640.1| Os03g0278400 [Oryza sativa Japonica Group]
 gb|EAZ26458.1| hypothetical protein OsJ_10347 [Oryza sativa Japonica Group]
 dbj|BAG91743.1| unnamed protein product [Oryza sativa Japonica Group]
Length=453

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            A+RRLR+LQ Q GNK CVDC+Q+NPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  5    AARRLRELQGQAGNKTCVDCAQRNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  64

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SW+E QLRKME GGND  N+F++  GVPKET  V KYN+ AA+ YRDRI A+A+G+PW D
Sbjct  65   SWTEAQLRKMEAGGNDRLNAFLAARGVPKETPHVAKYNSNAAAAYRDRIVAVAEGRPWTD  124

Query  540  PPVVKETLKGGA  575
            PPVVKET   GA
Sbjct  125  PPVVKETPGSGA  136



>gb|EAY89468.1| hypothetical protein OsI_11000 [Oryza sativa Indica Group]
Length=454

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            A+RRLR+LQ Q GNK CVDC+Q+NPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  5    AARRLRELQGQAGNKTCVDCAQRNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  64

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SW+E QLRKME GGND  N+F++  GVPKET  V KYN+ AA+ YRDRI A+A+G+PW D
Sbjct  65   SWTEAQLRKMEAGGNDRLNAFLAARGVPKETPHVAKYNSNAAAAYRDRIVAVAEGRPWTD  124

Query  540  PPVVKETLKGGA  575
            PPVVKET   GA
Sbjct  125  PPVVKETPGSGA  136



>dbj|BAJ88349.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=467

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            A+RRLR+LQ QPGNK CVDC+Q+NPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  5    AARRLRELQGQPGNKTCVDCAQRNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  64

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SW+E QLRKME GGND  N+F++  GVPKET  + KYN+ AA+ YRDRI ALA+G+ W D
Sbjct  65   SWTEPQLRKMEAGGNDRLNAFLAARGVPKETPHIPKYNSNAAAAYRDRIIALAEGRAWTD  124

Query  540  PPVVKET  560
            PPVVKET
Sbjct  125  PPVVKET  131



>ref|XP_001772457.1| predicted protein [Physcomitrella patens]
 gb|EDQ62739.1| predicted protein [Physcomitrella patens]
Length=567

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +3

Query  177  AASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  356
            AA+ +LR+LQSQPGNK+CVDCSQ+NPQWASVSYG+FMCLECSGKHRGLGVHISFVRSV+M
Sbjct  101  AAAAKLRELQSQPGNKVCVDCSQRNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVSM  160

Query  357  DSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWR  536
            DSWSEIQL+KM+ GGN   NSF+++YG+ KETDIV KYN++AAS+YR++IQALA+G+ W 
Sbjct  161  DSWSEIQLKKMQAGGNAALNSFLAEYGIAKETDIVAKYNSRAASIYREKIQALAEGRSWN  220

Query  537  DPPVVKET  560
             PPV +E+
Sbjct  221  APPVSRES  228



>ref|XP_003558222.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Brachypodium distachyon]
Length=464

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            A+RRLR+LQ Q GNK CVDC+Q+NPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  5    AARRLRELQGQNGNKTCVDCAQRNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  64

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SW+E+QLRKME GGND  N+F++  GV KET  V KYN+ AA+ YRDRI ALA+G+PW D
Sbjct  65   SWTEVQLRKMEAGGNDRLNAFLAARGVSKETPHVPKYNSNAAAAYRDRIVALAEGRPWND  124

Query  540  PPVVKETLKGGA  575
            PPVVKET   G 
Sbjct  125  PPVVKETPGSGG  136



>emb|CDX74953.1| BnaA05g06990D [Brassica napus]
Length=452

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MAA+ RLR LQSQP NK+CVDCSQKNPQWAS+SYG+FMCLECSGKHRGLGVHISFVRSVT
Sbjct  1    MAAAIRLRTLQSQPENKVCVDCSQKNPQWASISYGIFMCLECSGKHRGLGVHISFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSWSEIQ++KME GGN+  N F+++YG+ KET+IV KYN+ AASVYRDRIQA+A+G+ W
Sbjct  61   MDSWSEIQIKKMESGGNERLNGFLARYGIAKETEIVAKYNSNAASVYRDRIQAVAEGRQW  120

Query  534  RD  539
            RD
Sbjct  121  RD  122



>gb|EMS46940.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Triticum urartu]
Length=482

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            A+RRLR+LQ QPGNK CVDC+Q+NPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  5    AARRLRELQGQPGNKTCVDCAQRNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  64

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SW+E QLRKME GGND  N+F++  GVPK+T  + KYN+ AA+ YRDRI ALA+G+ W D
Sbjct  65   SWTEPQLRKMEAGGNDRLNAFLTARGVPKDTPHIPKYNSNAAAAYRDRIVALAEGRAWTD  124

Query  540  PPVVKETLKGG  572
            PPVVKET   G
Sbjct  125  PPVVKETPGSG  135



>ref|XP_008671989.1| PREDICTED: LOW QUALITY PROTEIN: probable ADP-ribosylation factor 
GTPase-activating protein AGD6 [Zea mays]
Length=377

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = +3

Query  162  RSKRMAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFV  341
            R     A+RRL++LQ+Q GNK  VDC+Q+NPQWASVSYGVFMCLECSGKH+GLGVHISFV
Sbjct  69   RKSSSTAARRLQELQAQTGNKTXVDCAQRNPQWASVSYGVFMCLECSGKHQGLGVHISFV  128

Query  342  RSVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            RSVTMDSW+E QLRKME GGND  N+F++ +GVPKET  V KYN  AA+ YRD I +L +
Sbjct  129  RSVTMDSWTEAQLRKMEAGGNDRLNAFLTAWGVPKETSHVAKYNFNAATAYRDCIASLIE  188

Query  522  GKPWRDPPVVKETLKGGA  575
            GKPW DPPVVKET   GA
Sbjct  189  GKPWTDPPVVKETPGSGA  206



>ref|XP_006651253.1| PREDICTED: LOW QUALITY PROTEIN: probable ADP-ribosylation factor 
GTPase-activating protein AGD6-like, partial [Oryza brachyantha]
Length=447

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            A+RRLR+LQ QPGNK CVDC+Q+NPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  7    AARRLRELQGQPGNKTCVDCAQRNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  66

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            SW+E+QLRKME GGND  N+F++  GVPKET  V KYN+ AA+ YRDRI A+A+G+PW D
Sbjct  67   SWTEVQLRKMEAGGNDRLNAFLAARGVPKETPHVAKYNSNAAAAYRDRIVAVAEGRPWTD  126



>ref|XP_001761895.1| predicted protein [Physcomitrella patens]
 gb|EDQ73336.1| predicted protein [Physcomitrella patens]
Length=462

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +3

Query  177  AASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTM  356
            AA+ +LR+LQSQ GNK+CVDC Q+NPQWASVSYG+FMCLECSGKHRGLGVHISFVRSV+M
Sbjct  5    AAAAKLRELQSQAGNKVCVDCPQRNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVSM  64

Query  357  DSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWR  536
            DSWSE+QL+KM+ GGN   N F  +YG+PK TDIV KYN++AAS+YR++IQAL + + W 
Sbjct  65   DSWSEMQLKKMQAGGNAALNGFFVEYGIPKGTDIVAKYNSRAASIYREKIQALVENRSWN  124

Query  537  DPPVVKET  560
             PPV KE+
Sbjct  125  APPVSKES  132



>ref|XP_009409624.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Musa acuminata subsp. malaccensis]
Length=423

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            RRL+ LQS+PGN  CVDC Q+NPQWAS+SYGVF+CL+CSGKHRGLGVH+SFVRSVTMDSW
Sbjct  15   RRLQALQSEPGNGACVDCGQRNPQWASISYGVFLCLDCSGKHRGLGVHLSFVRSVTMDSW  74

Query  366  SEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDPP  545
            ++ QLR+ME GGND  N+F+++  VP++ D  TKYN++AA+ YRD IQALADG+P +DPP
Sbjct  75   TDAQLRRMECGGNDRLNAFLARRRVPRDADPATKYNSRAAAAYRDCIQALADGRPSQDPP  134

Query  546  VVKE  557
            VVKE
Sbjct  135  VVKE  138



>ref|XP_010267329.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nelumbo nucifera]
Length=419

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 107/128 (84%), Gaps = 2/128 (2%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            ASRRLR LQS P N+ CVDC QKNPQWASVS+GVFMCL+CSGKHR LGVHISFVRSVTMD
Sbjct  9    ASRRLRQLQSLPANRTCVDCLQKNPQWASVSFGVFMCLDCSGKHRSLGVHISFVRSVTMD  68

Query  360  SWSEIQLRKMEL--GGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            SW+E+ L+KME   GGN+  N+F +  G+PKETDI  KYNT AA+++R++IQA+ + +PW
Sbjct  69   SWTELHLKKMEANPGGNEALNAFFTARGIPKETDITIKYNTTAATLFREKIQAIVENRPW  128

Query  534  RDPPVVKE  557
             +PP++KE
Sbjct  129  TEPPIIKE  136



>ref|XP_009381844.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Musa acuminata subsp. malaccensis]
Length=421

 Score =   199 bits (505),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  204  QSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQLR  383
            QS+PGN  CVDC Q+NPQWASVSYGVF+CLECSGKHRGLGVH+SFVRSVTMDSW+E QLR
Sbjct  17   QSEPGNGTCVDCRQRNPQWASVSYGVFICLECSGKHRGLGVHLSFVRSVTMDSWTEPQLR  76

Query  384  KMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDPPVVKETL  563
            +ME GGND  N+F+++ GV +  ++  KY++ AA+VYRDRIQALA+G+PW+DPPVVKE+ 
Sbjct  77   RMECGGNDRLNAFLARRGVHRGVNVTAKYSSGAAAVYRDRIQALAEGRPWKDPPVVKEST  136

Query  564  K  566
            +
Sbjct  137  E  137



>ref|XP_010100237.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Morus 
notabilis]
 gb|EXB82157.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Morus 
notabilis]
Length=166

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            M ASRRLRDLQSQP NKICVDCSQKNP WASVSYGVFMCLECSGKHR LGVHISFVRS+T
Sbjct  1    MVASRRLRDLQSQPWNKICVDCSQKNPPWASVSYGVFMCLECSGKHRDLGVHISFVRSIT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNT  476
            MDSWSEIQ++KME G ND  N+F++QY +PKETDIVTKYNT
Sbjct  61   MDSWSEIQIKKMESGSNDKLNAFLAQYDIPKETDIVTKYNT  101



