BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF020F02

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009616694.1|  PREDICTED: phosphoethanolamine N-methyltrans...    246   2e-75   Nicotiana tomentosiformis
ref|XP_007209941.1|  hypothetical protein PRUPE_ppa004742mg             244   5e-75   
ref|XP_011084235.1|  PREDICTED: phosphoethanolamine N-methyltrans...    245   6e-75   Sesamum indicum [beniseed]
ref|XP_009757363.1|  PREDICTED: phosphoethanolamine N-methyltrans...    244   7e-75   Nicotiana sylvestris
ref|NP_001234549.1|  phosphoethanolamine N-methyltransferase            244   1e-74   Solanum lycopersicum
ref|XP_007209942.1|  hypothetical protein PRUPE_ppa004742mg             244   2e-74   Prunus persica
ref|XP_007209943.1|  hypothetical protein PRUPE_ppa004742mg             244   2e-74   
ref|XP_002282182.1|  PREDICTED: phosphomethylethanolamine N-methy...    243   3e-74   Vitis vinifera
ref|XP_009614862.1|  PREDICTED: phosphoethanolamine N-methyltrans...    243   3e-74   Nicotiana tomentosiformis
ref|XP_010533969.1|  PREDICTED: phosphomethylethanolamine N-methy...    243   4e-74   Tarenaya hassleriana [spider flower]
ref|XP_008240154.1|  PREDICTED: phosphoethanolamine N-methyltrans...    241   2e-73   
emb|CAN64744.1|  hypothetical protein VITISV_041321                     240   3e-73   Vitis vinifera
ref|XP_006341528.1|  PREDICTED: phosphoethanolamine N-methyltrans...    240   3e-73   Solanum tuberosum [potatoes]
ref|XP_008240152.1|  PREDICTED: phosphoethanolamine N-methyltrans...    240   4e-73   Prunus mume [ume]
ref|XP_010519218.1|  PREDICTED: phosphoethanolamine N-methyltrans...    240   6e-73   Tarenaya hassleriana [spider flower]
gb|AAP83582.1|  phosphoethanolamine N-methyltransferase                 239   1e-72   Brassica napus [oilseed rape]
ref|XP_011084227.1|  PREDICTED: phosphoethanolamine N-methyltrans...    239   1e-72   Sesamum indicum [beniseed]
ref|XP_010519219.1|  PREDICTED: phosphoethanolamine N-methyltrans...    239   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_011072995.1|  PREDICTED: phosphoethanolamine N-methyltrans...    238   2e-72   Sesamum indicum [beniseed]
ref|XP_009145948.1|  PREDICTED: phosphoethanolamine N-methyltrans...    238   2e-72   Brassica rapa
gb|KJB30121.1|  hypothetical protein B456_005G132000                    236   2e-72   Gossypium raimondii
ref|XP_008364653.1|  PREDICTED: phosphoethanolamine N-methyltrans...    238   2e-72   
ref|XP_010097563.1|  hypothetical protein L484_017373                   238   3e-72   
ref|XP_010487710.1|  PREDICTED: phosphoethanolamine N-methyltrans...    238   3e-72   Camelina sativa [gold-of-pleasure]
ref|XP_002532097.1|  phosphoethanolamine n-methyltransferase, put...    238   3e-72   Ricinus communis
ref|XP_010033717.1|  PREDICTED: phosphoethanolamine N-methyltrans...    238   4e-72   Eucalyptus grandis [rose gum]
ref|XP_010506242.1|  PREDICTED: phosphoethanolamine N-methyltrans...    238   4e-72   Camelina sativa [gold-of-pleasure]
gb|ABX10444.1|  phosphoethanolamine N-methyltransferase                 237   5e-72   Gossypium hirsutum [American cotton]
gb|KJB30119.1|  hypothetical protein B456_005G132000                    236   5e-72   Gossypium raimondii
gb|KHG16117.1|  Phosphoethanolamine N-methyltransferase 1 -like p...    236   8e-72   Gossypium arboreum [tree cotton]
gb|KJB30123.1|  hypothetical protein B456_005G132000                    236   8e-72   Gossypium raimondii
ref|XP_008360927.1|  PREDICTED: phosphoethanolamine N-methyltrans...    236   9e-72   
ref|XP_002883100.1|  N-methyltransferase 1                              236   1e-71   
ref|XP_010465872.1|  PREDICTED: phosphoethanolamine N-methyltrans...    236   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_004299531.1|  PREDICTED: phosphomethylethanolamine N-methy...    236   2e-71   Fragaria vesca subsp. vesca
ref|XP_002891445.1|  hypothetical protein ARALYDRAFT_473996             236   2e-71   
emb|CDO98349.1|  unnamed protein product                                236   2e-71   Coffea canephora [robusta coffee]
ref|NP_973993.1|  phosphoethanolamine N-methyltransferase 2             236   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KJB30117.1|  hypothetical protein B456_005G132000                    235   3e-71   Gossypium raimondii
ref|XP_009356042.1|  PREDICTED: phosphoethanolamine N-methyltrans...    235   3e-71   Pyrus x bretschneideri [bai li]
gb|AAM13092.1|  unknown protein                                         235   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188427.2|  phosphoethanolamine N-methyltransferase 1             235   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487709.1|  PREDICTED: phosphoethanolamine N-methyltrans...    235   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006406666.1|  hypothetical protein EUTSA_v10020595mg             235   4e-71   Eutrema salsugineum [saltwater cress]
gb|KJB30122.1|  hypothetical protein B456_005G132000                    235   4e-71   Gossypium raimondii
ref|XP_006297517.1|  hypothetical protein CARUB_v10013541mg             235   4e-71   Capsella rubella
dbj|BAB02720.1|  methyl transferase-like protein                        235   4e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008393424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    234   5e-71   
ref|XP_009360079.1|  PREDICTED: phosphoethanolamine N-methyltrans...    234   5e-71   Pyrus x bretschneideri [bai li]
ref|XP_010506234.1|  PREDICTED: phosphoethanolamine N-methyltrans...    234   5e-71   Camelina sativa [gold-of-pleasure]
ref|XP_004252273.1|  PREDICTED: phosphomethylethanolamine N-methy...    234   5e-71   Solanum lycopersicum
ref|XP_007036802.1|  S-adenosyl-L-methionine-dependent methyltran...    234   7e-71   
ref|XP_007036803.1|  S-adenosyl-L-methionine-dependent methyltran...    234   7e-71   
ref|XP_006376718.1|  hypothetical protein POPTR_0012s044902g            223   1e-70   
ref|XP_010263678.1|  PREDICTED: phosphoethanolamine N-methyltrans...    233   1e-70   Nelumbo nucifera [Indian lotus]
gb|EYU33965.1|  hypothetical protein MIMGU_mgv1a005263mg                233   1e-70   Erythranthe guttata [common monkey flower]
gb|KDP23922.1|  hypothetical protein JCGZ_27082                         234   2e-70   Jatropha curcas
ref|XP_009776424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    233   2e-70   Nicotiana sylvestris
ref|XP_006303987.1|  hypothetical protein CARUB_v10008968mg             233   2e-70   Capsella rubella
gb|AFK34653.1|  unknown                                                 224   2e-70   Lotus japonicus
gb|KFK36082.1|  hypothetical protein AALP_AA4G075100                    233   2e-70   Arabis alpina [alpine rockcress]
dbj|BAD80838.1|  phosphoethanolamine N-methyltransferase                233   2e-70   Atriplex nummularia
gb|AER10512.1|  phosphoethanolamine N-methyltransferase                 233   3e-70   Pyrus betulifolia
ref|XP_009147956.1|  PREDICTED: phosphomethylethanolamine N-methy...    232   4e-70   Brassica rapa
gb|KFK39125.1|  hypothetical protein AALP_AA3G204100                    232   4e-70   Arabis alpina [alpine rockcress]
ref|XP_006346642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    233   4e-70   Solanum tuberosum [potatoes]
gb|EPS65842.1|  hypothetical protein M569_08933                         232   4e-70   Genlisea aurea
ref|XP_009104804.1|  PREDICTED: phosphoethanolamine N-methyltrans...    232   9e-70   Brassica rapa
emb|CDX68222.1|  BnaA07g22620D                                          232   9e-70   
gb|KDO63824.1|  hypothetical protein CISIN_1g043471mg                   231   1e-69   Citrus sinensis [apfelsine]
dbj|BAC57960.1|  phosphoethanolamine N-methyltransferase                231   2e-69   Tripolium pannonicum [sea starwort]
gb|AEY75253.1|  phosphoethanolamine N-methyltransferase                 231   2e-69   Atriplex canescens [shadscale]
ref|XP_010274723.1|  PREDICTED: phosphomethylethanolamine N-methy...    230   2e-69   Nelumbo nucifera [Indian lotus]
ref|XP_006490771.1|  PREDICTED: phosphoethanolamine N-methyltrans...    230   2e-69   
dbj|BAD93609.1|  hypothetical protein                                   222   2e-69   Cucumis melo [Oriental melon]
ref|XP_006451624.1|  hypothetical protein CICLE_v10010749mg             230   2e-69   Citrus clementina [clementine]
gb|AGI56231.1|  phosphoethanolamine N-methyltransferase                 231   2e-69   Lycium barbarum [Duke of Argyll's teatree]
gb|AFW83641.1|  hypothetical protein ZEAMMB73_560974                    223   2e-69   
ref|XP_010461752.1|  PREDICTED: phosphomethylethanolamine N-methy...    230   3e-69   Camelina sativa [gold-of-pleasure]
pir||H96762  hypothetical protein F6D5.1 [imported] - Arabidopsis...    231   4e-69
ref|XP_010097561.1|  Phosphoethanolamine N-methyltransferase 1          230   5e-69   
ref|XP_010461683.1|  PREDICTED: phosphomethylethanolamine N-methy...    229   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_003528975.2|  PREDICTED: phosphoethanolamine N-methyltrans...    230   6e-69   
emb|CDY11100.1|  BnaC06g23520D                                          229   6e-69   Brassica napus [oilseed rape]
sp|Q9M571.1|PEAMT_SPIOL  RecName: Full=Phosphoethanolamine N-meth...    229   1e-68   Spinacia oleracea
ref|XP_010686587.1|  PREDICTED: phosphoethanolamine N-methyltrans...    228   1e-68   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAE07178.1|  phosphoethanolamine N-methyltransferase                228   1e-68   Beta vulgaris [beet]
ref|XP_009782224.1|  PREDICTED: phosphoethanolamine N-methyltrans...    228   1e-68   Nicotiana sylvestris
ref|XP_011014101.1|  PREDICTED: phosphomethylethanolamine N-methy...    228   2e-68   Populus euphratica
ref|XP_011039130.1|  PREDICTED: phosphomethylethanolamine N-methy...    228   2e-68   Populus euphratica
gb|KDP23923.1|  hypothetical protein JCGZ_27083                         228   3e-68   Jatropha curcas
ref|XP_008799221.1|  PREDICTED: phosphomethylethanolamine N-methy...    228   3e-68   Phoenix dactylifera
gb|EYU24136.1|  hypothetical protein MIMGU_mgv1a005261mg                227   3e-68   Erythranthe guttata [common monkey flower]
ref|XP_008799219.1|  PREDICTED: phosphomethylethanolamine N-methy...    227   6e-68   Phoenix dactylifera
gb|AAM97038.1|  phosphoethanolamine N-methyltransferase, putative       223   7e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177501.2|  putative phosphoethanolamine N-methyltransferase 3    226   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010678114.1|  PREDICTED: phosphoethanolamine N-methyltrans...    226   1e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008799258.1|  PREDICTED: phosphomethylethanolamine N-methy...    225   1e-67   
ref|XP_007152684.1|  hypothetical protein PHAVU_004G150500g             226   1e-67   Phaseolus vulgaris [French bean]
ref|XP_006390538.1|  hypothetical protein EUTSA_v10018431mg             226   1e-67   Eutrema salsugineum [saltwater cress]
gb|EMT21187.1|  Phosphoethanolamine N-methyltransferase 1               226   2e-67   
ref|XP_006843796.1|  hypothetical protein AMTR_s00007p00250490          225   2e-67   Amborella trichopoda
gb|ACV89824.1|  S-adenosyl-L-methionine:phosphoethanolamine N-met...    226   2e-67   Triticum aestivum [Canadian hard winter wheat]
emb|CDM83845.1|  unnamed protein product                                226   2e-67   Triticum aestivum [Canadian hard winter wheat]
gb|EMS54147.1|  Phosphoethanolamine N-methyltransferase 1               226   2e-67   Triticum urartu
ref|XP_004161835.1|  PREDICTED: phosphoethanolamine N-methyltrans...    226   2e-67   
ref|XP_004503268.1|  PREDICTED: phosphoethanolamine N-methyltrans...    225   2e-67   Cicer arietinum [garbanzo]
ref|XP_003569614.1|  PREDICTED: phosphoethanolamine N-methyltrans...    225   2e-67   Brachypodium distachyon [annual false brome]
ref|XP_011008809.1|  PREDICTED: phosphomethylethanolamine N-methy...    225   2e-67   Populus euphratica
ref|XP_011008808.1|  PREDICTED: phosphomethylethanolamine N-methy...    225   3e-67   Populus euphratica
ref|XP_008464197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    225   3e-67   Cucumis melo [Oriental melon]
ref|XP_006644536.1|  PREDICTED: phosphoethanolamine N-methyltrans...    225   3e-67   Oryza brachyantha