>emb|CBI23433.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = +3

Query  201  LQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQL  380
            LQS   NK CVDC QKNPQWASVSYG+FMCL+CSGKHRGLGVH+SFVRSVTMDSW +  L
Sbjct  19   LQSLSSNKTCVDCHQKNPQWASVSYGIFMCLDCSGKHRGLGVHLSFVRSVTMDSWPDSHL  78

Query  381  RKMEL--GGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDPPVVK  554
            +KME   GGND  N+F+S  G+PK+TDI  KYNT AA++YR+++QA+A+ + W +PPVVK
Sbjct  79   KKMEANSGGNDALNAFLSARGIPKDTDIPLKYNTNAAALYREKVQAIAENRRWTEPPVVK  138

Query  555  ETL  563
            E++
Sbjct  139  ESV  141



>emb|CAN72855.1| hypothetical protein VITISV_043217 [Vitis vinifera]
Length=432

 Score =   186 bits (471),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = +3

Query  201  LQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQL  380
            LQS   NK CVDC QKNPQWASVSYG+FMCL+CSGKHRGLGVH+SFVRSVTMDSW +  L
Sbjct  19   LQSLSSNKTCVDCHQKNPQWASVSYGIFMCLDCSGKHRGLGVHLSFVRSVTMDSWPDSHL  78

Query  381  RKMEL--GGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDPPVVK  554
            +KME   GGND  N+F+S  G+PK+TDI  KYNT AA++YR+++QA+A+ + W +PPVVK
Sbjct  79   KKMEANSGGNDALNAFLSARGIPKDTDIPLKYNTNAAALYREKVQAIAENRRWTEPPVVK  138

Query  555  ETL  563
            E++
Sbjct  139  ESV  141



>ref|XP_010646583.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Vitis vinifera]
Length=432

 Score =   186 bits (471),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = +3

Query  201  LQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQL  380
            LQS   NK CVDC QKNPQWASVSYG+FMCL+CSGKHRGLGVH+SFVRSVTMDSW +  L
Sbjct  19   LQSLSSNKTCVDCHQKNPQWASVSYGIFMCLDCSGKHRGLGVHLSFVRSVTMDSWPDSHL  78

Query  381  RKMEL--GGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDPPVVK  554
            +KME   GGND  N+F+S  G+PK+TDI  KYNT AA++YR+++QA+A+ + W +PPVVK
Sbjct  79   KKMEANSGGNDALNAFLSARGIPKDTDIPLKYNTNAAALYREKVQAIAENRRWTEPPVVK  138

Query  555  ETL  563
            E++
Sbjct  139  ESV  141



>gb|KIZ06703.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Monoraphidium neglectum]
Length=495

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            A R LR+LQ++P NK+CVDC  KNPQWA+VSYG FMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  6    ALRILRELQAKPENKVCVDCETKNPQWATVSYGTFMCLECSGKHRGLGVHISFVRSVTMD  65

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
            +W+  QLRKM+ GGN   ++F  Q+GV K TDI  KYN K A VYRD+I+A  +G+PW  
Sbjct  66   AWNPDQLRKMQAGGNGKLDAFFQQHGVDKATDIKVKYNNKVAEVYRDKIRAEVEGRPWTA  125

Query  540  P  542
            P
Sbjct  126  P  126



>ref|XP_001695178.1| ARF-GAP protein [Chlamydomonas reinhardtii]
 gb|EDP01886.1| ARF-GAP protein [Chlamydomonas reinhardtii]
Length=495

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            LR+LQS+P N++C DC  KNPQWASVSYG+FMCLECSG+HRGLGVHISFVRSV MD+WS 
Sbjct  10   LRELQSKPDNRVCCDCEMKNPQWASVSYGIFMCLECSGRHRGLGVHISFVRSVGMDAWSA  69

Query  372  IQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDP  542
             QL+KM+LGGN   N+F+ QYG+ K TDI  KYN++AA  YR++++A  +G+ +  P
Sbjct  70   DQLKKMQLGGNAKLNTFLKQYGIEKSTDIKDKYNSRAAEFYREKLRADVEGRDYTPP  126



>ref|XP_001417919.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96212.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=313

 Score =   162 bits (409),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 87/121 (72%), Gaps = 0/121 (0%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            LR LQ   GN  C DC  KNPQWASVS+G F+CLECSG HR LGVH+SFVRS +MDSWS 
Sbjct  1    LRALQRADGNAQCADCETKNPQWASVSHGAFVCLECSGVHRSLGVHVSFVRSASMDSWSA  60

Query  372  IQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDPPVV  551
             QL KM  GGND  N+F+ ++GVP+ T I  KYN+ AA V+R+++ A A+G+ W  P  V
Sbjct  61   AQLAKMRAGGNDALNAFLERHGVPRRTAIKEKYNSDAARVFREKVAAEANGEAWTAPTRV  120

Query  552  K  554
            +
Sbjct  121  E  121



>ref|XP_007514120.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15557.1| predicted protein [Bathycoccus prasinos]
Length=445

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            LR+LQ + GN  CVDCS KNPQWASVS+G F+CLECSG HR LGVH+SFVRSV MDSW+ 
Sbjct  10   LRELQGKNGNGTCVDCSTKNPQWASVSFGSFICLECSGVHRSLGVHLSFVRSVGMDSWNA  69

Query  372  IQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDPPVV  551
             QL+KM+LGGN   N F++++GVPK+  I  KY++ AA  +R++I+  ADG  + +P  +
Sbjct  70   TQLKKMQLGGNAKVNQFLAKHGVPKDAPIHLKYDSAAAEAFREKIRVEADGGKYAEPANI  129

Query  552  KETLK  566
             + LK
Sbjct  130  PKGLK  134



>ref|XP_008605893.1| hypothetical protein SDRG_02105 [Saprolegnia diclina VS20]
 gb|EQC41049.1| hypothetical protein SDRG_02105 [Saprolegnia diclina VS20]
Length=390

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 85/117 (73%), Gaps = 3/117 (3%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MA  + LR L   PGN  CVDC    PQWA+VSYG FMCLECSG+HRGLGVHISFVRSVT
Sbjct  7    MAVQQELRKL---PGNNKCVDCDAPYPQWATVSYGTFMCLECSGRHRGLGVHISFVRSVT  63

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADG  524
            MDSW++ Q+R M+LGGND+F S  +  GVPK   I  KYNT  A  +R R+QAL +G
Sbjct  64   MDSWTDKQIRMMQLGGNDHFRSEFNAAGVPKTLTIAQKYNTPQAEAFRARLQALVEG  120



>ref|XP_011397681.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Auxenochlorella 
protothecoides]
 gb|KFM24793.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Auxenochlorella 
protothecoides]
Length=903

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +3

Query  180  ASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            A R LR+LQS+P NK+CVDC  KNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVTMD
Sbjct  6    ALRILRELQSRPDNKVCVDCDTKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVTMD  65

Query  360  SWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAA  485
            +W+  QL++M+LGGN   N+F+ +YGV K TDI  KYN++AA
Sbjct  66   AWNPDQLKRMQLGGNGACNAFLGKYGVTKHTDIREKYNSQAA  107



>gb|KDO25807.1| hypothetical protein SPRG_08750 [Saprolegnia parasitica CBS 223.65]
Length=392

 Score =   158 bits (400),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 85/117 (73%), Gaps = 3/117 (3%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            MA  + LR L   PGN  CVDC    PQWA+VSYG FMCLECSG+HRGLGVHISFVRSVT
Sbjct  7    MAVQQELRKL---PGNNKCVDCDAPYPQWATVSYGTFMCLECSGRHRGLGVHISFVRSVT  63

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADG  524
            MDSW++ Q+R M+LGGND+F S  +  GVPK   I  KYNT  A  +R R+QAL +G
Sbjct  64   MDSWTDKQIRMMQLGGNDHFRSEFNAAGVPKTLTIAQKYNTPQAEAFRARLQALVEG  120



>ref|XP_005848600.1| hypothetical protein CHLNCDRAFT_14348, partial [Chlorella variabilis]
 gb|EFN56498.1| hypothetical protein CHLNCDRAFT_14348, partial [Chlorella variabilis]
Length=86

 Score =   147 bits (370),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  228  CVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQLRKMELGGND  407
            CVDC  KNPQWASVSYG+FMCLECSGKHRGLGVHISFVRSVTMD+W+  QLR+M+LGGND
Sbjct  1    CVDCEMKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVTMDAWNPDQLRRMQLGGND  60

Query  408  NFNSFISQYGVPKETDIVTKYNTKAA  485
              N F+ QYGV K  +I  KYN+KAA
Sbjct  61   KLNKFLEQYGVAKAVEIREKYNSKAA  86



>emb|CBK19893.2| unnamed protein product [Blastocystis hominis]
Length=474

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 90/119 (76%), Gaps = 3/119 (3%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L +L+  PGN +C DC    PQWASVSYG+F+CLECSG+HRGLGVH+SFVRSV MDSW+E
Sbjct  6    LLELRKLPGNDVCADCGAARPQWASVSYGIFVCLECSGQHRGLGVHLSFVRSVQMDSWTE  65

Query  372  IQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDPPV  548
             +++ M++GGN   N F+ ++GVPK + I  KYN++AA++YR+ I A  +G   R+PP 
Sbjct  66   REIKAMQVGGNKQMNDFLQEHGVPKNSSIKKKYNSRAAALYREVIAAKIEG---REPPT  121



>ref|XP_008860901.1| hypothetical protein H310_00060 [Aphanomyces invadans]
 gb|ETW09490.1| hypothetical protein H310_00060 [Aphanomyces invadans]
Length=396

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +3

Query  195  RDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEI  374
            ++L+  PGN  CVDC    PQWA+VSYG FMCLECSG+HRGLGVH+SFVRSV+MDSW++ 
Sbjct  11   QELRKLPGNNKCVDCDAPYPQWATVSYGTFMCLECSGRHRGLGVHLSFVRSVSMDSWTDK  70

Query  375  QLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADG  524
            Q+R M+LGGND+F S   + GVPK   I  KYNT  A  +R+R+ AL +G
Sbjct  71   QIRLMQLGGNDHFRSEFDKAGVPKTLSIAQKYNTPQAEAFRNRLNALVEG  120



>ref|XP_009830090.1| hypothetical protein H257_06531 [Aphanomyces astaci]
 gb|ETV80166.1| hypothetical protein H257_06531 [Aphanomyces astaci]
Length=398