gb|ACJ83326.1|  unknown                                                 217   3e-67   Medicago truncatula
ref|XP_010416170.1|  PREDICTED: phosphoethanolamine N-methyltrans...    224   3e-67   Camelina sativa [gold-of-pleasure]
ref|XP_002322102.2|  hypothetical protein POPTR_0015s04540g             225   4e-67   
dbj|BAH01482.1|  unnamed protein product                                224   4e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009595958.1|  PREDICTED: phosphoethanolamine N-methyltrans...    224   5e-67   Nicotiana tomentosiformis
ref|XP_010428286.1|  PREDICTED: phosphoethanolamine N-methyltrans...    224   5e-67   Camelina sativa [gold-of-pleasure]
gb|KEH21430.1|  phosphoethanolamine N-methyltransferase                 223   5e-67   Medicago truncatula
gb|KEH21429.1|  phosphoethanolamine N-methyltransferase                 223   5e-67   Medicago truncatula
gb|AAF79704.1|AC020889_12  T1N15.22                                     214   6e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137500.1|  PREDICTED: phosphoethanolamine N-methyltrans...    224   7e-67   Cucumis sativus [cucumbers]
ref|XP_003631125.1|  Phosphoethanolamine N-methyltransferase            223   1e-66   
dbj|BAJ97525.1|  predicted protein                                      223   1e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003631124.1|  Phosphoethanolamine N-methyltransferase            223   2e-66   
gb|AET05600.2|  phosphoethanolamine N-methyltransferase                 223   2e-66   Medicago truncatula
gb|AAS57723.1|  phosphoethanolamine N-methyltransferase                 223   2e-66   Oryza sativa [red rice]
ref|NP_001043957.1|  Os01g0695100                                       223   2e-66   
ref|XP_002887491.1|  predicted protein                                  223   2e-66   
ref|NP_001148925.1|  LOC100282545                                       223   2e-66   Zea mays [maize]
gb|EEE55232.1|  hypothetical protein OsJ_03109                          223   2e-66   Oryza sativa Japonica Group [Japonica rice]
gb|KFK41794.1|  hypothetical protein AALP_AA2G173000                    223   2e-66   Arabis alpina [alpine rockcress]
ref|NP_974139.2|  putative phosphoethanolamine N-methyltransferase 3    223   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302164.1|  hypothetical protein CARUB_v10020173mg             223   3e-66   Capsella rubella
ref|XP_002456194.1|  hypothetical protein SORBIDRAFT_03g031950          222   4e-66   Sorghum bicolor [broomcorn]
ref|XP_006365411.1|  PREDICTED: phosphoethanolamine N-methyltrans...    222   5e-66   Solanum tuberosum [potatoes]
ref|XP_010471422.1|  PREDICTED: phosphoethanolamine N-methyltrans...    221   5e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010921161.1|  PREDICTED: phosphoethanolamine N-methyltrans...    221   5e-66   Elaeis guineensis
ref|XP_003567962.1|  PREDICTED: phosphomethylethanolamine N-methy...    222   5e-66   Brachypodium distachyon [annual false brome]
ref|XP_004969638.1|  PREDICTED: phosphoethanolamine N-methyltrans...    222   5e-66   Setaria italica
gb|AFW83642.1|  phosphoethanolamine N-methyltransferase                 222   6e-66   
ref|XP_004166029.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    221   6e-66   
ref|XP_004137341.1|  PREDICTED: phosphoethanolamine N-methyltrans...    221   8e-66   Cucumis sativus [cucumbers]
dbj|BAE99185.1|  putative phosphoethanolamine N-methyltransferase       221   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385384.1|  PREDICTED: phosphoethanolamine N-methyltrans...    221   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010921197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    221   1e-65   Elaeis guineensis
ref|XP_004961340.1|  PREDICTED: phosphoethanolamine N-methyltrans...    221   1e-65   Setaria italica
ref|XP_008453479.1|  PREDICTED: phosphoethanolamine N-methyltrans...    220   2e-65   Cucumis melo [Oriental melon]
ref|XP_010471421.1|  PREDICTED: phosphoethanolamine N-methyltrans...    220   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009404071.1|  PREDICTED: phosphomethylethanolamine N-methy...    220   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004512744.1|  PREDICTED: phosphoethanolamine N-methyltrans...    220   2e-65   Cicer arietinum [garbanzo]
ref|XP_006393388.1|  hypothetical protein EUTSA_v10012068mg             213   3e-65   
ref|XP_006655550.1|  PREDICTED: phosphoethanolamine N-methyltrans...    219   3e-65   Oryza brachyantha
ref|XP_010428285.1|  PREDICTED: phosphoethanolamine N-methyltrans...    219   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_003534138.1|  PREDICTED: phosphoethanolamine N-methyltrans...    219   3e-65   
ref|XP_010921188.1|  PREDICTED: phosphoethanolamine N-methyltrans...    220   3e-65   
dbj|BAC57432.1|  phosphoethanolamine N-methyltransferase                218   8e-65   Suaeda japonica
gb|AFW04224.1|  phosphoethanolamine N-methyl transferase                218   8e-65   Suaeda maritima
gb|ABK42071.1|  phosphoethanolamine N-methyltransferase                 218   1e-64   Suaeda liaotungensis
ref|XP_002441466.1|  hypothetical protein SORBIDRAFT_09g027360          218   1e-64   Sorghum bicolor [broomcorn]
ref|NP_001169597.1|  uncharacterized LOC100383478                       218   2e-64   Zea mays [maize]
ref|XP_004512745.1|  PREDICTED: phosphoethanolamine N-methyltrans...    218   2e-64   Cicer arietinum [garbanzo]
ref|XP_008799222.1|  PREDICTED: phosphomethylethanolamine N-methy...    217   2e-64   
dbj|BAG50404.1|  methyltransferase                                      206   3e-64   Cardamine sp. SIM-2007
ref|XP_004241642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    217   3e-64   Solanum lycopersicum
ref|XP_004969637.1|  PREDICTED: phosphoethanolamine N-methyltrans...    216   1e-63   Setaria italica
gb|ABG57185.1|  phosphoethanolamine N-methyltransferase                 215   1e-63   Salicornia europaea [chicken-claws]
ref|XP_003619836.1|  Phosphoethanolamine N-methyltransferase            215   1e-63   Medicago truncatula
ref|NP_175293.1|  phosphoethanolamine N-methyltransferase 2             214   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002317875.2|  Phosphoethanolamine N-methyltransferase 1 fa...    203   3e-63   
emb|CDX93681.1|  BnaA06g03670D                                          213   5e-63   
emb|CDY40594.1|  BnaC06g02100D                                          213   7e-63   Brassica napus [oilseed rape]
ref|XP_006393387.1|  hypothetical protein EUTSA_v10011451mg             213   9e-63   
ref|XP_003525185.1|  PREDICTED: phosphoethanolamine N-methyltrans...    210   9e-62   
ref|XP_010461685.1|  PREDICTED: phosphomethylethanolamine N-methy...    203   9e-62   Camelina sativa [gold-of-pleasure]
ref|XP_007160542.1|  hypothetical protein PHAVU_002G330400g             210   1e-61   Phaseolus vulgaris [French bean]
ref|XP_007160543.1|  hypothetical protein PHAVU_002G330400g             211   1e-61   Phaseolus vulgaris [French bean]
ref|XP_002456193.1|  hypothetical protein SORBIDRAFT_03g031940          209   2e-61   Sorghum bicolor [broomcorn]
ref|XP_008675146.1|  PREDICTED: phosphoethanolamine N-methyltrans...    209   4e-61   Zea mays [maize]
gb|AFZ78648.1|  methyl transferase                                      208   5e-61   Populus tomentosa [Chinese white poplar]
ref|XP_008675144.1|  PREDICTED: phosphoethanolamine N-methyltrans...    209   5e-61   
tpg|DAA57997.1|  TPA: putative phosphoethanolamine N-methyltransf...    208   6e-61   
gb|AAV67950.1|  putative phosphoethanolamine N-methyltransferase        208   6e-61   Zea mays [maize]
gb|AAL40895.1|  phosphoethanolamine methyltransferase                   208   8e-61   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010500398.1|  PREDICTED: phosphomethylethanolamine N-methy...    204   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010921205.1|  PREDICTED: phosphoethanolamine N-methyltrans...    203   6e-59   
gb|KJB53041.1|  hypothetical protein B456_008G289900                    202   6e-59   Gossypium raimondii
gb|KJB53038.1|  hypothetical protein B456_008G289900                    201   2e-58   Gossypium raimondii
gb|KJB53039.1|  hypothetical protein B456_008G289900                    201   2e-58   Gossypium raimondii
gb|KJB53040.1|  hypothetical protein B456_008G289900                    201   2e-58   Gossypium raimondii
ref|XP_001763293.1|  predicted protein                                  201   5e-58   
emb|CDX92181.1|  BnaA05g22260D                                          199   7e-58   
ref|XP_002284594.1|  PREDICTED: phosphoethanolamine N-methyltrans...    199   1e-57   Vitis vinifera
ref|XP_002454522.1|  hypothetical protein SORBIDRAFT_04g032625          187   5e-57   
gb|KJB30120.1|  hypothetical protein B456_005G132000                    197   8e-57   Gossypium raimondii
ref|XP_010655650.1|  PREDICTED: phosphomethylethanolamine N-methy...    197   2e-56   Vitis vinifera
gb|EEC79642.1|  hypothetical protein OsI_20868                          194   1e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_006306318.1|  hypothetical protein CARUB_v10012188mg             189   4e-55   
emb|CDX95799.1|  BnaC05g35500D                                          190   3e-54   
gb|ABK24808.1|  unknown                                                 189   7e-54   Picea sitchensis
ref|XP_001768934.1|  predicted protein                                  187   2e-53   
ref|XP_002969650.1|  hypothetical protein SELMODRAFT_146547             186   1e-52   Selaginella moellendorffii
ref|XP_002970912.1|  hypothetical protein SELMODRAFT_270875             186   1e-52   Selaginella moellendorffii
ref|XP_006303561.1|  hypothetical protein CARUB_v10011038mg             179   8e-50   
gb|KHN10536.1|  Phosphoethanolamine N-methyltransferase                 178   9e-50   Glycine soja [wild soybean]
emb|CBI26879.3|  unnamed protein product                                177   2e-49   Vitis vinifera
gb|AGO59019.1|  heat responsive transcription factor protein            177   2e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010540184.1|  PREDICTED: phosphoethanolamine N-methyltrans...    176   5e-49   Tarenaya hassleriana [spider flower]
gb|KDD75565.1|  hypothetical protein H632_c615p0                        168   1e-47   Helicosporidium sp. ATCC 50920
gb|KIZ00652.1|  hypothetical protein MNEG_7307                          166   4e-47   Monoraphidium neglectum
gb|EPS69227.1|  hypothetical protein M569_05544                         166   4e-46   Genlisea aurea
ref|XP_011399976.1|  Phosphoethanolamine N-methyltransferase            166   4e-45   Auxenochlorella protothecoides
ref|XP_002730517.1|  PREDICTED: phosphoethanolamine N-methyltrans...    156   3e-44   Saccoglossus kowalevskii
ref|XP_002594091.1|  hypothetical protein BRAFLDRAFT_68467              158   3e-44   Branchiostoma floridae
gb|EAY75471.1|  hypothetical protein OsI_03371                          161   2e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_010231068.1|  PREDICTED: phosphomethylethanolamine N-methy...    161   3e-43   Brachypodium distachyon [annual false brome]
ref|XP_004166030.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    160   5e-43   
ref|XP_004137342.1|  PREDICTED: phosphoethanolamine N-methyltrans...    160   6e-43   Cucumis sativus [cucumbers]
ref|XP_002594077.1|  hypothetical protein BRAFLDRAFT_68483              155   7e-43   Branchiostoma floridae
ref|XP_002594089.1|  hypothetical protein BRAFLDRAFT_118790             159   3e-42   Branchiostoma floridae
ref|XP_009011308.1|  hypothetical protein HELRODRAFT_71964              151   7e-42   Helobdella robusta
ref|XP_005643867.1|  S-adenosyl-L-methionine-dependent methyltran...    155   5e-41   Coccomyxa subellipsoidea C-169
ref|XP_008324912.1|  PREDICTED: phosphoethanolamine N-methyltrans...    151   1e-39   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005096334.1|  PREDICTED: phosphoethanolamine N-methyltrans...    151   1e-39   Aplysia californica
ref|XP_008324913.1|  PREDICTED: phosphoethanolamine N-methyltrans...    151   1e-39   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008324914.1|  PREDICTED: phosphoethanolamine N-methyltrans...    151   1e-39   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008418601.1|  PREDICTED: phosphoethanolamine N-methyltrans...    150   3e-39   Poecilia reticulata