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +3

Query  195  RDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEI  374
            ++L+  PGN  CVDC    PQWA+VSYG FMCLECSG+HRGLGVH+SFVRSV+MDSW++ 
Sbjct  11   QELRKLPGNNKCVDCDAPYPQWATVSYGTFMCLECSGRHRGLGVHLSFVRSVSMDSWTDK  70

Query  375  QLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADG  524
            Q+R M+LGGND+F S   + GVPK   I  KYNT  A  +R R+ AL +G
Sbjct  71   QIRLMQLGGNDHFRSEFDKAGVPKTLSIAQKYNTPQAEAFRSRLNALVEG  120



>ref|XP_002768563.1| ADP-ribosylation factor GTPase-activating protein, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER01281.1| ADP-ribosylation factor GTPase-activating protein, putative [Perkinsus 
marinus ATCC 50983]
Length=147

 Score =   147 bits (370),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 87/131 (66%), Gaps = 5/131 (4%)
 Frame = +3

Query  165  SKRMAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            +K    +RR  D    P N +C DC   NPQWASV YG++ CL CSGKHR LGVH+SFVR
Sbjct  5    TKSFFVARRKED----PENAVCCDCGAANPQWASVPYGIYFCLVCSGKHRSLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADG  524
            S TMDSW+  QL+KMELGGN  FN F  + G+ K + I  KYNTKAA  YR+ IQALADG
Sbjct  61   STTMDSWNPKQLKKMELGGNSKFNKFCREMGIDKMS-ISEKYNTKAAEYYRNYIQALADG  119

Query  525  KPWRDPPVVKE  557
                + P V +
Sbjct  120  TAPPERPSVAD  130



>emb|CEF97847.1| Arf GTPase activating protein [Ostreococcus tauri]
Length=472

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            LR LQ    N +C DC  KNPQWASVS+G F+CLECSG HR LGVH+SFVRSV MDSWSE
Sbjct  10   LRRLQGCDRNDVCADCETKNPQWASVSHGSFICLECSGIHRSLGVHVSFVRSVGMDSWSE  69

Query  372  IQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDPPVV  551
             QL+KM  GGN   N+F++++G+ K  D+ +KYN+ AA+ +RD+++  ++G  W +P  +
Sbjct  70   AQLKKMSAGGNGTLNAFLARHGIEKSCDVASKYNSAAAAAFRDKVKTESEGGRWIEPKNI  129

Query  552  KETLK  566
            +  +K
Sbjct  130  ERGVK  134



>ref|XP_005645766.1| Arf GTPase activating protein, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21222.1| Arf GTPase activating protein, partial [Coccomyxa subellipsoidea 
C-169]
Length=87

 Score =   144 bits (363),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  228  CVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQLRKMELGGND  407
            CVDC+ KNPQWASVSYG+FMCLECSGKHRGLGVH+SFVRSVTMD+WS  QLRKM+LGGND
Sbjct  1    CVDCNTKNPQWASVSYGIFMCLECSGKHRGLGVHLSFVRSVTMDAWSGDQLRKMQLGGND  60

Query  408  NFNSFISQYGVPKETDIVTKYNTKAA  485
              NSF+ +Y V K TDI  KY+++AA
Sbjct  61   ALNSFLKKYSVDKFTDIKEKYSSQAA  86



>ref|XP_005536673.1| similar to ADP ribosylation factor 1 GTPase activating protein 
[Cyanidioschyzon merolae strain 10D]
 dbj|BAM80637.1| similar to ADP ribosylation factor 1 GTPase activating protein 
[Cyanidioschyzon merolae strain 10D]
Length=390

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 92/128 (72%), Gaps = 3/128 (2%)
 Frame = +3

Query  168  KRMAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRS  347
            + + A++ L +LQ  P NK C DC   +PQWA+V+YG F+CLECSG+HRGLGVH+SFVRS
Sbjct  8    EELDAAKVLAELQRLPDNKRCADCGAYHPQWATVTYGTFICLECSGRHRGLGVHVSFVRS  67

Query  348  VTMDSWSEIQLRKMELGGNDNFNSFISQYG--VPK-ETDIVTKYNTKAASVYRDRIQALA  518
            V+MD W  ++LR+M++GGN  F  F+ ++    P    DI  KY T AA++Y  RI+ALA
Sbjct  68   VSMDRWKPLELRQMQVGGNAAFIDFMRRFAGITPSVSADIPAKYATPAAAIYAQRIRALA  127

Query  519  DGKPWRDP  542
             G+PW+DP
Sbjct  128  RGEPWQDP  135



>dbj|GAM26213.1| hypothetical protein SAMD00019534_093880 [Acytostelium subglobosum 
LB1]
Length=590

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 90/133 (68%), Gaps = 4/133 (3%)
 Frame = +3

Query  144  SDPNFVRSKRMAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLG  323
            ++ N  R+K +    R  D    P NK+C +C   NPQWASVSYG+F+CLECSG HR LG
Sbjct  7    AENNIARAKELFKKLREED----PSNKVCFECRAANPQWASVSYGIFICLECSGVHRSLG  62

Query  324  VHISFVRSVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDR  503
            VH+SFVRS++MD WS+ QL  M +GGN     F  ++GVP  +DI  KYN K  ++YR++
Sbjct  63   VHLSFVRSLSMDKWSDKQLEAMSVGGNTKCREFFKKHGVPDGSDIKNKYNHKGCALYREK  122

Query  504  IQALADGKPWRDP  542
            I ALA+ K WR+P
Sbjct  123  ITALAEQKSWREP  135



>ref|XP_002997471.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY68779.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=440

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 87/128 (68%), Gaps = 6/128 (5%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            M   + LR L   PGN  CVDC    PQWA+VSYG FMCLECSG+HRGLGVHISFVRSVT
Sbjct  7    METQQELRRL---PGNNRCVDCDAPYPQWATVSYGTFMCLECSGRHRGLGVHISFVRSVT  63

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSW++ Q+ +M+ GGND+F +  S  GVP +  I  KYNT  A  YR R+ A+ +G   
Sbjct  64   MDSWTDKQVLQMQKGGNDSFRAAFSAAGVPTDLSISEKYNTPQAEAYRQRLTAIVEG---  120

Query  534  RDPPVVKE  557
            R PP + +
Sbjct  121  RSPPSLPQ  128



>gb|ETO61900.1| hypothetical protein F444_20132 [Phytophthora parasitica P1976]
Length=439

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = +3

Query  195  RDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEI  374
            ++L+  PGN  CVDC    PQWA+VSYG FMCLECSG+HRGLGVHISFVRSVTMDSW++ 
Sbjct  11   QELRRLPGNNRCVDCDAPYPQWATVSYGTFMCLECSGRHRGLGVHISFVRSVTMDSWTDK  70

Query  375  QLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDPPVVK  554
            Q+ +M+ GGND F +  S  GVP +  I  KYNT  A  YR R+ A+ +G   R PP + 
Sbjct  71   QVLQMQKGGNDTFRAAFSAAGVPTDLSISEKYNTPQAEAYRQRLTAIVEG---RSPPSLP  127

Query  555  E  557
            +
Sbjct  128  Q  128



>ref|XP_001634175.1| predicted protein [Nematostella vectensis]
 gb|EDO42112.1| predicted protein, partial [Nematostella vectensis]
Length=148

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L++L+ + GN  C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W
Sbjct  8    RVLKELKPRDGNNCCFECGAHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             + +L KM++GGND   +F  SQ  + +   +  KYN+KAA++YRD+I AL++G+ W
Sbjct  68   KDSELEKMKVGGNDKAKAFFSSQPDIHQGQSLHDKYNSKAAALYRDKITALSEGRSW  124



>ref|XP_009517356.1| hypothetical protein PHYSODRAFT_358803 [Phytophthora sojae]
 gb|EGZ30081.1| hypothetical protein PHYSODRAFT_358803 [Phytophthora sojae]
Length=448

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +3

Query  195  RDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEI  374
            ++L+  PGN  CVDC    PQWA+VSYG FMCLECSG+HRGLGVHISFVRSVTMDSW++ 
Sbjct  11   QELRRLPGNNRCVDCDAPYPQWATVSYGTFMCLECSGRHRGLGVHISFVRSVTMDSWTDK  70

Query  375  QLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDPPVVK  554
            Q+ +M+ GGND+F +  S  GVP +  I  KYNT  A  YR R+ A+ +G   R PP + 
Sbjct  71   QVLQMQKGGNDSFRAAFSAAGVPTDLSISEKYNTPQAEAYRQRLTAIVEG---RSPPSLP  127

Query  555  E  557
            +
Sbjct  128  Q  128



>ref|XP_008914204.1| hypothetical protein PPTG_17983 [Phytophthora parasitica INRA-310]
 gb|ETI33190.1| hypothetical protein F443_20119 [Phytophthora parasitica P1569]
 gb|ETK73503.1| hypothetical protein L915_19582 [Phytophthora parasitica]
 gb|ETL26934.1| hypothetical protein L916_19472 [Phytophthora parasitica]
 gb|ETL80180.1| hypothetical protein L917_19311 [Phytophthora parasitica]
 gb|ETM33429.1| hypothetical protein L914_19347 [Phytophthora parasitica]
 gb|ETN00533.1| hypothetical protein PPTG_17983 [Phytophthora parasitica INRA-310]
 gb|ETP02995.1| hypothetical protein F441_19998 [Phytophthora parasitica CJ01A1]
Length=439

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 86/128 (67%), Gaps = 6/128 (5%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            M   + LR L   PGN  CVDC    PQWA+VSYG FMCLECSG+HRGLGVHISFVRSVT
Sbjct  7    METQQELRRL---PGNNRCVDCDAPYPQWATVSYGTFMCLECSGRHRGLGVHISFVRSVT  63

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSW++ Q+ +M+ GGND F +  S  GVP +  I  KYNT  A  YR R+ A+ +G   
Sbjct  64   MDSWTDKQVLQMQKGGNDTFRAAFSAAGVPTDLSISEKYNTPQAEAYRQRLTAIVEG---  120

Query  534  RDPPVVKE  557
            R PP + +
Sbjct  121  RSPPSLPQ  128



>gb|EWM30510.1| adp-ribosylation factor gtpase-activating protein agd7 [Nannochloropsis 
gaditana]
Length=641

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 87/121 (72%), Gaps = 6/121 (5%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            RRLR+L    GNK+C DC   NPQWASVSYG F+CL+CSG+HR LGVH+SFVRS+TMDSW
Sbjct  35   RRLREL---AGNKVCADCPAPNPQWASVSYGSFICLDCSGQHRALGVHLSFVRSITMDSW  91

Query  366  SEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDPP  545
            ++ Q++ ME GGND   SF  Q G+ K   I  KY T  A +YR+RI+A+ +G   R+PP
Sbjct  92   TDKQIKLMEKGGNDQVISFFQQRGIAKSVPIQQKYKTAEAELYRERIKAVVEG---REPP  148

Query  546  V  548
             
Sbjct  149  T  149



>ref|XP_002507574.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68832.1| predicted protein [Micromonas sp. RCC299]
Length=396

 Score =   148 bits (373),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 90/130 (69%), Gaps = 10/130 (8%)
 Frame = +3

Query  180  ASRRLRDLQSQPGN---KICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFV---  341
            A+  LR+LQ    N    +CVDC  +NPQWASV+YG+F+CLECSG HRGLGVHISFV   
Sbjct  6    ATAVLRELQQTNENWVSMLCVDCGSRNPQWASVTYGIFLCLECSGVHRGLGVHISFVRYK  65

Query  342  ----RSVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQ  509
                RSV MDSWS IQL+KM+ GGN N N F+   G+ K  D   KYN+ AA  Y+D++Q
Sbjct  66   WESFRSVGMDSWSPIQLKKMQAGGNANLNDFLKDKGIAKNIDPKIKYNSLAAKEYKDKVQ  125

Query  510  ALADGKPWRD  539
            A+A+G+ W +
Sbjct  126  AVAEGRLWTE  135



>gb|ETP31173.1| hypothetical protein F442_19946 [Phytophthora parasitica P10297]
Length=439

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 86/128 (67%), Gaps = 6/128 (5%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            M   + LR L   PGN  CVDC    PQWA+VSYG FMCLECSG+HRGLGVHISFVRSVT
Sbjct  7    METQQELRRL---PGNNRCVDCDAPYPQWATVSYGTFMCLECSGRHRGLGVHISFVRSVT  63

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            MDSW++ Q+ +M+ GG+D F +  S  GVP +  I  KYNT  A  YR R+ A+ +G   
Sbjct  64   MDSWTDKQVLQMQKGGDDTFRAAFSAAGVPTDLSISEKYNTPQAEAYRQRLTAIVEG---  120

Query  534  RDPPVVKE  557
            R PP + +
Sbjct  121  RSPPSLPQ  128



>ref|XP_002783407.1| ADP-ribosylation factor GTPase-activating protein, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER15203.1| ADP-ribosylation factor GTPase-activating protein, putative [Perkinsus 
marinus ATCC 50983]
Length=449

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 87/131 (66%), Gaps = 5/131 (4%)
 Frame = +3

Query  165  SKRMAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            +K    +RR  D    P N +C DC   NPQWASV YG++ CL CSGKHR LGVH+SFVR
Sbjct  5    TKSFFVARRKED----PENAVCCDCGAANPQWASVPYGIYFCLVCSGKHRSLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADG  524
            S TMDSW+  QL+KMELGGN  FN F  + G+ K + I  KYNTKAA  YR+ IQALADG
Sbjct  61   STTMDSWNPKQLKKMELGGNSKFNKFCREMGIDKMS-ISEKYNTKAAEYYRNYIQALADG  119

Query  525  KPWRDPPVVKE  557
                + P V +
Sbjct  120  TAPPERPSVAD  130



>ref|XP_002778044.1| ADP-ribosylation factor GTPase-activating protein, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER09839.1| ADP-ribosylation factor GTPase-activating protein, putative [Perkinsus 
marinus ATCC 50983]
Length=450

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 87/131 (66%), Gaps = 5/131 (4%)
 Frame = +3

Query  165  SKRMAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            +K    +RR  D    P N +C DC   NPQWASV YG++ CL CSGKHR LGVH+SFVR
Sbjct  5    TKSFFVARRKED----PENAVCCDCGAANPQWASVPYGIYFCLVCSGKHRSLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADG  524
            S TMDSW+  QL+KMELGGN  FN F  + G+ K + I  KYNTKAA  YR+ IQALADG
Sbjct  61   STTMDSWNPKQLKKMELGGNSKFNKFCREMGIDKMS-ISEKYNTKAAEYYRNYIQALADG  119

Query  525  KPWRDPPVVKE  557
                + P V +
Sbjct  120  TAPPERPSVAD  130



>ref|XP_003288862.1| hypothetical protein DICPUDRAFT_153151 [Dictyostelium purpureum]
 gb|EGC34637.1| hypothetical protein DICPUDRAFT_153151 [Dictyostelium purpureum]
Length=612

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = +3

Query  153  NFVRSKRMAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHI  332
            N  R+K +   +RL++  +   NKIC +C   NPQWASVSYG+++CLECSG HR LGVH+
Sbjct  8    NIARAKEIF--KRLKEEDTT--NKICFECRSANPQWASVSYGIYICLECSGVHRSLGVHL  63

Query  333  SFVRSVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQA  512
            SFVRS+TMD WS++QL KM  GGN     F  ++G+P + +I  KYNT+ A +Y+D++ A
Sbjct  64   SFVRSLTMDQWSDVQLEKMIQGGNSKAKEFFKKHGIPDDANIKGKYNTEGARLYKDKLSA  123

Query  513  LADGKPWRDP  542
            L++ + W++P
Sbjct  124  LSESRAWKEP  133



>ref|XP_002947250.1| hypothetical protein VOLCADRAFT_103335 [Volvox carteri f. nagariensis]
 gb|EFJ51840.1| hypothetical protein VOLCADRAFT_103335 [Volvox carteri f. nagariensis]
Length=487

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 89/128 (70%), Gaps = 10/128 (8%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWA----------SVSYGVFMCLECSGKHRGLGVHISFV  341
            LR+LQS+P N++ +                    +VSYG+FMCLECSG+HRGLGVHISFV
Sbjct  10   LRELQSRPDNRVKLHSGFLGKHQIFTGNYPIIPITVSYGIFMCLECSGRHRGLGVHISFV  69

Query  342  RSVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            RSVTMDSWS  QL+KM+LGGN   N+F+ QYGV K TDI  KYNT+AA  YR++++A  +
Sbjct  70   RSVTMDSWSPEQLKKMQLGGNAKLNAFLKQYGVDKSTDIKEKYNTRAAEFYREKLRASVE  129

Query  522  GKPWRDPP  545
            G+ +  PP
Sbjct  130  GREYTPPP  137



>ref|XP_640542.1| Arf GTPase activating protein [Dictyostelium discoideum AX4]
 gb|EAL66575.1| Arf GTPase activating protein [Dictyostelium discoideum AX4]
Length=608

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 95/135 (70%), Gaps = 4/135 (3%)
 Frame = +3

Query  138  IGSDPNFVRSKRMAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRG  317
            I  + N  R+K +   +RL++  S   NK+C +C   NPQWASVSYG+++CLECSG HR 
Sbjct  5    IDREANIARAKEIF--KRLKEEDS--SNKVCFECRSANPQWASVSYGIYICLECSGVHRS  60

Query  318  LGVHISFVRSVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYR  497
            LGVH+SFVRS+TMD W++ QL KM+ GGN     F  ++GVP +++I  KYN K A +Y+
Sbjct  61   LGVHLSFVRSLTMDQWNDQQLEKMKQGGNTKAKEFFKKHGVPDDSNIKGKYNLKGAILYK  120

Query  498  DRIQALADGKPWRDP  542
            +++ ALA+ K W++P
Sbjct  121  EKLAALAESKAWKEP  135



>ref|XP_002432407.1| ADP-ribosylation factor GTPase-activating protein, putative [Pediculus 
humanus corporis]
 gb|EEB19669.1| ADP-ribosylation factor GTPase-activating protein, putative [Pediculus 
humanus corporis]
Length=449

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L++L+S   N  C +C   NPQWASV+YG+++CLECSGKHRGLGVH+SFVRS+TMD W
Sbjct  8    RVLQELKSINDNSKCFECGAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSITMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +++L KM++GGN N   F+ +Q        I  KYNTKAA++YRD+I ALA GK W
Sbjct  68   KDVELEKMKVGGNKNAREFLNAQKDYNDSMPIQQKYNTKAAALYRDKISALAQGKSW  124



>emb|CBK21352.2| unnamed protein product [Blastocystis hominis]
Length=231

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L +L++ PGN +CVDC    PQWASVSYG F+CLECSGKHRGLGVH+SFVRSV MDSW+E
Sbjct  6    LAELRALPGNNVCVDCGASRPQWASVSYGTFICLECSGKHRGLGVHLSFVRSVQMDSWTE  65

Query  372  IQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRD  500
             +++ M++GGN +  SF  ++G+  +  I  KY++ AA++YR+
Sbjct  66   DEIKAMQVGGNQSLRSFFEEHGISNDATIREKYSSPAAALYRE  108



>gb|AFR94315.1| ADP-ribosylation factor GTPase-activating protein 1 [Cryptococcus 
neoformans var. grubii H99]
Length=420

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 87/127 (69%), Gaps = 6/127 (5%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            + L  L +  GNK+CVDC+  +PQWASVSYG+F+CLECSG HRG GVHISFVRS+TMD W
Sbjct  8    KELLALMNIGGNKVCVDCNAPSPQWASVSYGIFICLECSGVHRGFGVHISFVRSITMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFISQY----GVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            SE QL KM++GGN+ F  F+  Y    G  K   +  KYN+ AA+ YR+++ A   G+PW
Sbjct  68   SEDQLNKMKMGGNEKFKDFMGNYGPEGGYTKGMGMQEKYNSWAAAQYREKLTAECAGQPW  127

Query  534  --RDPPV  548
                PP 
Sbjct  128  SPSSPPA  134



>dbj|GAN06267.1| ARF GTPase activator [Mucor ambiguus]
Length=432

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 85/124 (69%), Gaps = 1/124 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            ++L D+Q    NK C DC   NPQWAS+SYG+F+CL+CSG HR  GVHISFVRS+TMD W
Sbjct  8    KKLYDIQRTGENKNCFDCRAPNPQWASISYGIFICLDCSGIHRSFGVHISFVRSITMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDP  542
             + QL+KMELGGN+N   F  SQ     +     KY+T+AA +YRD++ A A+G+PW   
Sbjct  68   FDDQLKKMELGGNENARVFFESQPDYSSDMTTQEKYHTQAAELYRDKLSAEAEGRPWTPT  127