ref|XP_008418600.1|  PREDICTED: phosphoethanolamine N-methyltrans...    150   3e-39   Poecilia reticulata
ref|XP_007550439.1|  PREDICTED: phosphoethanolamine N-methyltrans...    150   4e-39   Poecilia formosa
ref|XP_006003521.1|  PREDICTED: phosphoethanolamine N-methyltrans...    144   9e-39   
ref|XP_005806845.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   1e-38   Xiphophorus maculatus
gb|AHY01341.1|  phosphoethanolamine methyltransferase                   141   2e-38   Carassius gibelio [gibel carp]
ref|XP_005096335.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   3e-38   Aplysia californica
ref|NP_001096276.2|  phosphoethanolamine methyltransferase              147   3e-38   Xenopus tropicalis [western clawed frog]
ref|XP_008453688.1|  PREDICTED: phosphoethanolamine N-methyltrans...    140   5e-38   Cucumis melo [Oriental melon]
ref|XP_010864863.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   5e-38   Esox lucius
ref|XP_005723169.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   6e-38   Pundamilia nyererei
ref|XP_005723168.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   6e-38   
ref|XP_005723167.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   6e-38   Pundamilia nyererei
ref|XP_008278560.1|  PREDICTED: phosphoethanolamine N-methyltrans...    146   7e-38   Stegastes partitus
ref|XP_008278559.1|  PREDICTED: phosphoethanolamine N-methyltrans...    146   8e-38   Stegastes partitus
gb|ETM43048.1|  hypothetical protein L914_11412                         142   8e-38   Phytophthora parasitica
gb|EWM27854.1|  phosphoethanolamine n-methyltransferase                 146   1e-37   Nannochloropsis gaditana
ref|XP_006781399.1|  PREDICTED: phosphoethanolamine N-methyltrans...    146   1e-37   Neolamprologus brichardi [lyretail cichlid]
ref|NP_001167350.1|  phosphoethanolamine N-methyltransferase 3          146   1e-37   Salmo salar
ref|XP_008872791.1|  hypothetical protein H310_08714                    145   2e-37   Aphanomyces invadans
gb|EMT23240.1|  Phosphoethanolamine N-methyltransferase 1               145   2e-37   
gb|ETK83171.1|  hypothetical protein L915_11577                         139   2e-37   Phytophthora parasitica
ref|XP_004545582.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   2e-37   
ref|NP_001070105.1|  phosphoethanolamine methyltransferase              145   2e-37   Danio rerio [leopard danio]
ref|XP_004545581.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   2e-37   
ref|XP_005913451.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   2e-37   Haplochromis burtoni
ref|XP_005913450.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   2e-37   Haplochromis burtoni
ref|XP_005467627.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   3e-37   Oreochromis niloticus
ref|XP_003444639.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   3e-37   Oreochromis niloticus
ref|XP_005467629.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   3e-37   Oreochromis niloticus
ref|XP_009832411.1|  hypothetical protein H257_08283                    145   3e-37   Aphanomyces astaci
gb|KDO18851.1|  hypothetical protein SPRG_15850                         144   6e-37   Saprolegnia parasitica CBS 223.65
ref|XP_005855505.1|  phosphoethanolamine n-methyltransferase            144   6e-37   Nannochloropsis gaditana CCMP526
ref|XP_008620239.1|  hypothetical protein SDRG_15833                    144   6e-37   Saprolegnia diclina VS20
gb|AAI35513.1|  LOC100124841 protein                                    144   8e-37   Xenopus tropicalis [western clawed frog]
gb|ETL36539.1|  hypothetical protein L916_11495                         139   8e-37   Phytophthora parasitica
ref|XP_010730439.1|  PREDICTED: phosphomethylethanolamine N-methy...    143   9e-37   
ref|XP_010730440.1|  PREDICTED: phosphomethylethanolamine N-methy...    143   9e-37   
ref|XP_002898137.1|  phosphoethanolamine N-methyltransferase, put...    143   1e-36   Phytophthora infestans T30-4
ref|NP_001087172.1|  phosphoethanolamine methyltransferase              142   3e-36   Xenopus laevis [clawed frog]
ref|XP_009061459.1|  hypothetical protein LOTGIDRAFT_219756             142   4e-36   Lottia gigantea
ref|XP_004073222.1|  PREDICTED: phosphoethanolamine N-methyltrans...    140   1e-35   
ref|XP_003970259.1|  PREDICTED: phosphoethanolamine N-methyltrans...    140   2e-35   
ref|XP_007440631.1|  PREDICTED: phosphomethylethanolamine N-methy...    139   2e-35   
gb|ETI43103.1|  hypothetical protein F443_11871                         133   8e-35   Phytophthora parasitica P1569
gb|EMT23241.1|  Phosphoethanolamine N-methyltransferase 1               138   1e-34   
emb|CAG09731.1|  unnamed protein product                                137   2e-34   Tetraodon nigroviridis
gb|ETP40954.1|  hypothetical protein F442_11792                         133   2e-34   Phytophthora parasitica P10297
gb|ETP27600.1|  hypothetical protein F442_23122                         133   2e-34   Phytophthora parasitica P10297
gb|EMT23242.1|  Putative phosphoethanolamine N-methyltransferase 2      134   3e-34   
ref|XP_010655490.1|  PREDICTED: phosphomethylethanolamine N-methy...    135   5e-34   Vitis vinifera
emb|CBI26877.3|  unnamed protein product                                135   6e-34   Vitis vinifera
gb|ETL89752.1|  hypothetical protein L917_11366                         133   1e-33   Phytophthora parasitica
gb|ETK83144.1|  hypothetical protein L915_11579                         133   2e-33   
emb|CAN75113.1|  hypothetical protein VITISV_043577                     133   4e-33   
gb|ELU13998.1|  hypothetical protein CAPTEDRAFT_140071                  127   4e-33   
emb|CCI39434.1|  unnamed protein product                                132   6e-33   
ref|XP_009525377.1|  hypothetical protein PHYSODRAFT_354467             130   8e-33   
gb|ELU02022.1|  hypothetical protein CAPTEDRAFT_91785                   126   3e-32   
ref|XP_002898136.1|  phosphoethanolamine N-methyltransferase            130   5e-32   
emb|CCA16454.1|  phosphoethanolamine Nmethyltransferase putative        130   5e-32   
ref|XP_009525359.1|  hypothetical protein PHYSODRAFT_345888             130   7e-32   
ref|XP_011453570.1|  PREDICTED: phosphoethanolamine N-methyltrans...    127   5e-31   
ref|XP_011453569.1|  PREDICTED: phosphoethanolamine N-methyltrans...    127   7e-31   
ref|XP_011453571.1|  PREDICTED: phosphoethanolamine N-methyltrans...    126   1e-30   
gb|ELT87122.1|  hypothetical protein CAPTEDRAFT_189076                  126   1e-30   
gb|EYC44164.1|  hypothetical protein Y032_0470g2031                     124   6e-30   
gb|ETN83758.1|  methyltransferase domain protein                        124   6e-30   
emb|CDJ81011.1|  Methyltransferase type 11 domain containing protein    124   8e-30   
gb|KFM80232.1|  Phosphoethanolamine N-methyltransferase                 118   4e-29   
ref|NP_494991.1|  Protein PMT-1, isoform b                              121   5e-29   
gb|EFX73213.1|  hypothetical protein DAPPUDRAFT_58148                   120   1e-28   
ref|XP_003108788.1|  CRE-PMT-1 protein                                  120   1e-28   
ref|XP_010677350.1|  PREDICTED: phosphoethanolamine N-methyltrans...    120   1e-28   
ref|NP_494990.2|  Protein PMT-1, isoform a                              120   2e-28   
ref|NP_871998.1|  Protein PMT-1, isoform d                              120   2e-28   
ref|XP_002630685.1|  C. briggsae CBR-PMT-1 protein                      119   4e-28   
gb|EGT50464.1|  hypothetical protein CAEBREN_10892                      119   5e-28   
gb|EGT32041.1|  hypothetical protein CAEBREN_18341                      119   5e-28   
emb|CDQ92053.1|  unnamed protein product                                112   8e-28   
ref|XP_006824126.1|  PREDICTED: phosphoethanolamine N-methyltrans...    111   5e-27   
pdb|4KRG|A  Chain A, Semet Haemonchus Contortus Phosphoethanolami...    115   1e-26   
ref|XP_009862400.1|  PREDICTED: phosphoethanolamine N-methyltrans...    111   1e-26   
gb|ERG79882.1|  phosphoethanolamine n-methyltransferase                 110   4e-25   
gb|EKE08147.1|  Phosphoethanolamine N-methyltransferase                 106   8e-25   
ref|XP_010481025.1|  PREDICTED: phosphomethylethanolamine N-methy...    104   4e-23   
gb|ETO35874.1|  phosphoethanolamine N-methyltransferase 2 (NMT2)        101   2e-22   
emb|CDM83854.1|  unnamed protein product                              99.8    2e-21   
emb|CDY07952.1|  BnaC03g35710D                                        96.7    2e-20   
emb|CDX74572.1|  BnaA04g08170D                                        94.4    2e-19   
ref|XP_011403472.1|  PREDICTED: phosphoethanolamine N-methyltrans...  94.4    4e-19   
ref|WP_027370305.1|  hypothetical protein                             87.8    7e-18   
emb|CDY35847.1|  BnaC09g37790D                                        88.2    2e-17   
ref|WP_020209191.1|  hypothetical protein                             88.6    5e-17   
emb|CEF71262.1|  Protein of unknown function DUF858, methyltransf...  87.8    8e-17   
ref|WP_013610264.1|  Putative SAM-dependent methyltransferase         84.0    2e-16   
ref|XP_794381.2|  PREDICTED: phosphoethanolamine N-methyltransfer...  83.6    3e-15   
gb|ETO07474.1|  hypothetical protein RFI_29918                        79.3    6e-15   
ref|XP_008908105.1|  hypothetical protein PPTG_12690                  78.2    6e-15   
gb|ETO01952.1|  hypothetical protein RFI_35487                        78.2    7e-15   
gb|ETO71745.1|  hypothetical protein F444_11961                       78.6    1e-14   
ref|XP_007228349.1|  PREDICTED: phosphoethanolamine N-methyltrans...  80.5    4e-14   
ref|XP_010774827.1|  PREDICTED: phosphoethanolamine N-methyltrans...  77.8    2e-13   
gb|AFK40181.1|  unknown                                               71.6    3e-13   
gb|KHJ94304.1|  hypothetical protein OESDEN_05765                     76.6    3e-13   
gb|AFW78992.1|  hypothetical protein ZEAMMB73_932976                  72.4    5e-13   
gb|ETO71769.1|  hypothetical protein F444_11956                       68.9    5e-12   
gb|EMT23239.1|  hypothetical protein F775_30181                       68.9    5e-12   
gb|ETP40963.1|  hypothetical protein F442_11783                       68.9    6e-12   
emb|CEF71482.1|  Protein of unknown function DUF858, methyltransf...  72.8    1e-11   
gb|KFG31924.1|  methyltransferase domain-containing protein           71.2    3e-11   
ref|XP_002370184.1|  calpain, putative                                71.2    4e-11   
emb|CAJ20397.1|  hypothetical protein TgIa.1450                       71.2    4e-11   
gb|KFG59470.1|  methyltransferase domain-containing protein           71.2    4e-11   
gb|KFH03254.1|  methyltransferase domain-containing protein           71.2    4e-11   
ref|XP_010314226.1|  PREDICTED: phosphoethanolamine N-methyltrans...  68.6    2e-10   
ref|XP_008884763.1|  methyltransferase domain-containing protein      67.8    6e-10   
ref|WP_038474864.1|  hypothetical protein                             63.5    3e-09   
gb|AFK44813.1|  unknown                                               60.5    1e-08   
ref|WP_017004055.1|  hypothetical protein                             60.5    6e-08   
ref|WP_016959600.1|  hypothetical protein                             60.5    6e-08   
ref|WP_038589229.1|  methyltransferase type 11                        59.7    7e-08   
ref|WP_042231279.1|  methyltransferase type 11                        59.3    9e-08   
ref|WP_029535633.1|  methyltransferase type 11                        58.9    1e-07   
gb|ETL89780.1|  hypothetical protein L917_11359                       55.5    2e-07   
ref|WP_028552340.1|  methyltransferase type 11                        58.5    2e-07   
ref|WP_030923479.1|  hypothetical protein                             58.9    2e-07   
gb|KIH63696.1|  hypothetical protein ANCDUO_06001                     55.5    3e-07   
ref|WP_042175094.1|  methyltransferase type 11                        57.8    3e-07   
ref|WP_020674224.1|  hypothetical protein                             57.8    3e-07   
ref|WP_043801196.1|  malonyl-CoA O-methyltransferase                  56.2    4e-07   
ref|WP_002137162.1|  methyltransferase                                57.8    4e-07   