Query  543  PVVK  554
            P  +
Sbjct  128  PSTR  131



>emb|CCI46063.1| unnamed protein product [Albugo candida]
Length=374

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 85/122 (70%), Gaps = 4/122 (3%)
 Frame = +3

Query  174  MAASRRLRDLQSQ----PGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFV  341
            MA ++   ++Q Q     GN  CVDC    PQWA+VSYG F+CLECSG+HRGLGVHISFV
Sbjct  1    MACNQMPLEIQQQLRLLSGNNKCVDCDAPYPQWATVSYGTFLCLECSGRHRGLGVHISFV  60

Query  342  RSVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            RSVTMDSW+E+Q+++M++GGN+ F    +  GVP    I  KYNT  A  YR R+ AL +
Sbjct  61   RSVTMDSWTELQIKQMQMGGNEAFRREFNGAGVPNTLCIQEKYNTSQAEAYRKRLSALVE  120

Query  522  GK  527
            G+
Sbjct  121  GR  122



>ref|XP_773500.1| hypothetical protein CNBI1140 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL18853.1| hypothetical protein CNBI1140 [Cryptococcus neoformans var. neoformans 
B-3501A]
Length=416

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 86/127 (68%), Gaps = 6/127 (5%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            + L  L +  GNK+CVDC+  +PQWASVSYG+F+CLECSG HRG GVHISFVRS+TMD W
Sbjct  8    KELLALMNTGGNKVCVDCNAPSPQWASVSYGIFICLECSGVHRGFGVHISFVRSITMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFISQY----GVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            S+ QL KM+ GGN+ F  F+  Y    G  K   +  KYN+ AA+ YR+++ A   G+PW
Sbjct  68   SDEQLNKMKTGGNEKFKDFMENYGPEGGYTKGMGMQEKYNSWAAAQYREKLTAECAGQPW  127

Query  534  --RDPPV  548
                PP 
Sbjct  128  SASSPPA  134



>ref|XP_568103.1| ARF GTPase activator [Cryptococcus neoformans var. neoformans 
JEC21]
 gb|AAW46586.1| ARF GTPase activator, putative [Cryptococcus neoformans var. 
neoformans JEC21]
Length=416

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 86/127 (68%), Gaps = 6/127 (5%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            + L  L +  GNK+CVDC+  +PQWASVSYG+F+CLECSG HRG GVHISFVRS+TMD W
Sbjct  8    KELLALMNTGGNKVCVDCNAPSPQWASVSYGIFICLECSGVHRGFGVHISFVRSITMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFISQY----GVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            S+ QL KM+ GGN+ F  F+  Y    G  K   +  KYN+ AA+ YR+++ A   G+PW
Sbjct  68   SDEQLNKMKTGGNEKFKDFMENYGPEGGYTKGMGMQEKYNSWAAAQYREKLTAECAGQPW  127

Query  534  --RDPPV  548
                PP 
Sbjct  128  SASSPPA  134



>pdb|3DWD|A Chain A, Crystal Structure Of The Arfgap Domain Of Human Arfgap1
 pdb|3DWD|B Chain B, Crystal Structure Of The Arfgap Domain Of Human Arfgap1
Length=147

 Score =   136 bits (342),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L++++ Q  N +C +C   NPQW SV+YG+++CLECSG+HRGLGVH+SFVRSVTMD W +
Sbjct  29   LKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMDKWKD  88

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            I+L KM+ GGN  F  F+ SQ        +  KYN++AA+++RD++ ALA+G+ W
Sbjct  89   IELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAEGREW  143



>ref|XP_002765599.1| ADP-ribosylation factor GTPase-activating protein, putative [Perkinsus 
marinus ATCC 50983]
 gb|EEQ98316.1| ADP-ribosylation factor GTPase-activating protein, putative [Perkinsus 
marinus ATCC 50983]
Length=448

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 86/131 (66%), Gaps = 5/131 (4%)
 Frame = +3

Query  165  SKRMAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            +K   A+RR  D    P N +C DC   NPQWASV YG++ CL CSGKHR LGVH+SFVR
Sbjct  5    TKSFFAARRKED----PENAVCCDCGAANPQWASVPYGIYFCLVCSGKHRSLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADG  524
            S TMD+W+  QL+KME+GGN  FN F  +  + K + I  KYNTKAA  YR+ IQAL DG
Sbjct  61   STTMDTWNPKQLKKMEVGGNGKFNKFCREMEIDKMS-ISEKYNTKAAEYYRNFIQALVDG  119

Query  525  KPWRDPPVVKE  557
                + P + E
Sbjct  120  TAPPERPSIAE  130



>ref|XP_010720794.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1-like [Meleagris gallopavo]
Length=178

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++  +A+
Sbjct  61   SVTMDKWKDIELEKMKAGGNSKFREFLESQDDYDPCWSMQEKYNSKAAALFRDQVATVAE  120

Query  522  GKPW  533
            GK W
Sbjct  121  GKEW  124



>ref|XP_008182223.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X2 [Acyrthosiphon pisum]
Length=358

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L++L +Q  N  C +C   NPQWASVSYG+++CL CSGKHRGLGVH+SFVRS+TMDSW
Sbjct  12   RILQELMTQQDNSKCFECGSHNPQWASVSYGIWICLMCSGKHRGLGVHLSFVRSITMDSW  71

Query  366  SEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +++L KM++GGN N   F  SQ        I  KYNTKAA++YRD+I  LA G+ W
Sbjct  72   KDLELEKMKVGGNRNAKEFFKSQPDWSDSMTIEQKYNTKAAALYRDKILNLAKGEQW  128



>gb|EFA86569.1| Arf GTPase activating protein [Polysphondylium pallidum PN500]
Length=604

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 85/130 (65%), Gaps = 4/130 (3%)
 Frame = +3

Query  153  NFVRSKRMAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHI  332
            N  R+K +    +  D    P NK C +C   NPQWASVSYG+F+CLECSG HR LGVH+
Sbjct  10   NINRAKELFKKLKEED----PSNKQCFECRSANPQWASVSYGIFICLECSGVHRSLGVHL  65

Query  333  SFVRSVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQA  512
            SFVRS+TMD WS+ QL  M +GGN     F  ++GVP+  DI  KYN K   +Y+++I A
Sbjct  66   SFVRSLTMDQWSDKQLEMMSVGGNARAREFFKKHGVPEGLDIKNKYNNKNVQMYKEKILA  125

Query  513  LADGKPWRDP  542
            L + K W++P
Sbjct  126  LVESKVWKEP  135



>ref|XP_007248441.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1-like isoform X6 [Astyanax mexicanus]
Length=376

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L+++++  GN +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSV+MD W
Sbjct  8    RVLKEVRTDDGNNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVSMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM+ GGN+ F  F+  Q        +  KYN+KAA+++RD++  LADGK W
Sbjct  68   KDIELEKMKAGGNEKFRLFLELQDDYDPNWTLQEKYNSKAAALFRDKVATLADGKEW  124



>ref|XP_007248439.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1-like isoform X4 [Astyanax mexicanus]
Length=398

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L+++++  GN +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSV+MD W
Sbjct  8    RVLKEVRTDDGNNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVSMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM+ GGN+ F  F+  Q        +  KYN+KAA+++RD++  LADGK W
Sbjct  68   KDIELEKMKAGGNEKFRLFLELQDDYDPNWTLQEKYNSKAAALFRDKVATLADGKEW  124



>ref|XP_001950272.2| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X1 [Acyrthosiphon pisum]
Length=389

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L++L +Q  N  C +C   NPQWASVSYG+++CL CSGKHRGLGVH+SFVRS+TMDSW
Sbjct  12   RILQELMTQQDNSKCFECGSHNPQWASVSYGIWICLMCSGKHRGLGVHLSFVRSITMDSW  71

Query  366  SEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +++L KM++GGN N   F  SQ        I  KYNTKAA++YRD+I  LA G+ W
Sbjct  72   KDLELEKMKVGGNRNAKEFFKSQPDWSDSMTIEQKYNTKAAALYRDKILNLAKGEQW  128



>gb|EDL07365.1| ADP-ribosylation factor GTPase activating protein 1, isoform 
CRA_a [Mus musculus]
Length=148

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSG+HRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            I+L KM+ GGN  F  F+ +Q        +  KY+++AA+++RD++  LA+GK W
Sbjct  70   IELEKMKAGGNAKFREFLETQDDYEPSWSLQDKYSSRAAALFRDKVATLAEGKEW  124



>gb|EPB81233.1| hypothetical protein HMPREF1544_12056 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=429

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 85/124 (69%), Gaps = 1/124 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            ++L D+Q    NK C DC   NPQWAS+SYG+F+CL+CSG HR  GVHISFVRS+TMD W
Sbjct  8    KKLYDIQRTGENKNCFDCRAPNPQWASISYGIFICLDCSGIHRSFGVHISFVRSITMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDP  542
             + QL+KMELGGN+    F  SQ     +     KY+T+AA +YRD++ A A+G+PW   
Sbjct  68   FDDQLKKMELGGNERARIFFESQPDYSSDMTTQEKYHTQAAELYRDKLSAEAEGRPWTPT  127

Query  543  PVVK  554
            P ++
Sbjct  128  PSIR  131



>gb|EDL88775.1| ADP-ribosylation factor GTPase activating protein 1, isoform 
CRA_d [Rattus norvegicus]
Length=148

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSG+HRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            I+L KM+ GGN  F  F+ +Q        +  KY+++AA+++RD++  LA+GK W
Sbjct  70   IELEKMKAGGNAKFREFLEAQDDYEPSWSLQDKYSSRAAALFRDKVATLAEGKEW  124



>ref|XP_008155396.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 [Eptesicus fuscus]
Length=408

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            + L++++ Q GN +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W
Sbjct  8    KALKEVRVQDGNNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++ ALA+G+ W
Sbjct  68   KDIELEKMKAGGNAKFKQFLASQEDYDPCWSLQDKYNSKAAALFRDKVAALAEGREW  124



>ref|XP_007248438.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1-like isoform X3 [Astyanax mexicanus]
Length=417

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L+++++  GN +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSV+MD W
Sbjct  8    RVLKEVRTDDGNNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVSMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM+ GGN+ F  F+  Q        +  KYN+KAA+++RD++  LADGK W
Sbjct  68   KDIELEKMKAGGNEKFRLFLELQDDYDPNWTLQEKYNSKAAALFRDKVATLADGKEW  124



>ref|XP_002169146.2| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1-like [Hydra vulgaris]
Length=362