ref|WP_028971893.1|  methyltransferase type 11                        57.0    9e-07   
ref|WP_022493475.1|  phosphoethanolamine Nmethyltransferase putative  56.6    9e-07   
gb|EQB28536.1|  methylase involved in ubiquinone/menaquinone bios...  56.6    1e-06   
gb|KJF71268.1|  SAM-dependent methyltransferase                       56.6    1e-06   
gb|KCZ72303.1|  methyltransferase family protein                      56.6    1e-06   
ref|WP_025592905.1|  SAM-dependent methyltransferase                  56.6    1e-06   
ref|WP_019565359.1|  methyltransferase                                56.2    1e-06   
ref|WP_013635800.1|  methyltransferase                                56.2    1e-06   
ref|WP_015850956.1|  SAM-dependent methyltransferase                  56.2    1e-06   
ref|WP_035218037.1|  SAM-dependent methyltransferase                  56.2    2e-06   
gb|KIH53398.1|  hypothetical protein ANCDUO_16477                     53.5    2e-06   
ref|WP_039871819.1|  methyltransferase type 11                        56.2    2e-06   
ref|WP_041268184.1|  hypothetical protein                             54.7    2e-06   
ref|WP_043778158.1|  methyltransferase type 11                        55.8    2e-06   
ref|WP_038490461.1|  SAM-dependent methyltransferase                  55.5    3e-06   
ref|WP_038205258.1|  biotin synthase                                  55.8    3e-06   
ref|WP_030320182.1|  ubiquinone biosynthesis methyltransferase UbiE   55.8    3e-06   
gb|KJF69443.1|  SAM-dependent methyltransferase                       55.5    3e-06   
ref|WP_038675258.1|  methyltransferase type 11                        55.5    3e-06   
gb|AIF52542.1|  Methyltransferase type 11                             55.5    3e-06   
gb|ABZ87545.1|  methyltransferase type 11                             54.7    3e-06   
ref|WP_015365730.1|  Methyltransferase type 11                        55.5    3e-06   
ref|WP_009675881.1|  MULTISPECIES: methyltransferase type 11          55.1    4e-06   
gb|KFM98367.1|  methyltransferase small domain protein                55.1    4e-06   
ref|WP_000655494.1|  ubiquinone biosynthesis methlytransferase UbiE   54.7    4e-06   
ref|WP_036624290.1|  rRNA adenine methyltransferase                   55.5    4e-06   
ref|WP_003512256.1|  methyltransferase                                55.1    5e-06   
gb|EEL81767.1|  Methyltransferase type 11                             54.7    5e-06   
ref|WP_006311543.1|  methyltransferase                                54.7    5e-06   
ref|WP_022555903.1|  Methyltransferase                                54.7    5e-06   
ref|WP_040217132.1|  hypothetical protein                             54.7    5e-06   
ref|WP_043330844.1|  ubiquinone biosynthesis protein                  53.9    6e-06   
ref|WP_044458759.1|  SAM-dependent methyltransferase                  54.7    6e-06   
ref|WP_003501956.1|  methyltransferase                                54.7    6e-06   
ref|WP_035210160.1|  SAM-dependent methyltransferase                  54.7    6e-06   
ref|WP_010971351.1|  MULTISPECIES: methyltransferase                  54.7    6e-06   
ref|WP_036343328.1|  ubiquinone biosynthesis protein                  53.9    7e-06   
gb|EWM66995.1|  methyltransferase                                     54.3    8e-06   
ref|WP_007154813.1|  biotin biosynthesis protein BioC                 54.3    8e-06   
gb|ETB50522.1|  methyltransferase type 11                             52.8    9e-06   
ref|WP_009589920.1|  methyltransferase type 11                        53.9    9e-06   
ref|WP_037088919.1|  SAM-dependent methyltransferase                  53.9    9e-06   
ref|WP_016134694.1|  ubiquinone/menaquinone biosynthesis methyltr...  53.9    1e-05   
ref|WP_042475209.1|  hypothetical protein                             55.1    1e-05   
ref|WP_016087553.1|  ubiquinone/menaquinone biosynthesis methyltr...  53.9    1e-05   
ref|WP_032712033.1|  SAM-dependent methyltransferase                  53.9    1e-05   
ref|WP_010899034.1|  methyltransferase type 11                        53.9    1e-05   
ref|WP_001987073.1|  Non-ribosomal peptide synthase, putative         55.1    1e-05   
ref|WP_025027294.1|  methyltransferase type 11                        53.9    1e-05   
ref|WP_032708748.1|  SAM-dependent methyltransferase                  53.5    1e-05   
ref|WP_036809035.1|  ubiquinone biosynthesis methyltransferase UbiE   53.5    1e-05   
ref|WP_002649363.1|  SAM-dependent methyltransferase                  53.5    1e-05   
ref|WP_018213222.1|  methyltransferase type 11                        53.5    2e-05   
gb|ELP57482.1|  hypothetical protein F502_19446                       53.5    2e-05   
gb|ETB43218.1|  methyltransferase type 11                             52.0    2e-05   
ref|WP_018718509.1|  hypothetical protein                             53.5    2e-05   
ref|WP_026932721.1|  methyltransferase type 11                        52.8    2e-05   
ref|WP_034829698.1|  methyltransferase type 11                        53.5    2e-05   
ref|WP_009954416.1|  MULTISPECIES: methyltransferase type 11          53.5    2e-05   
ref|WP_016129882.1|  hypothetical protein                             53.1    2e-05   
ref|WP_003496924.1|  methyltransferase                                53.1    2e-05   
ref|WP_003190381.1|  methyltransferase                                53.1    2e-05   
ref|WP_020078296.1|  SAM-dependent methyltransferase                  53.1    2e-05   
ref|WP_032714967.1|  SAM-dependent methyltransferase                  53.1    2e-05   
ref|WP_004440929.1|  methyltransferase                                53.1    2e-05   
ref|WP_002066207.1|  methyltransferase                                53.1    2e-05   
ref|WP_028608495.1|  methyltransferase type 11                        53.1    2e-05   
ref|WP_014941284.1|  methyltransferase type 11                        53.1    2e-05   
ref|WP_014381807.1|  methyltransferase type 11                        53.1    2e-05   
ref|WP_021509832.1|  hypothetical protein                             53.1    2e-05   
ref|WP_009548140.1|  methylase involved in ubiquinone/menaquinone...  52.8    2e-05   
ref|WP_002128087.1|  MULTISPECIES: methyltransferase                  53.1    2e-05   
ref|WP_014379131.1|  methyltransferase type 11                        53.1    2e-05   
gb|AFM41472.1|  methylase involved in ubiquinone/menaquinone bios...  52.4    2e-05   
ref|WP_014041811.1|  fibrillarin-like rRNA methylase                  52.4    2e-05   
ref|WP_006699398.1|  methyltransferase                                52.8    2e-05   
ref|WP_035774675.1|  hypothetical protein                             53.1    2e-05   
ref|WP_002033133.1|  MULTISPECIES: methyltransferase                  52.8    3e-05   
ref|WP_028164399.1|  SAM-dependent methyltransferase                  52.8    3e-05   
ref|WP_016101074.1|  hypothetical protein                             52.8    3e-05   
ref|WP_002142407.1|  MULTISPECIES: methyltransferase                  52.8    3e-05   
ref|WP_031167243.1|  hypothetical protein                             53.1    3e-05   
ref|WP_030171158.1|  ubiquinone biosynthesis methyltransferase UbiE   53.1    3e-05   
ref|WP_022595273.1|  putative Biotin biosynthesis protein BioC        52.8    3e-05   
ref|WP_026682185.1|  ubiquinone biosynthesis methyltransferase UbiE   52.8    3e-05   
ref|WP_028025295.1|  biotin synthase                                  52.8    3e-05   
ref|WP_038256373.1|  SAM-dependent methyltransferase                  52.8    3e-05   
dbj|GAF27217.1|  methylase                                            52.4    3e-05   
ref|WP_035015125.1|  hypothetical protein                             53.1    3e-05   
ref|WP_040903760.1|  SAM-dependent methyltransferase                  52.8    3e-05   
ref|WP_009366385.1|  S-adenosylmethionine-dependent methyltransfe...  52.4    3e-05   
gb|EMS98141.1|  methyltransferase                                     52.8    3e-05   
ref|WP_020009542.1|  MULTISPECIES: methyltransferase                  52.4    3e-05   
ref|WP_039983829.1|  biotin synthase                                  52.8    3e-05   
gb|EHM45042.1|  methyltransferase domain protein                      52.8    3e-05   
ref|WP_036547124.1|  hypothetical protein                             52.8    3e-05   
ref|WP_000812695.1|  methyltransferase                                52.4    3e-05   
ref|WP_035237741.1|  SAM-dependent methyltransferase                  52.4    3e-05   
ref|WP_009792281.1|  MULTISPECIES: ubiquinone biosynthesis methyl...  52.4    4e-05   
ref|WP_001968674.1|  methyltransferase                                52.4    4e-05   
ref|WP_043281533.1|  hypothetical protein                             50.4    4e-05   
ref|WP_010178217.1|  Biotin biosynthesis protein BioC                 52.4    4e-05   
ref|WP_005707515.1|  hypothetical protein                             52.4    4e-05   
ref|WP_028544807.1|  methyltransferase type 11                        52.0    4e-05   
ref|WP_008253539.1|  methyltransferase-UbiE family protein            52.0    5e-05   
ref|WP_017249948.1|  methyltransferase type 11                        51.6    6e-05   
ref|WP_007981656.1|  S-adenosylmethionine-dependent methyltransfe...  51.6    6e-05   
ref|WP_023394424.1|  N-methyltransferase-like protein                 51.6    6e-05   
ref|WP_023866537.1|  methyltransferase type 11                        52.0    6e-05   
ref|WP_014710950.1|  MULTISPECIES: methyltransferase type 11          52.0    6e-05   
ref|WP_033711115.1|  MULTISPECIES: methyltransferase type 11          52.0    7e-05   
ref|WP_022604334.1|  putative Biotin biosynthesis protein BioC        52.0    7e-05   
gb|AAS02988.1|  hypothetical protein MAP_0671                         52.0    7e-05   
ref|WP_000812399.1|  methyltransferase                                51.6    7e-05   
gb|EFC74027.1|  methyltransferase domain protein                      51.6    7e-05   
ref|WP_036885867.1|  methyltransferase type 12                        51.6    8e-05   
dbj|GAK84382.1|  biotin synthesis protein BioC                        51.2    8e-05   
ref|WP_013433494.1|  fibrillarin-like rRNA methylase                  50.8    8e-05   
ref|WP_011710956.1|  methyltransferase type 11                        51.2    8e-05   
ref|WP_004406035.1|  biotin synthase                                  51.6    8e-05   
ref|WP_022551161.1|  putative Biotin biosynthesis protein BioC        51.6    8e-05   
ref|WP_021061842.1|  methylase involved in ubiquinone/menaquinone...  51.2    8e-05   
gb|ELP47551.1|  hypothetical protein D522_03959                       51.6    8e-05   
ref|WP_009974977.1|  methyltransferase type 11                        51.6    9e-05   
ref|WP_023505824.1|  methylase involved in ubiquinone/menaquinone...  51.6    9e-05   
ref|WP_005378220.1|  biotin synthase                                  51.6    9e-05   
ref|WP_034771182.1|  SAM-dependent methyltransferase                  51.6    9e-05   
dbj|GAJ73064.1|  biotin synthesis protein BioC                        51.6    9e-05   
ref|WP_019733079.1|  methyltransferase type 11                        51.6    9e-05   
ref|WP_003873068.1|  methyltransferase type 11                        51.6    9e-05   
dbj|GAK14959.1|  biotin synthesis protein BioC                        51.6    9e-05   
ref|WP_039987330.1|  biotin synthase                                  51.6    9e-05   
ref|WP_000655497.1|  ubiquinone biosynthesis methyltransferase UbiE   51.2    1e-04   
ref|WP_011322316.1|  S-adenosylmethionine-dependent methyltransfe...  51.2    1e-04   
ref|WP_020196985.1|  biotin synthase                                  51.2    1e-04   
ref|WP_003452268.1|  Methyltransferase type 11                        51.2    1e-04   
dbj|GAK20672.1|  biotin synthesis protein BioC                        51.2    1e-04   
ref|WP_025147982.1|  methyltransferase                                51.2    1e-04   
ref|WP_005388087.1|  MULTISPECIES: biotin synthase                    51.2    1e-04   
ref|WP_000655484.1|  ubiquinone biosynthesis methlytransferase UbiE   51.2    1e-04   
ref|WP_007808703.1|  malonyl-CoA O-methyltransferase                  51.6    1e-04   
ref|WP_023160493.1|  biotin synthesis protein BioC                    51.2    1e-04   