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 84/119 (71%), Gaps = 1/119 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R LRDL+ + GN  C +C+  NPQW SVSYG+++CL+CSGKHRGLGVH+SFVRSVTMD W
Sbjct  8    RVLRDLKFKDGNNACFECNSHNPQWVSVSYGIWICLDCSGKHRGLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRD  539
             +I+L KM++GGN     F  SQ        +  KYN++AA++YRD+I   A+G  W +
Sbjct  68   KDIELEKMKVGGNAKAKEFFQSQSDYKDGMSLTEKYNSRAAALYRDKIITEAEGNTWSE  126



>ref|XP_009481135.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1-like, partial [Pelecanus crispus]
 gb|KFQ51620.1| ADP-ribosylation factor GTPase-activating protein 1, partial 
[Pelecanus crispus]
Length=209

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++  +A+
Sbjct  61   SVTMDKWKDIELEKMKAGGNSKFQEFLESQDDYDPCWSMQEKYNSKAAALFRDQVATVAE  120

Query  522  GKPW  533
            GK W
Sbjct  121  GKEW  124



>ref|XP_007475631.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X4 [Monodelphis domestica]
Length=401

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 94/143 (66%), Gaps = 13/143 (9%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++  LA+
Sbjct  61   SVTMDKWKDIELEKMKAGGNARFREFLESQEDYDPSWSMQQKYNSKAAALFRDKVATLAE  120

Query  522  GKPWR---------DPPVVKETL  563
            GK W           PP  K TL
Sbjct  121  GKEWSLETSSAQNWTPPQPKMTL  143



>ref|XP_008561395.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X3 [Galeopterus variegatus]
Length=275

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L++++ Q GN +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRVQDGNNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            I+L KM+ GGN  F +F+ SQ        +  KY+++AA+++RD++ ALA+G+ W
Sbjct  70   IELEKMKAGGNAKFQAFLESQEDYDPCWSLQEKYSSRAAALFRDKVAALAEGREW  124



>ref|XP_007248440.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1-like isoform X5 [Astyanax mexicanus]
Length=386

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L+++++  GN +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSV+MD W
Sbjct  8    RVLKEVRTDDGNNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVSMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM+ GGN+ F  F+  Q        +  KYN+KAA+++RD++  LADGK W
Sbjct  68   KDIELEKMKAGGNEKFRLFLELQDDYDPNWTLQEKYNSKAAALFRDKVATLADGKEW  124



>ref|XP_010187255.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1, partial [Mesitornis unicolor]
Length=209

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++  +A+
Sbjct  61   SVTMDKWKDIELEKMKAGGNSKFREFLESQDDYDPCWSMQEKYNSKAAALFRDQVATVAE  120

Query  522  GKPW  533
            GK W
Sbjct  121  GKEW  124



>gb|EFB27915.1| hypothetical protein PANDA_015322 [Ailuropoda melanoleuca]
Length=199

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 88/124 (71%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L++++ Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +++L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RDR+  LA+
Sbjct  61   SVTMDKWKDVELEKMKAGGNAKFREFLESQEDYDPCWSMQDKYNSKAAALFRDRVATLAE  120

Query  522  GKPW  533
            G+ W
Sbjct  121  GREW  124



>gb|KFQ24554.1| ADP-ribosylation factor GTPase-activating protein 1, partial 
[Mesitornis unicolor]
Length=210

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++  +A+
Sbjct  61   SVTMDKWKDIELEKMKAGGNSKFREFLESQDDYDPCWSMQEKYNSKAAALFRDQVATVAE  120

Query  522  GKPW  533
            GK W
Sbjct  121  GKEW  124



>ref|XP_011473811.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X5 [Oryzias latipes]
Length=392

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L+D+++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W
Sbjct  8    RVLKDVRTQDENNLCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM+ GGN  F  F+  Q        +  KYN+KAA+++RD++  LA+GK W
Sbjct  68   KDIELEKMKAGGNGKFRLFLELQDDYDPNWTLQEKYNSKAAALFRDKVATLAEGKEW  124



>ref|XP_005711999.1| unnamed protein product [Chondrus crispus]
 emb|CDF32334.1| unnamed protein product [Chondrus crispus]
Length=407

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            LR+LQ +P NK+C DC  KNPQWA+VS+G F+CL+CSG+HRGLGVHISFVRSV MD W E
Sbjct  8    LRELQMRPENKVCADCGTKNPQWATVSFGTFICLDCSGQHRGLGVHISFVRSVGMDRWKE  67

Query  372  IQLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDP  542
             ++++M+ GGN  F ++    G+    DI +KY ++AA++Y   ++A+A G+P+  P
Sbjct  68   WEVKRMQAGGNAKFVTYCKSNGM-HGADIASKYQSEAAAIYAATLKAVATGEPYVPP  123



>gb|KFP51575.1| ADP-ribosylation factor GTPase-activating protein 1, partial 
[Cathartes aura]
Length=210

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 88/124 (71%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFISQYGVPKET-DIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+   G       +  KYN+KAA+++RD++  +A+
Sbjct  61   SVTMDKWKDIELEKMKAGGNSKFREFLESQGDYDPCWSMQEKYNSKAAALFRDQVATVAE  120

Query  522  GKPW  533
            GK W
Sbjct  121  GKEW  124



>ref|XP_007475630.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X3 [Monodelphis domestica]
Length=411

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 94/143 (66%), Gaps = 13/143 (9%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++  LA+
Sbjct  61   SVTMDKWKDIELEKMKAGGNARFREFLESQEDYDPSWSMQQKYNSKAAALFRDKVATLAE  120

Query  522  GKPWR---------DPPVVKETL  563
            GK W           PP  K TL
Sbjct  121  GKEWSLETSSAQNWTPPQPKMTL  143



>ref|XP_008561394.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X2 [Galeopterus variegatus]
Length=308

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L++++ Q GN +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRVQDGNNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            I+L KM+ GGN  F +F+ SQ        +  KY+++AA+++RD++ ALA+G+ W
Sbjct  70   IELEKMKAGGNAKFQAFLESQEDYDPCWSLQEKYSSRAAALFRDKVAALAEGREW  124



>ref|XP_011473810.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X4 [Oryzias latipes]
Length=395

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L+D+++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W
Sbjct  8    RVLKDVRTQDENNLCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM+ GGN  F  F+  Q        +  KYN+KAA+++RD++  LA+GK W
Sbjct  68   KDIELEKMKAGGNGKFRLFLELQDDYDPNWTLQEKYNSKAAALFRDKVATLAEGKEW  124



>ref|XP_001368073.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X1 [Monodelphis domestica]
Length=423

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 94/143 (66%), Gaps = 13/143 (9%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++  LA+
Sbjct  61   SVTMDKWKDIELEKMKAGGNARFREFLESQEDYDPSWSMQQKYNSKAAALFRDKVATLAE  120

Query  522  GKPWR---------DPPVVKETL  563
            GK W           PP  K TL
Sbjct  121  GKEWSLETSSAQNWTPPQPKMTL  143



>gb|KIR36581.1| ADP-ribosylation factor GTPase-activating protein 1 [Cryptococcus 
gattii MMRL2647]
Length=421

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 85/127 (67%), Gaps = 6/127 (5%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            + L  L +   NK+CVDCS  +PQWASVSYG+F+CLECSG HRG GVHISFVRS+TMD W
Sbjct  8    KELLTLMNTGDNKVCVDCSALSPQWASVSYGIFICLECSGVHRGFGVHISFVRSITMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFISQYGVP----KETDIVTKYNTKAASVYRDRIQALADGKPW  533
            S+ QL KM+ GGN+ F  F+  YG      K   +  KYN+ AA+ YR+++ A   G+PW
Sbjct  68   SDEQLNKMKTGGNEKFKDFMENYGPEGGYIKGMGMQEKYNSWAAAQYREKLAAECAGQPW  127

Query  534  --RDPPV  548
                PP 
Sbjct  128  SPSSPPA  134



>ref|XP_007248436.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1-like isoform X1 [Astyanax mexicanus]
 ref|XP_007248437.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1-like isoform X2 [Astyanax mexicanus]
Length=427

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L+++++  GN +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSV+MD W
Sbjct  8    RVLKEVRTDDGNNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVSMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM+ GGN+ F  F+  Q        +  KYN+KAA+++RD++  LADGK W
Sbjct  68   KDIELEKMKAGGNEKFRLFLELQDDYDPNWTLQEKYNSKAAALFRDKVATLADGKEW  124



>ref|XP_007475629.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X2 [Monodelphis domestica]
Length=433

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 94/143 (66%), Gaps = 13/143 (9%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++  LA+
Sbjct  61   SVTMDKWKDIELEKMKAGGNARFREFLESQEDYDPSWSMQQKYNSKAAALFRDKVATLAE  120

Query  522  GKPWR---------DPPVVKETL  563
            GK W           PP  K TL
Sbjct  121  GKEWSLETSSAQNWTPPQPKMTL  143



>ref|XP_001661085.1| AAEL010834-PA [Aedes aegypti]
 gb|EAT37139.1| AAEL010834-PA [Aedes aegypti]
Length=497

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L DL+    N  C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSV+MD W
Sbjct  8    RVLSDLKPNNENNKCFECGTHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVSMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +++L KM++GGN N  +F  +Q        I  KYNT+AA++YRD+I  LA GKPW
Sbjct  68   KDVELEKMKVGGNRNARTFFDAQDDWDDTLPITKKYNTRAAALYRDKISTLAQGKPW  124



>ref|XP_004069187.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X2 [Oryzias latipes]
Length=414

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L+D+++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W
Sbjct  8    RVLKDVRTQDENNLCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM+ GGN  F  F+  Q        +  KYN+KAA+++RD++  LA+GK W
Sbjct  68   KDIELEKMKAGGNGKFRLFLELQDDYDPNWTLQEKYNSKAAALFRDKVATLAEGKEW  124



>ref|XP_011473812.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X6 [Oryzias latipes]
Length=383

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L+D+++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W
Sbjct  8    RVLKDVRTQDENNLCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM+ GGN  F  F+  Q        +  KYN+KAA+++RD++  LA+GK W
Sbjct  68   KDIELEKMKAGGNGKFRLFLELQDDYDPNWTLQEKYNSKAAALFRDKVATLAEGKEW  124



>gb|KFP37360.1| ADP-ribosylation factor GTPase-activating protein 1, partial 
[Chlamydotis macqueenii]
Length=240

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++  +A+GK W
Sbjct  70   IELEKMKAGGNSKFREFLESQDDYDPCWSMQEKYNSKAAALFRDQVATVAEGKEW  124



>ref|XP_008561393.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X1 [Galeopterus variegatus]
Length=318

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L++++ Q GN +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRVQDGNNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            I+L KM+ GGN  F +F+ SQ        +  KY+++AA+++RD++ ALA+G+ W
Sbjct  70   IELEKMKAGGNAKFQAFLESQEDYDPCWSLQEKYSSRAAALFRDKVAALAEGREW  124



>gb|KGB78795.1| ARF GTPase activator [Cryptococcus gattii R265]
 gb|KIR25211.1| ADP-ribosylation factor GTPase-activating protein 1 [Cryptococcus 
gattii LA55]
 gb|KIR76011.1| ADP-ribosylation factor GTPase-activating protein 1 [Cryptococcus 
gattii CA1014]
 gb|KIR95954.1| ADP-ribosylation factor GTPase-activating protein 1 [Cryptococcus 
gattii CBS 10090]
 gb|KIS02450.1| ADP-ribosylation factor GTPase-activating protein 1 [Cryptococcus 
gattii 2001/935-1]
Length=421

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 85/127 (67%), Gaps = 6/127 (5%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            + L  L +   NK+CVDCS  +PQWASVSYG+F+CLECSG HRG GVHISFVRS+TMD W
Sbjct  8    KELLALMNTGDNKVCVDCSALSPQWASVSYGIFICLECSGVHRGFGVHISFVRSITMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFISQYGVP----KETDIVTKYNTKAASVYRDRIQALADGKPW  533
            S+ QL KM+ GGN+ F  F+  YG      K   +  KYN+ AA+ YR+++ A   G+PW
Sbjct  68   SDEQLNKMKTGGNEKFKDFMENYGPEGGYIKGMGMQEKYNSWAAAQYREKLAAECAGQPW  127

Query  534  --RDPPV  548
                PP 
Sbjct  128  SPSSPPA  134



>gb|KIR38984.1| ADP-ribosylation factor GTPase-activating protein 1 [Cryptococcus 
gattii Ram5]
 gb|KIY58897.1| ADP-ribosylation factor GTPase-activating protein 1 [Cryptococcus 
gattii 99/473]
Length=421

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 85/127 (67%), Gaps = 6/127 (5%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            + L  L +   NK+CVDCS  +PQWASVSYG+F+CLECSG HRG GVHISFVRS+TMD W
Sbjct  8    KELLALMNTGDNKVCVDCSALSPQWASVSYGIFICLECSGVHRGFGVHISFVRSITMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFISQYGVP----KETDIVTKYNTKAASVYRDRIQALADGKPW  533
            S+ QL KM+ GGN+ F  F+  YG      K   +  KYN+ AA+ YR+++ A   G+PW
Sbjct  68   SDEQLNKMKTGGNEKFKDFMENYGPEGGYIKGMGMQEKYNSWAAAQYREKLAAECAGQPW  127

Query  534  --RDPPV  548
                PP 
Sbjct  128  SPSSPPA  134



>ref|XP_011473809.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X3 [Oryzias latipes]
Length=402

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L+D+++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W
Sbjct  8    RVLKDVRTQDENNLCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM+ GGN  F  F+  Q        +  KYN+KAA+++RD++  LA+GK W
Sbjct  68   KDIELEKMKAGGNGKFRLFLELQDDYDPNWTLQEKYNSKAAALFRDKVATLAEGKEW  124



>ref|XP_009561374.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1, partial [Cuculus canorus]
Length=209

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++  +A+
Sbjct  61   SVTMDKWKDIELEKMKAGGNRKFREFLESQDDYDPCWSMQEKYNSKAAALFRDQVATVAE  120

Query  522  GKPW  533
            GK W
Sbjct  121  GKEW  124



>ref|XP_006021706.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X2 [Alligator sinensis]
Length=409

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 92/127 (72%), Gaps = 5/127 (4%)
 Frame = +3

Query  168  KRMAASRR----LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHIS  335
            +R+ AS R    L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+S
Sbjct  4    QRIMASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLS  63

Query  336  FVRSVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQA  512
            FVRSVTMD W +I+L KM++GGN  F  F+ SQ        +  KYN+KAA+++RD++  
Sbjct  64   FVRSVTMDKWKDIELEKMKVGGNSKFREFLESQDDYDPCWSMPEKYNSKAAALFRDKVAT  123

Query  513  LADGKPW  533
            LA+GK W
Sbjct  124  LAEGKDW  130



>gb|KIR46360.1| ADP-ribosylation factor GTPase-activating protein 1 [Cryptococcus 
gattii CA1280]
Length=421

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 85/127 (67%), Gaps = 6/127 (5%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            + L  L +   NK+CVDCS  +PQWASVSYG+F+CLECSG HRG GVHISFVRS+TMD W
Sbjct  8    KELLALMNTGDNKVCVDCSALSPQWASVSYGIFICLECSGVHRGFGVHISFVRSITMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFISQY----GVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            S+ QL KM+ GGN+ F  F+  Y    G  K   +  KYN+ AA+ YR+++ A   G+PW
Sbjct  68   SDEQLNKMKTGGNEKFKDFMENYGPEGGYTKGMGMQEKYNSWAAAQYREKLAAECAGQPW  127

Query  534  --RDPPV  548
                PP 
Sbjct  128  SPSSPPA  134



>ref|XP_004586004.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X3 [Ochotona princeps]
Length=390

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 90/124 (73%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L++++ Q  N +C +C   NPQWASV+YGV++CLECSG+HRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRVQDDNNVCFECGAFNPQWASVTYGVWICLECSGRHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W E++L KM++GGN  F  F+ SQ        +  KYN++AA+++RD++  LA+
Sbjct  61   SVTMDKWKEVELEKMKVGGNAKFREFLESQEDYDPNWSLQDKYNSRAAALFRDKVATLAE  120

Query  522  GKPW  533
            G+ W
Sbjct  121  GRAW  124



>gb|KFO77782.1| ADP-ribosylation factor GTPase-activating protein 1, partial 
[Cuculus canorus]
Length=210

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++  +A+
Sbjct  61   SVTMDKWKDIELEKMKAGGNRKFREFLESQDDYDPCWSMQEKYNSKAAALFRDQVATVAE  120

Query  522  GKPW  533
            GK W
Sbjct  121  GKEW  124



>gb|ELT90952.1| hypothetical protein CAPTEDRAFT_222395 [Capitella teleta]
Length=468

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L+DL+ + GN  C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRS+TMD W
Sbjct  8    RALKDLKVRDGNSTCFECGAHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSITMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             + +L KM++GGN     F   Q        I  KYNT+AA++YRD+I   A+G+PW
Sbjct  68   KDAELEKMKVGGNLKARDFFEMQDDYSDNMSIQQKYNTRAAALYRDKISTEAEGRPW  124



>gb|KIR59556.1| ADP-ribosylation factor GTPase-activating protein 1 [Cryptococcus 
gattii CA1873]
Length=421

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 85/127 (67%), Gaps = 6/127 (5%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            + L  L +   NK+CVDCS  +PQWASVSYG+F+CLECSG HRG GVHISFVRS+TMD W
Sbjct  8    KELLALMNTGDNKVCVDCSALSPQWASVSYGIFICLECSGVHRGFGVHISFVRSITMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFISQY----GVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            S+ QL KM+ GGN+ F  F+  Y    G  K   +  KYN+ AA+ YR+++ A   G+PW
Sbjct  68   SDEQLNKMKTGGNEKFKDFMENYGPEGGYTKGMGMQEKYNSWAAAQYREKLAAECAGQPW  127

Query  534  --RDPPV  548
                PP 
Sbjct  128  SPSSPPA  134



>ref|XP_004586003.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X2 [Ochotona princeps]
Length=392

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 90/124 (73%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L++++ Q  N +C +C   NPQWASV+YGV++CLECSG+HRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRVQDDNNVCFECGAFNPQWASVTYGVWICLECSGRHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W E++L KM++GGN  F  F+ SQ        +  KYN++AA+++RD++  LA+
Sbjct  61   SVTMDKWKEVELEKMKVGGNAKFREFLESQEDYDPNWSLQDKYNSRAAALFRDKVATLAE  120

Query  522  GKPW  533
            G+ W
Sbjct  121  GRAW  124



>ref|XP_011473806.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X1 [Oryzias latipes]
 ref|XP_011473808.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X1 [Oryzias latipes]
Length=424

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L+D+++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W
Sbjct  8    RVLKDVRTQDENNLCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM+ GGN  F  F+  Q        +  KYN+KAA+++RD++  LA+GK W
Sbjct  68   KDIELEKMKAGGNGKFRLFLELQDDYDPNWTLQEKYNSKAAALFRDKVATLAEGKEW  124



>emb|CBJ25986.1| conserved unknown protein [Ectocarpus siliculosus]
Length=482

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 82/123 (67%), Gaps = 6/123 (5%)
 Frame = +3

Query  195  RDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEI  374
            R++++ PGN  CVDC   NPQWASVSYG   CLECSG+HRGLGVHISFVRS+TMDSWSE 
Sbjct  11   REIRALPGNTRCVDCGVANPQWASVSYGCVFCLECSGQHRGLGVHISFVRSITMDSWSEK  70

Query  375  QLRKMELGGNDNFNSFISQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW------R  536
            Q+  M  GGN     +   +GV  +  I  KY++ AA ++RDR+ A  +G+P       R
Sbjct  71   QINMMRAGGNQKLIDWFQSHGVTSDQRIAKKYHSPAAELFRDRLLATVEGRPLPTELPQR  130

Query  537  DPP  545
             PP
Sbjct  131  PPP  133



>ref|XP_005911153.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X4 [Bos mutus]
Length=395

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>ref|XP_006040558.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X6 [Bubalus bubalis]
Length=397

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>ref|XP_004586002.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X1 [Ochotona princeps]
Length=412

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 90/124 (73%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L++++ Q  N +C +C   NPQWASV+YGV++CLECSG+HRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRVQDDNNVCFECGAFNPQWASVTYGVWICLECSGRHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W E++L KM++GGN  F  F+ SQ        +  KYN++AA+++RD++  LA+
Sbjct  61   SVTMDKWKEVELEKMKVGGNAKFREFLESQEDYDPNWSLQDKYNSRAAALFRDKVATLAE  120

Query  522  GKPW  533
            G+ W
Sbjct  121  GRAW  124



>ref|XP_006040559.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X7 [Bubalus bubalis]
Length=395

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>ref|XP_005688339.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X6 [Capra hircus]
Length=395