>ref|XP_009616694.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=491

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA  G+EREVQKSYW+EH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAATSGQEREVQKSYWMEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELA+KAGQ+IA+DFIE  IKKNE+INGH  N+KFMCADVTS DLNFS ES+
Sbjct  61   GAGIGRFTGELAKKAGQLIALDFIEGAIKKNESINGHHKNVKFMCADVTSPDLNFSPESV  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD EV+ L
Sbjct  121  DLIFSNWLLMYLSDGEVQYL  140



>ref|XP_007209941.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11140.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=463

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            D+IFSNWLLMYLSD+EVE+L
Sbjct  121  DMIFSNWLLMYLSDKEVENL  140



>ref|XP_011084235.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Sesamum indicum]
Length=491

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA Q +EREVQKSYWIEHS +LT+EAMMLDSKA+DLDKEERPEVLS+LP YEGKS+LEL
Sbjct  1    MAAIQEQEREVQKSYWIEHSVDLTLEAMMLDSKASDLDKEERPEVLSLLPPYEGKSILEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELA+K+GQ+IA+DFIE+VIKKNETINGH  N+KF+CADVTS+DLNFS+ S+
Sbjct  61   GAGIGRFTGELAKKSGQLIALDFIETVIKKNETINGHHKNVKFLCADVTSRDLNFSEGSL  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE+L
Sbjct  121  DLIFSNWLLMYLSDEEVENL  140



>ref|XP_009757363.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=491

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA  G+EREVQKSYW+EH++ELTVEAMMLDSKAADLDKEERPEV+S+LP YEGKSVLEL
Sbjct  1    MAATSGQEREVQKSYWMEHTAELTVEAMMLDSKAADLDKEERPEVVSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELA+KAGQ+IA+DFIE  IKKNE+INGH  N+KFMCADVTS DLNFS ES+
Sbjct  61   GAGIGRFTGELAKKAGQLIALDFIEGAIKKNESINGHHKNVKFMCADVTSPDLNFSPESV  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD EV+ L
Sbjct  121  DLIFSNWLLMYLSDGEVQDL  140



>ref|NP_001234549.1| phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
 gb|AAG59894.1|AF328858_1 phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=491

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA  G+EREVQKSYWIEH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGK+VLEL
Sbjct  1    MAAASGQEREVQKSYWIEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKTVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAGQ+IA+DFIE  IKKNE INGH  N+KFMCADVTS +L FS ES+
Sbjct  61   GAGIGRFTGELAQKAGQLIALDFIEGAIKKNENINGHYKNVKFMCADVTSPNLIFSPESV  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EV++L
Sbjct  121  DLIFSNWLLMYLSDEEVKAL  140



>ref|XP_007209942.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11141.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=491

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            D+IFSNWLLMYLSD+EVE+L
Sbjct  121  DMIFSNWLLMYLSDKEVENL  140



>ref|XP_007209943.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11142.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=493

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            D+IFSNWLLMYLSD+EVE+L
Sbjct  121  DMIFSNWLLMYLSDKEVENL  140



>ref|XP_002282182.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Vitis 
vinifera]
 emb|CBI15568.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA  G+ERE+QK+YW EHS++LTVEAMMLDSKAADLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAAQVGQEREIQKNYWAEHSADLTVEAMMLDSKAADLDKEERPEVLSLLPPFEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAGQVI++DFIESVIKKNE+INGH  N+KFMCADV S +LNFS ES+
Sbjct  61   GAGIGRFTGELAQKAGQVISLDFIESVIKKNESINGHYKNVKFMCADVASPELNFSAESV  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  121  DLIFSNWLLMYLSDKEVEEL  140



>ref|XP_009614862.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=499

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  134  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  313
             ++ +A  A  G+ER+VQK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP+YEG
Sbjct  3    PVISAATTASSGQERDVQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPSYEG  62

Query  314  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLN  493
            KSVLELGAGIGRFTGELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS DL 
Sbjct  63   KSVLELGAGIGRFTGELAKNAGQLIALDFIESAIKKNESINRHHKNVKFMCADVTSPDLK  122

Query  494  FSDESIDLIFSNWLLMYLSDQEVESL  571
            FS ES+DLIFSNWLLMYLSD+EV+SL
Sbjct  123  FSPESVDLIFSNWLLMYLSDEEVQSL  148



>ref|XP_010533969.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Tarenaya 
hassleriana]
Length=491

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MA+  GEERE+QKSYW+EHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MASSYGEEREIQKSYWMEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  N+KFMC DVTS DL  +DESI
Sbjct  61   GAGIGRFTGELAQKAGEVIAIDFIESAIKKNESVNGHYKNVKFMCMDVTSPDLKITDESI  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DL+FSNWLLMYLSD+EVE L
Sbjct  121  DLLFSNWLLMYLSDKEVEHL  140



>ref|XP_008240154.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Prunus mume]
Length=485

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAANGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFT ELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTAELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            D+IFSNWLLMYLSD+EVE+L
Sbjct  121  DMIFSNWLLMYLSDKEVENL  140



>emb|CAN64744.1| hypothetical protein VITISV_041321 [Vitis vinifera]
Length=490

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 130/140 (93%), Gaps = 1/140 (1%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA QG+ERE+QK+YW EHS++LTVEAMMLDSKAADLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAA-QGQEREIQKNYWAEHSADLTVEAMMLDSKAADLDKEERPEVLSLLPPFEGKSVLEL  59

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFT ELAQKAGQVI++DFIESVIKKNE+INGH  N+KFMCADV S +LNFS ES+
Sbjct  60   GAGIGRFTXELAQKAGQVISLDFIESVIKKNESINGHYKNVKFMCADVASPELNFSAESV  119

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  120  DLIFSNWLLMYLSDKEVEEL  139



>ref|XP_006341528.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341529.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=491

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            M A  G+EREVQKSYWIEH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGK+VLEL
Sbjct  1    MDAASGQEREVQKSYWIEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKTVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELA KAGQ+IA+DFIE  IKKNE ING+  N+KFMCADVTS +LNFS ES+
Sbjct  61   GAGIGRFTGELANKAGQLIALDFIEGAIKKNENINGYHKNVKFMCADVTSPNLNFSPESV  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EV++L
Sbjct  121  DLIFSNWLLMYLSDEEVKAL  140



>ref|XP_008240152.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Prunus mume]
Length=491

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAANGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFT ELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTAELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            D+IFSNWLLMYLSD+EVE+L
Sbjct  121  DMIFSNWLLMYLSDKEVENL  140



>ref|XP_010519218.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Tarenaya hassleriana]
Length=510

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  140  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  319
            + S+++   GEERE+QKSYW EHS +L+VEAMMLDSKAADLDKEERPE+LS+LP YEGKS
Sbjct  7    ISSSLSKHNGEEREIQKSYWTEHSVDLSVEAMMLDSKAADLDKEERPEILSILPPYEGKS  66

Query  320  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  499
            VLE GAGIGRFTGE A KAGQVIA+DFI+SVIKKNE INGH  N+KFMCADVTS +L FS
Sbjct  67   VLEFGAGIGRFTGEFALKAGQVIAVDFIDSVIKKNENINGHHKNVKFMCADVTSPELKFS  126

Query  500  DESIDLIFSNWLLMYLSDQEVESL  571
            DES+DLIFSNWLLMYLSD+EVE L
Sbjct  127  DESVDLIFSNWLLMYLSDKEVEDL  150



>gb|AAP83582.1| phosphoethanolamine N-methyltransferase [Brassica napus]
Length=491

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA    ER+VQK+YWIEHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEAERDVQKNYWIEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DLN +D SI
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLNITDGSI  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  121  DLIFSNWLLMYLSDKEVELL  140



>ref|XP_011084227.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Sesamum indicum]
Length=494

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +2

Query  161  FQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAG  340
            F  +EREVQKSYWIEHS +LT+EAMMLDSKA+DLDKEERPEVLS+LP YEGKS+LELGAG
Sbjct  7    FVEQEREVQKSYWIEHSVDLTLEAMMLDSKASDLDKEERPEVLSLLPPYEGKSILELGAG  66

Query  341  IGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLI  520
            IGRFTGELA+K+GQ+IA+DFIE+VIKKNETINGH  N+KF+CADVTS+DLNFS+ S+DLI
Sbjct  67   IGRFTGELAKKSGQLIALDFIETVIKKNETINGHHKNVKFLCADVTSRDLNFSEGSLDLI  126

Query  521  FSNWLLMYLSDQEVESL  571
            FSNWLLMYLSD+EVE+L
Sbjct  127  FSNWLLMYLSDEEVENL  143



>ref|XP_010519219.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Tarenaya hassleriana]
Length=499

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA+ GEERE+QKSYW EHS +L+VEAMMLDSKAADLDKEERPE+LS+LP YEGKSVLE 
Sbjct  1    MAAY-GEEREIQKSYWTEHSVDLSVEAMMLDSKAADLDKEERPEILSILPPYEGKSVLEF  59

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGE A KAGQVIA+DFI+SVIKKNE INGH  N+KFMCADVTS +L FSDES+
Sbjct  60   GAGIGRFTGEFALKAGQVIAVDFIDSVIKKNENINGHHKNVKFMCADVTSPELKFSDESV  119

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  120  DLIFSNWLLMYLSDKEVEDL  139



>ref|XP_011072995.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Sesamum 
indicum]
Length=491

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA Q +EREVQKSYW+EHS +LT+EAMMLDS A DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAANQEQEREVQKSYWMEHSVDLTLEAMMLDSNACDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELA+KAG+++A+DFIESVIKKNETINGH  N+KFMCADVTS DLNF + S+
Sbjct  61   GAGIGRFTGELAKKAGELVALDFIESVIKKNETINGHNKNVKFMCADVTSPDLNFPEGSL  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  121  DLIFSNWLLMYLSDKEVEDL  140



>ref|XP_009145948.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Brassica 
rapa]
Length=492

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 131/141 (93%), Gaps = 1/141 (1%)
 Frame = +2

Query  149  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  328
            A A+F+ E R+VQK+YWIEHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLE
Sbjct  2    AAASFEAE-RDVQKNYWIEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLE  60

Query  329  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  508
            LGAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DLN +D S
Sbjct  61   LGAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLNITDGS  120

Query  509  IDLIFSNWLLMYLSDQEVESL  571
            IDLIFSNWLLMYLSD+EVE L
Sbjct  121  IDLIFSNWLLMYLSDKEVELL  141



>gb|KJB30121.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=422

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  149  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  328
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  329  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  508
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  509  IDLIFSNWLLMYLSDQEVESL  571
            +DLIFSNWLLMYLSD+EVE+L
Sbjct  122  LDLIFSNWLLMYLSDKEVENL  142



>ref|XP_008364653.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 130/141 (92%), Gaps = 1/141 (1%)
 Frame = +2

Query  152  MAAF-QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  328
            MAAF  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+E
Sbjct  1    MAAFANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVVE  60

Query  329  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  508
            LGAGIGRFTGELA+KAGQ+ A+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  S+ S
Sbjct  61   LGAGIGRFTGELAEKAGQLFALDFIDSVIKKNESINGHHKNVKFMCADVTSPDLKISENS  120

Query  509  IDLIFSNWLLMYLSDQEVESL  571
            +DL+FSNWLLMYLSD EVE+L
Sbjct  121  VDLVFSNWLLMYLSDXEVENL  141



>ref|XP_010097563.1| hypothetical protein L484_017373 [Morus notabilis]
 gb|EXB69095.1| hypothetical protein L484_017373 [Morus notabilis]
Length=503

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  316
            +  +A     G+ERE QK YW++HS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK
Sbjct  1    MADAATVNANGQEREKQKIYWMQHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGK  60

Query  317  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  496
            SVLELGAGIGRFT ELAQKAGQ++AMDFIESVIKKNE+INGH  N+KFMCADVTS DLN 
Sbjct  61   SVLELGAGIGRFTSELAQKAGQLVAMDFIESVIKKNESINGHYKNVKFMCADVTSPDLNI  120

Query  497  SDESIDLIFSNWLLMYLSDQEVESL  571
            S++S+DLIFSNWLLMYLSD+EVE+L
Sbjct  121  SEDSVDLIFSNWLLMYLSDKEVENL  145



>ref|XP_010487710.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Camelina sativa]
Length=491

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  121  DLIFSNWLLMYLSDKEVELL  140



>ref|XP_002532097.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
 gb|EEF30287.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
Length=492

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 130/141 (92%), Gaps = 1/141 (1%)
 Frame = +2

Query  152  MAAFQG-EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  328
            MAA Q  EEREVQK+YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLS+LP+YEGKSVLE
Sbjct  1    MAAAQNVEEREVQKNYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSLLPSYEGKSVLE  60

Query  329  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  508
             GAGIGRFTGELAQKAGQ++A+DFIESVIKKNE INGH  N+KFMCADVTS+ L FS+ES
Sbjct  61   FGAGIGRFTGELAQKAGQLVAVDFIESVIKKNENINGHHKNVKFMCADVTSQGLKFSEES  120

Query  509  IDLIFSNWLLMYLSDQEVESL  571
            +DLIFSNWLLMYLSD+EV +L
Sbjct  121  VDLIFSNWLLMYLSDEEVVNL  141



>ref|XP_010033717.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW84063.1| hypothetical protein EUGRSUZ_B00946 [Eucalyptus grandis]
Length=491

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA QG+ER VQKSYW EHS+ LTVEAMMLDSKA+DLDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAAAQGDERHVQKSYWAEHSASLTVEAMMLDSKASDLDKEERPEILSLLPPYEGKTVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAGQ++A+DFI+  IKKNE+INGH  N+KF CADVTS DLN ++ES+
Sbjct  61   GAGIGRFTGELAQKAGQLLALDFIDGAIKKNESINGHHKNVKFQCADVTSPDLNIAEESV  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD EVE+L
Sbjct  121  DLIFSNWLLMYLSDTEVENL  140



>ref|XP_010506242.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Camelina sativa]
Length=491

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  121  DLIFSNWLLMYLSDKEVELL  140



>gb|ABX10444.1| phosphoethanolamine N-methyltransferase [Gossypium hirsutum]
Length=475

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  149  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  328
            A   F G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGFVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  329  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  508
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  509  IDLIFSNWLLMYLSDQEVESL  571
            +DLIFSNWLLMYLSD+EVE+L
Sbjct  122  LDLIFSNWLLMYLSDKEVENL  142



>gb|KJB30119.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=443

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  149  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  328
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  329  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  508
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  509  IDLIFSNWLLMYLSDQEVESL  571
            +DLIFSNWLLMYLSD+EVE+L
Sbjct  122  LDLIFSNWLLMYLSDKEVENL  142



>gb|KHG16117.1| Phosphoethanolamine N-methyltransferase 1 -like protein [Gossypium 
arboreum]
Length=486

 Score =   236 bits (603),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  149  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  328
            A   F G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGFVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  329  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  508
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  509  IDLIFSNWLLMYLSDQEVESL  571
            +DLIFSNWLLMYLSD+EVE+L
Sbjct  122  LDLIFSNWLLMYLSDKEVENL  142



>gb|KJB30123.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=464

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  149  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  328
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  329  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  508
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  509  IDLIFSNWLLMYLSDQEVESL  571
            +DLIFSNWLLMYLSD+EVE+L
Sbjct  122  LDLIFSNWLLMYLSDKEVENL  142



>ref|XP_008360927.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Malus domestica]
Length=492

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +2

Query  155  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  334
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  335  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  514
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVTSPDLKISEGSVD  122

Query  515  LIFSNWLLMYLSDQEVESL  571
            LIFSNWLLMYLSD+EVE L
Sbjct  123  LIFSNWLLMYLSDKEVEKL  141



>ref|XP_002883100.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59359.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  121  DLIFSNWLLMYLSDKEVELL  140



>ref|XP_010465872.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Camelina 
sativa]
Length=491

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG++IA+DFI+SVI+KNET+NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIEKNETVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  121  DLIFSNWLLMYLSDKEVELL  140



>ref|XP_004299531.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=500

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  143  QSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  322
            ++A A   G+ERE+QKSYW E+S+ELTVE+MMLDSKA+DLDKEERPEVL+MLP YEGKSV
Sbjct  7    RTATANGSGKEREIQKSYWEENSTELTVESMMLDSKASDLDKEERPEVLAMLPPYEGKSV  66

Query  323  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSD  502
            LELGAGIGRFTGELAQKAGQ+IAMDFIE+VIKKNE+ING+  N+KFMCADVTS DL  S+
Sbjct  67   LELGAGIGRFTGELAQKAGQLIAMDFIENVIKKNESINGNHKNVKFMCADVTSPDLKISE  126

Query  503  ESIDLIFSNWLLMYLSDQEVESL  571
            ES+DLIFSNWLLMYL D+EVE+L
Sbjct  127  ESVDLIFSNWLLMYLCDKEVENL  149



>ref|XP_002891445.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67704.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MA    +ER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLEL
Sbjct  1    MATPYKKERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  NIKFMCADVTS DL  +D SI
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIKKNESVNGHYKNIKFMCADVTSPDLKIADGSI  120

Query  512  DLIFSNWLLMYLSDQEVE  565
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>emb|CDO98349.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA +G+EREVQKSYWIEH+++LTVEAMMLDS AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAVEGQEREVQKSYWIEHTADLTVEAMMLDSMAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELA+KAGQ++A+DFIE  IKKNE+ING+L N KF+CADVTS +L+FS ES+
Sbjct  61   GAGIGRFTGELAKKAGQIVALDFIEGAIKKNESINGNLKNTKFICADVTSPELHFSAESM  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EV +L
Sbjct  121  DLIFSNWLLMYLSDEEVVTL  140



>ref|NP_973993.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 sp|Q944H0.2|PEAM2_ARATH RecName: Full=Phosphomethylethanolamine N-methyltransferase; 
Short=AtPMEAMT; AltName: Full=Phosphoethanolamine N-methyltransferase 
2 [Arabidopsis thaliana]
 gb|AEE32323.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=491

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MA    EER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLEL
Sbjct  1    MATPYKEERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG+VIA+DFIES I+KNE++NGH  NIKFMCADVTS DL   D SI
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSI  120

Query  512  DLIFSNWLLMYLSDQEVE  565
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>gb|KJB30117.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=494

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  149  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  328
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  329  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  508
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  509  IDLIFSNWLLMYLSDQEVESL  571
            +DLIFSNWLLMYLSD+EVE+L
Sbjct  122  LDLIFSNWLLMYLSDKEVENL  142



>ref|XP_009356042.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 130/141 (92%), Gaps = 1/141 (1%)
 Frame = +2