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>ref|XP_002174427.1| GTPase activating protein [Schizosaccharomyces japonicus yFS275]
 gb|EEB08134.1| GTPase activating protein [Schizosaccharomyces japonicus yFS275]
Length=305

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 84/121 (69%), Gaps = 1/121 (1%)
 Frame = +3

Query  174  MAASRRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVT  353
            M++S+ L  +  Q GNK C DC   NPQWAS + G+F+CL+CSG+HRGLGV  SFVRSVT
Sbjct  1    MSSSKALDSIIQQSGNKKCFDCGTPNPQWASANLGIFICLDCSGQHRGLGVEKSFVRSVT  60

Query  354  MDSWSEIQLRKMELGGNDNFNSFISQY-GVPKETDIVTKYNTKAASVYRDRIQALADGKP  530
            MD+W+E Q++ +ELGGND    F++ Y        I  KYNT+AA  YR+++ AL DGK 
Sbjct  61   MDNWTERQIKCVELGGNDAARKFLNDYPEFVNAKSIKEKYNTEAAEDYREKLAALVDGKE  120

Query  531  W  533
            W
Sbjct  121  W  121



>ref|XP_008108396.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X8 [Anolis carolinensis]
Length=382

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L++++ Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++ ALA+
Sbjct  61   SVTMDKWKDIELEKMKAGGNHKFREFLESQEDYDPCWSLQEKYNSKAAALFRDKVAALAE  120

Query  522  GKPW  533
            GK W
Sbjct  121  GKEW  124



>ref|XP_005177691.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X2 [Musca domestica]
Length=464

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L++L+ Q  N  C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W
Sbjct  8    RVLQELKPQDDNSKCFECGTHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM++GGN N   F+  Q        I  KYN+KAA++YRD+I  LA GK W
Sbjct  68   KDIELEKMKVGGNRNAREFLEDQDDWNDRAPISQKYNSKAAALYRDKISTLAQGKTW  124



>ref|XP_003421812.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X1 [Loxodonta africana]
Length=416

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L++++ Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRVQDANNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++  LA+
Sbjct  61   SVTMDKWKDIELEKMKAGGNAKFREFLESQEDYDPSWSLQEKYNSKAAALFRDKVATLAE  120

Query  522  GKPW  533
            GK W
Sbjct  121  GKEW  124



>ref|XP_010125893.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1, partial [Chlamydotis macqueenii]
Length=249

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++  +A+
Sbjct  61   SVTMDKWKDIELEKMKAGGNSKFREFLESQDDYDPCWSMQEKYNSKAAALFRDQVATVAE  120

Query  522  GKPW  533
            GK W
Sbjct  121  GKEW  124



>ref|XP_006021705.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X1 [Alligator sinensis]
Length=436

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 92/127 (72%), Gaps = 5/127 (4%)
 Frame = +3

Query  168  KRMAASRR----LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHIS  335
            +R+ AS R    L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+S
Sbjct  4    QRIMASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLS  63

Query  336  FVRSVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQA  512
            FVRSVTMD W +I+L KM++GGN  F  F+ SQ        +  KYN+KAA+++RD++  
Sbjct  64   FVRSVTMDKWKDIELEKMKVGGNSKFREFLESQDDYDPCWSMPEKYNSKAAALFRDKVAT  123

Query  513  LADGKPW  533
            LA+GK W
Sbjct  124  LAEGKDW  130



>emb|CEP08064.1| hypothetical protein [Parasitella parasitica]
Length=430

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 84/131 (64%), Gaps = 1/131 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            ++L D+Q    NK C DC   NPQWAS+SYG+F+CL+CSG HR  GVHISFVRS+TMD W
Sbjct  8    KKLYDIQRTGENKNCFDCRAPNPQWASISYGIFICLDCSGIHRSFGVHISFVRSITMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDP  542
             + QL+KMELGGN+    F  SQ           KY T+AA +YRD++ A A+G+PW   
Sbjct  68   FDDQLKKMELGGNEKARIFFESQPDYSSNMTTQEKYQTQAAELYRDKLSAEAEGRPWTPT  127

Query  543  PVVKETLKGGA  575
            P  +   +  A
Sbjct  128  PSTRSAKQSSA  138



>ref|XP_005688338.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X5 [Capra hircus]
Length=397

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>ref|XP_008199322.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X2 [Tribolium castaneum]
Length=432

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 86/129 (67%), Gaps = 1/129 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L++L+    N  C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W
Sbjct  8    RVLQELKPHNENDKCFECGTHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDP  542
             +I+L KM++GGN N   F  +Q        I  KYNTKAA++YRD+I ALA GK W + 
Sbjct  68   KDIELEKMKVGGNRNARVFFEAQDDWDDHMSIQQKYNTKAAALYRDKIAALAQGKAWDEK  127

Query  543  PVVKETLKG  569
                +   G
Sbjct  128  SSPAQNYTG  136



>ref|XP_008108395.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X7 [Anolis carolinensis]
Length=392

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L++++ Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++ ALA+
Sbjct  61   SVTMDKWKDIELEKMKAGGNHKFREFLESQEDYDPCWSLQEKYNSKAAALFRDKVAALAE  120

Query  522  GKPW  533
            GK W
Sbjct  121  GKEW  124



>ref|XP_005177690.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X1 [Musca domestica]
Length=480

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L++L+ Q  N  C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W
Sbjct  8    RVLQELKPQDDNSKCFECGTHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM++GGN N   F+  Q        I  KYN+KAA++YRD+I  LA GK W
Sbjct  68   KDIELEKMKVGGNRNAREFLEDQDDWNDRAPISQKYNSKAAALYRDKISTLAQGKTW  124



>ref|XP_004014459.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 [Ovis aries]
Length=417

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>ref|XP_005911151.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X2 [Bos mutus]
Length=417

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>ref|XP_005688336.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X3 [Capra hircus]
Length=417

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>ref|XP_002021171.1| GL24958 [Drosophila persimilis]
 gb|EDW40327.1| GL24958 [Drosophila persimilis]
Length=441

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L++L+ Q  N  C +C   NPQW SV+YG+++CLECSGKHR LGVH+SFVRSVTMD W
Sbjct  8    RVLQELKPQDDNSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM+ GGN N   F+  Q    +   I  +YN+KAA++YRD+I ALA GK W
Sbjct  68   KDIELEKMKAGGNRNAREFLEDQADWSERAPITQRYNSKAAALYRDKIAALAQGKSW  124



>ref|XP_006040556.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X4 [Bubalus bubalis]
Length=407

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>ref|XP_008108394.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X6 [Anolis carolinensis]
Length=404

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L++++ Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++ ALA+
Sbjct  61   SVTMDKWKDIELEKMKAGGNHKFREFLESQEDYDPCWSLQEKYNSKAAALFRDKVAALAE  120

Query  522  GKPW  533
            GK W
Sbjct  121  GKEW  124



>ref|XP_005688337.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X4 [Capra hircus]
Length=405

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>ref|XP_008318298.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X3 [Cynoglossus semilaevis]
Length=394

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = +3

Query  183  SRR-LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMD  359
            SRR L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD
Sbjct  6    SRRVLKEVRTQDENNLCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMD  65

Query  360  SWSEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             W +I+L KM+ GGN  F  F+  Q       ++  KYN+KAA+++RD++  LA+GK W
Sbjct  66   KWKDIELEKMKAGGNGKFRLFLELQDDYDPTWNLQEKYNSKAAALFRDKVATLAEGKEW  124



>ref|XP_010834887.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 [Bison bison bison]
Length=417

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>ref|XP_006040555.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X3 [Bubalus bubalis]
Length=417

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>ref|XP_008199318.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X1 [Tribolium castaneum]
 gb|EEZ99649.1| hypothetical protein TcasGA2_TC002406 [Tribolium castaneum]
Length=433

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 86/129 (67%), Gaps = 1/129 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L++L+    N  C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W
Sbjct  8    RVLQELKPHNENDKCFECGTHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPWRDP  542
             +I+L KM++GGN N   F  +Q        I  KYNTKAA++YRD+I ALA GK W + 
Sbjct  68   KDIELEKMKVGGNRNARVFFEAQDDWDDHMSIQQKYNTKAAALYRDKIAALAQGKAWDEK  127

Query  543  PVVKETLKG  569
                +   G
Sbjct  128  SSPAQNYTG  136



>ref|XP_010599443.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X4 [Loxodonta africana]
Length=426

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 4/124 (3%)
 Frame = +3

Query  174  MAASRR---LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVR  344
            MA+ R    L++++ Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVR
Sbjct  1    MASPRTRKVLKEVRVQDANNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR  60

Query  345  SVTMDSWSEIQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALAD  521
            SVTMD W +I+L KM+ GGN  F  F+ SQ        +  KYN+KAA+++RD++  LA+
Sbjct  61   SVTMDKWKDIELEKMKAGGNAKFREFLESQEDYDPSWSLQEKYNSKAAALFRDKVATLAE  120

Query  522  GKPW  533
            GK W
Sbjct  121  GKEW  124



>ref|XP_005911152.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X3 [Bos mutus]
Length=405

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>gb|ABG81468.1| ADP-ribosylation factor GTPase activating protein 1 [Bos taurus]
Length=417

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>ref|XP_005688335.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X2 [Capra hircus]
Length=425

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



>ref|XP_008318295.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X1 [Cynoglossus semilaevis]
 ref|XP_008318296.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X1 [Cynoglossus semilaevis]
Length=416

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  RRLRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSW  365
            R L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W
Sbjct  8    RVLKEVRTQDENNLCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKW  67

Query  366  SEIQLRKMELGGNDNFNSFIS-QYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
             +I+L KM+ GGN  F  F+  Q       ++  KYN+KAA+++RD++  LA+GK W
Sbjct  68   KDIELEKMKAGGNGKFRLFLELQDDYDPTWNLQEKYNSKAAALFRDKVATLAEGKEW  124



>ref|XP_006040557.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
1 isoform X5 [Bubalus bubalis]
Length=405

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  LRDLQSQPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSE  371
            L+++++Q  N +C +C   NPQW SV+YG+++CLECSGKHRGLGVH+SFVRSVTMD W +
Sbjct  10   LKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKD  69

Query  372  IQLRKMELGGNDNFNSFI-SQYGVPKETDIVTKYNTKAASVYRDRIQALADGKPW  533
            ++L KM+ GGN  F  F+ SQ        +  KYN++AA+++RDR+ ALA+GK W
Sbjct  70   VELEKMKAGGNARFREFLESQEDYDPCWSLQEKYNSRAAALFRDRVAALAEGKEW  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750