Query  152  MAAF-QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  328
            MAAF  GEER VQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+E
Sbjct  1    MAAFANGEERAVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVVE  60

Query  329  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  508
            LGAGIGRFTGELA+KAGQ+ A+DFI+SVIKKNE+INGH  N+KF+CADVTS DL  S+ S
Sbjct  61   LGAGIGRFTGELAEKAGQLFALDFIDSVIKKNESINGHHKNVKFICADVTSPDLKISENS  120

Query  509  IDLIFSNWLLMYLSDQEVESL  571
            +DL+FSNWLLMYLSD+EVE+L
Sbjct  121  VDLVFSNWLLMYLSDKEVENL  141



>gb|AAM13092.1| unknown protein [Arabidopsis thaliana]
Length=491

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPDLKITDGSL  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  121  DLIFSNWLLMYLSDKEVELL  140



>ref|NP_188427.2| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
 sp|Q9FR44.1|PEAM1_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 1; Short=AtNMT1; 
Short=PEAMT 1; AltName: Full=Protein XIPOTL 1 [Arabidopsis 
thaliana]
 gb|AAG41121.1|AF197940_1 SAM:phospho-ethanolamine N-methyltransferase [Arabidopsis thaliana]
 gb|AAK32886.1|AF367299_1 AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAL25589.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAM10282.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AEE76033.1| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
Length=491

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPDLKITDGSL  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  121  DLIFSNWLLMYLSDKEVELL  140



>ref|XP_010487709.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Camelina sativa]
Length=494

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  10   EERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLELGAGIGR  69

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+DLIFSN
Sbjct  70   FTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSLDLIFSN  129

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  130  WLLMYLSDKEVELL  143



>ref|XP_006406666.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
 gb|ESQ48119.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
Length=491

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPFEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DL  +D SI
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLKITDGSI  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  121  DLIFSNWLLMYLSDKEVELL  140



>gb|KJB30122.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=491

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 130/140 (93%), Gaps = 1/140 (1%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA  G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LEL
Sbjct  1    MAA-NGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILEL  59

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S+
Sbjct  60   GAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGSL  119

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE+L
Sbjct  120  DLIFSNWLLMYLSDKEVENL  139



>ref|XP_006297517.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
 gb|EOA30415.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
Length=491

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE+INGH  N+KF+CADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESINGHYKNVKFLCADVTSPDLKITDGSL  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  121  DLIFSNWLLMYLSDKEVELL  140



>dbj|BAB02720.1| methyl transferase-like protein [Arabidopsis thaliana]
Length=498

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPDLKITDGSL  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  121  DLIFSNWLLMYLSDKEVELL  140



>ref|XP_008393424.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +2

Query  155  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  334
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+S +ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSXVELG  62

Query  335  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  514
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVTSPDLKISEGSVD  122

Query  515  LIFSNWLLMYLSDQEVESL  571
            LIFSNWLLMYLSD+EVE L
Sbjct  123  LIFSNWLLMYLSDKEVEKL  141



>ref|XP_009360079.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +2

Query  155  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  334
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  335  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  514
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADV S DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVASPDLKISEGSVD  122

Query  515  LIFSNWLLMYLSDQEVESL  571
            LIFSNWLLMYLSD+EVE L
Sbjct  123  LIFSNWLLMYLSDKEVEKL  141



>ref|XP_010506234.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Camelina sativa]
Length=494

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  10   EERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLELGAGIGR  69

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+DLIFSN
Sbjct  70   FTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSLDLIFSN  129

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  130  WLLMYLSDKEVELL  143



>ref|XP_004252273.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Solanum lycopersicum]
Length=500

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  146  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  325
            +   A  G+ER++QK+YW+EH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVL
Sbjct  8    AGAGAKSGQERDIQKNYWMEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVL  67

Query  326  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  505
            ELGAGIGRFT ELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS DL FS E
Sbjct  68   ELGAGIGRFTSELAKNAGQLIALDFIESAIKKNESINKHHKNVKFMCADVTSPDLKFSPE  127

Query  506  SIDLIFSNWLLMYLSDQEVESL  571
            S+DLIFSNWLLMYLSD+EV+SL
Sbjct  128  SVDLIFSNWLLMYLSDEEVQSL  149



>ref|XP_007036802.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY21303.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=493

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +EREVQK YW+EHS +LTVEAMMLDSKAADLDKEERPEVLS+LP YEGKS+LELGAGIGR
Sbjct  9    DEREVQKDYWMEHSLDLTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSILELGAGIGR  68

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAG VIA+DFIESVIKKNE+INGH  N KF+CADVTS DL FS+ S+DLIFSN
Sbjct  69   FTGELAQKAGHVIALDFIESVIKKNESINGHYKNAKFLCADVTSPDLKFSEGSLDLIFSN  128

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+E+E+L
Sbjct  129  WLLMYLSDKEIENL  142



>ref|XP_007036803.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY21304.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=494

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +EREVQK YW+EHS +LTVEAMMLDSKAADLDKEERPEVLS+LP YEGKS+LELGAGIGR
Sbjct  9    DEREVQKDYWMEHSLDLTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSILELGAGIGR  68

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAG VIA+DFIESVIKKNE+INGH  N KF+CADVTS DL FS+ S+DLIFSN
Sbjct  69   FTGELAQKAGHVIALDFIESVIKKNESINGHYKNAKFLCADVTSPDLKFSEGSLDLIFSN  128

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+E+E+L
Sbjct  129  WLLMYLSDKEIENL  142



>ref|XP_006376718.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 ref|XP_006376719.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 gb|ERP54515.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 gb|ERP54516.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
Length=135

 Score =   223 bits (567),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  6    EEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  65

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLNFS+ S+DLIFSN
Sbjct  66   FTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNFSEGSVDLIFSN  125

Query  530  WLLMYLSDQE  559
            WLLMYLSD+E
Sbjct  126  WLLMYLSDKE  135



>ref|XP_010263678.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nelumbo 
nucifera]
Length=489

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 130/140 (93%), Gaps = 1/140 (1%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA QG ERE+QKSYWIEHS +LTVEAMMLDSKA+DLDKEERPEVLS+LP ++GKSVLEL
Sbjct  1    MAA-QGGEREIQKSYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSLLPPFKGKSVLEL  59

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELA++AGQV+A+DFIE+VIKKNE+INGH  N+KF+CADVTS DL  + ES+
Sbjct  60   GAGIGRFTGELAKEAGQVLALDFIENVIKKNESINGHHKNVKFLCADVTSPDLQIASESV  119

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE+L
Sbjct  120  DLIFSNWLLMYLSDKEVENL  139



>gb|EYU33965.1| hypothetical protein MIMGU_mgv1a005263mg [Erythranthe guttata]
Length=491

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA Q EERE+QKSYW+EHS +LT+E+MMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAVQDEEREMQKSYWVEHSVDLTLESMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELA+KAGQ++A+DFIE  IKKNE INGH  N+KFMCADVTS  L+F D S 
Sbjct  61   GAGIGRFTGELAKKAGQLVALDFIEGSIKKNEIINGHHKNVKFMCADVTSPSLSFPDGSF  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE+L
Sbjct  121  DLIFSNWLLMYLSDKEVENL  140



>gb|KDP23922.1| hypothetical protein JCGZ_27082 [Jatropha curcas]
Length=510

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EERE+Q++YW+EHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP+YEGKSVLE GAGIGR
Sbjct  26   EEREIQRNYWMEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPSYEGKSVLEFGAGIGR  85

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGE+AQ AGQ++A+DFI+SVIKKNE+INGH  N+KF+CADVTS+DL FS+ S+DLIFSN
Sbjct  86   FTGEIAQNAGQLVALDFIDSVIKKNESINGHYKNVKFICADVTSQDLKFSEGSVDLIFSN  145

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE+L
Sbjct  146  WLLMYLSDKEVENL  159



>ref|XP_009776424.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
sylvestris]
Length=499

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ER+VQK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  15   QERDVQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPSYEGKSVLELGAGIGR  74

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FT ELA+ AGQ++A+DFIES IKKNE+IN H  N+KFMCADVTS DL FS ES+DLIFSN
Sbjct  75   FTSELAKNAGQLLALDFIESAIKKNESINSHHKNVKFMCADVTSPDLKFSPESVDLIFSN  134

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EV+SL
Sbjct  135  WLLMYLSDEEVQSL  148



>ref|XP_006303987.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
 gb|EOA36885.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
Length=491

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MA    EER +QKSYW+EHSS+LTVEAMMLDSKA DLDKEERPEVLS++P YEGK+VLEL
Sbjct  1    MATPYKEERHIQKSYWMEHSSDLTVEAMMLDSKATDLDKEERPEVLSLIPPYEGKTVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIADGSV  120

Query  512  DLIFSNWLLMYLSDQEVE  565
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>gb|AFK34653.1| unknown [Lotus japonicus]
Length=198

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EEREVQKSYWIEHSS+L++E+MMLDS A++LDKEERPEVLS+LPA E KSV+ELGAGIGR
Sbjct  15   EEREVQKSYWIEHSSDLSMESMMLDSNASNLDKEERPEVLSLLPAIESKSVIELGAGIGR  74

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+K+GQ++A+DFIES IKKNE+INGH  N+KFMCADVTS +L+ S+ S+DLIFSN
Sbjct  75   FTGELAKKSGQLLAVDFIESAIKKNESINGHHKNVKFMCADVTSPNLHVSEGSVDLIFSN  134

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSDQEVE+L
Sbjct  135  WLLMYLSDQEVENL  148



>gb|KFK36082.1| hypothetical protein AALP_AA4G075100 [Arabis alpina]
Length=492

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK+VLELGAGIGR
Sbjct  8    EERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKTVLELGAGIGR  67

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAG+VIA+DFIES IKKNE+ NGH  N+KFMCADVTS DL  +D SIDLIFSN
Sbjct  68   FTGELAQKAGEVIALDFIESAIKKNESDNGHYKNVKFMCADVTSPDLKITDGSIDLIFSN  127

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  128  WLLMYLSDKEVELL  141



>dbj|BAD80838.1| phosphoethanolamine N-methyltransferase [Atriplex nummularia]
Length=503

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  146  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  325
            SAM     EEREV K YW+EHS +LTVEAMMLDS+A+DLDKEERPEVLSMLP YEGKSVL
Sbjct  4    SAMGV--NEEREVFKKYWVEHSVDLTVEAMMLDSQASDLDKEERPEVLSMLPPYEGKSVL  61

Query  326  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  505
            ELGAGIGRFTGELA+KAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS  LN S  
Sbjct  62   ELGAGIGRFTGELAEKAGQVIALDFIESVIKKNECINGHYKNVKFMCADVTSPSLNISPN  121

Query  506  SIDLIFSNWLLMYLSDQEVESL  571
            S+D+IFSNWLLMYLSD+EVE L
Sbjct  122  SVDIIFSNWLLMYLSDEEVERL  143



>gb|AER10512.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
 gb|AER10513.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
Length=492

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  155  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  334
            A+  GEEREVQK+YW+EHS++LTVEAMMLDS A+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSNASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  335  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  514
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADV S DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVASPDLKISEGSVD  122

Query  515  LIFSNWLLMYLSDQEVESL  571
            LIFSNWLLMYLSD+EVE L
Sbjct  123  LIFSNWLLMYLSDKEVEKL  141



>ref|XP_009147956.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Brassica 
rapa]
Length=489

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MA     ER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLEL
Sbjct  1    MATPYKAERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  N+KFMCADVTS DL   D S+
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPDLKIEDGSV  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  121  DLIFSNWLLMYLSDKEVELL  140



>gb|KFK39125.1| hypothetical protein AALP_AA3G204100 [Arabis alpina]
Length=491

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA   EER++QK+YWIEHS +LTVE+MMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSVDLTVESMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKAG++IA+DFI+SVI KNE++NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVINKNESVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  121  DLIFSNWLLMYLSDKEVELL  140



>ref|XP_006346642.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Solanum 
tuberosum]
Length=500

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  167  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  346
            GEER++QK+YW+EH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLELGAGIG
Sbjct  15   GEERDIQKNYWMEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLELGAGIG  74

Query  347  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  526
            RFT ELA+ AGQ+IA+DFI+S IKKN++IN H  N+KFMCADVTS DL FS ES+DLIFS
Sbjct  75   RFTSELAKNAGQLIALDFIDSAIKKNKSINKHHKNVKFMCADVTSPDLKFSPESVDLIFS  134

Query  527  NWLLMYLSDQEVESL  571
            NWLLMYLSD+EV+SL
Sbjct  135  NWLLMYLSDEEVQSL  149



>gb|EPS65842.1| hypothetical protein M569_08933, partial [Genlisea aurea]
Length=487

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +EREVQKSYWIEHS +LTVEAMMLDSKA++LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  2    QEREVQKSYWIEHSGDLTVEAMMLDSKASELDKEERPEVLSLLPSYEGKSVLELGAGIGR  61

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGE+A+KA QV+A+DFIESVIKKNE INGH  N+KFMCADVTS DL+F + S+DLIFSN
Sbjct  62   FTGEIAKKADQVVALDFIESVIKKNEIINGHHKNVKFMCADVTSSDLSFPEGSLDLIFSN  121

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE+L
Sbjct  122  WLLMYLSDEEVENL  135



>ref|XP_009104804.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 [Brassica 
rapa]
Length=506

 Score =   232 bits (591),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  316
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  317  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  496
            +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D+ F
Sbjct  70   TVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPDMKF  129

Query  497  SDESIDLIFSNWLLMYLSDQEVESL  571
            S+ES+DLIFSNWLLMYLSD+EVE L
Sbjct  130  SNESMDLIFSNWLLMYLSDKEVEDL  154



>emb|CDX68222.1| BnaA07g22620D [Brassica napus]
Length=506

 Score =   232 bits (591),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  316
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  317  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  496
            +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D+ F
Sbjct  70   TVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPDMKF  129

Query  497  SDESIDLIFSNWLLMYLSDQEVESL  571
            S+ES+DLIFSNWLLMYLSD+EVE L
Sbjct  130  SNESMDLIFSNWLLMYLSDKEVEDL  154



>gb|KDO63824.1| hypothetical protein CISIN_1g043471mg [Citrus sinensis]
Length=485

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            ERE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GAGIGRF
Sbjct  9    EREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRF  68

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            TGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS DL FS++S+D++FSNW
Sbjct  69   TGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDMMFSNW  128

Query  533  LLMYLSDQEVESL  571
            LLMYLSD+EVE L
Sbjct  129  LLMYLSDKEVEKL  141



>dbj|BAC57960.1| phosphoethanolamine N-methyltransferase [Aster tripolium]
Length=493

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  155  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  334
                G+ERE+QK+YW+EHS +LTVE+MMLDS A+DLDKEERPEVLS+LP+YEGK VLELG
Sbjct  3    GVINGDEREIQKNYWVEHSVDLTVESMMLDSMASDLDKEERPEVLSLLPSYEGKRVLELG  62

Query  335  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  514
            AGIGRFTGELA+ AG+VIA+DFIESV+KKNE+INGH  N+KFMCADVTS DL F  ESID
Sbjct  63   AGIGRFTGELAKTAGEVIALDFIESVVKKNESINGHCKNVKFMCADVTSPDLRFPAESID  122

Query  515  LIFSNWLLMYLSDQEVESL  571
            LIFSNWLLMYLSD+EVE +
Sbjct  123  LIFSNWLLMYLSDKEVEDI  141



>gb|AEY75253.1| phosphoethanolamine N-methyltransferase [Atriplex canescens]
Length=494

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            EREV K YW+EHS +LTVEAMMLDS+A+DLDKEERPEVLSMLP YEGKSVLELGAGIGRF
Sbjct  11   EREVFKKYWVEHSVDLTVEAMMLDSQASDLDKEERPEVLSMLPPYEGKSVLELGAGIGRF  70

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            TGELA+KAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS  LN S  S+D+IFSNW
Sbjct  71   TGELAEKAGQVIALDFIESVIKKNECINGHYKNVKFMCADVTSPSLNISPNSVDIIFSNW  130

Query  533  LLMYLSDQEVESL  571
            LLMYLSD+EVE L
Sbjct  131  LLMYLSDEEVERL  143



>ref|XP_010274723.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Nelumbo nucifera]
Length=489

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 1/140 (1%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA Q EEREVQKSYWIEHSSELT+EAMMLDSKAADLDKEERPEVLS+LP ++GK VLEL
Sbjct  1    MAA-QVEEREVQKSYWIEHSSELTIEAMMLDSKAADLDKEERPEVLSLLPPFKGKDVLEL  59

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFT E A++A QV+A+DFIESVIKKNE++NGH  N+KF+CADVTS DL  + ES+
Sbjct  60   GAGIGRFTSEFAKEANQVLALDFIESVIKKNESVNGHFKNVKFLCADVTSPDLKIAPESV  119

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  120  DLIFSNWLLMYLSDKEVEKL  139



>ref|XP_006490771.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Citrus sinensis]
Length=489

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = +2

Query  158  AFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGA  337
            A QGE RE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GA
Sbjct  2    AGQGE-REIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGA  60

Query  338  GIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDL  517
            GIGRFTGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS DL FS++S+D+
Sbjct  61   GIGRFTGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDM  120

Query  518  IFSNWLLMYLSDQEVESL  571
            +FSNWLLMYLSD+EVE L
Sbjct  121  MFSNWLLMYLSDKEVEKL  138



>dbj|BAD93609.1| hypothetical protein [Cucumis melo]
Length=211

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +2

Query  140  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  319
              +   A   +ER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKS
Sbjct  3    TPTPAPALNDDERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKS  62

Query  320  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  499
            VLELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S
Sbjct  63   VLELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKIS  122

Query  500  DESIDLIFSNWLLMYLSDQEVESL  571
            + S+DLIFSNWLLMYLSD EV++L
Sbjct  123  ENSVDLIFSNWLLMYLSDIEVKNL  146



>ref|XP_006451624.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
 ref|XP_006490770.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Citrus sinensis]
 gb|ESR64864.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
Length=492

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            ERE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GAGIGRF
Sbjct  9    EREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRF  68

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            TGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS DL FS++S+D++FSNW
Sbjct  69   TGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDMMFSNW  128

Query  533  LLMYLSDQEVESL  571
            LLMYLSD+EVE L
Sbjct  129  LLMYLSDKEVEKL  141



>gb|AGI56231.1| phosphoethanolamine N-methyltransferase [Lycium barbarum]
Length=498

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ER++QK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  15   QERDIQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLELGAGIGR  74

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FT ELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS DL  S ES+DLIFSN
Sbjct  75   FTSELAKNAGQLIALDFIESAIKKNESINKHHKNVKFMCADVTSPDLKISPESVDLIFSN  134

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EV+SL
Sbjct  135  WLLMYLSDEEVQSL  148



>gb|AFW83641.1| hypothetical protein ZEAMMB73_560974 [Zea mays]
Length=244

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  167  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  346
             EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEGKSVLELGAGIG
Sbjct  18   AEERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEGKSVLELGAGIG  77

Query  347  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  526
            RFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL     SIDLIFS
Sbjct  78   RFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQDLVLQANSIDLIFS  137

Query  527  NWLLMYLSDQEVESL  571
            NWLLMYLSD+EVE L
Sbjct  138  NWLLMYLSDEEVEQL  152



>ref|XP_010461752.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Camelina 
sativa]
Length=492

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER +QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGR
Sbjct  8    EERHIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGR  67

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +  SIDLIFSN
Sbjct  68   FTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIAVGSIDLIFSN  127

Query  530  WLLMYLSDQEVE  565
            WLLMYLSD+EVE
Sbjct  128  WLLMYLSDKEVE  139



>pir||H96762 hypothetical protein F6D5.1 [imported] - Arabidopsis thaliana
 gb|AAG51806.1|AC079676_1 phosphoethanolamine N-methyltransferase, putative; 6854-3993 
[Arabidopsis thaliana]
Length=555

 Score =   231 bits (590),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = +2

Query  80   FSV-RIAFPGFLDFFYLFTAIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAA  256
            FS+ R  +P      +LF ++    MA++ GEERE+QK+YW EHS  L+VEAMMLDSKA+
Sbjct  41   FSIHRFHYPREKIVSFLFPSVFSRIMASY-GEEREIQKNYWKEHSVGLSVEAMMLDSKAS  99

Query  257  DLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETIN  436
            DLDKEERPE+L+ LP  EG +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE IN
Sbjct  100  DLDKEERPEILAFLPPIEGTTVLEFGAGIGRFTTELAQKAGQVIAVDFIESVIKKNENIN  159

Query  437  GHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESL  571
            GH  N+KF+CADVTS ++NF +ES+DLIFSNWLLMYLSDQEVE L
Sbjct  160  GHYKNVKFLCADVTSPNMNFPNESMDLIFSNWLLMYLSDQEVEDL  204



>ref|XP_010097561.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
 gb|EXB69093.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
Length=519

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  167  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  346
            GEERE+QK+YW E+S++LT+E+MMLDSKA+DLDKEERPEVLS+LP +EGKSVLELGAGIG
Sbjct  11   GEEREIQKTYWTENSADLTIESMMLDSKASDLDKEERPEVLSVLPPFEGKSVLELGAGIG  70

Query  347  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  526
            RFTGELAQKAGQV+A+DFIESVIKKNE INGH  N+KFMCADVTS +L  S+ S+DLIFS
Sbjct  71   RFTGELAQKAGQVLALDFIESVIKKNEEINGHYENVKFMCADVTSPELKISEGSVDLIFS  130

Query  527  NWLLMYLSDQEVESL  571
            NWLLMYLSD+EVE+L
Sbjct  131  NWLLMYLSDKEVENL  145



>ref|XP_010461683.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=492

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER +QKSYW+EHSS+LTVEAMMLDSKA+DLD+EERPEVLS++P YEGKSVLELGAGIGR
Sbjct  8    EERHIQKSYWMEHSSDLTVEAMMLDSKASDLDREERPEVLSLIPPYEGKSVLELGAGIGR  67

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +  SIDLIFSN
Sbjct  68   FTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIAVGSIDLIFSN  127

Query  530  WLLMYLSDQEVE  565
            WLLMYLSD+EVE
Sbjct  128  WLLMYLSDKEVE  139



>ref|XP_003528975.2| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN44632.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=531

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = +2

Query  122  YLFTAIVQSAMAAFQG--EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSM  295
            +LF++  Q  MA+     +ER VQ+SYWIEH+++L+VE+MMLDS A+DLDKEERPEVLS+
Sbjct  30   FLFSSFCQPYMASLATVQDERCVQRSYWIEHTTDLSVESMMLDSNASDLDKEERPEVLSL  89

Query  296  LPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADV  475
            LPAYEGKSV+ELGAGIGRFTGELA+KAGQ++A+DFIES IKKNE+INGH  N+KFMCADV
Sbjct  90   LPAYEGKSVVELGAGIGRFTGELAKKAGQLLAVDFIESAIKKNESINGHHKNVKFMCADV  149

Query  476  TSKDLNFSDESIDLIFSNWLLMYLSDQEVESL  571
            TS +L+ S+ S+DL+FSNWLLMYLSD+EVE+L
Sbjct  150  TSPNLHISEGSVDLMFSNWLLMYLSDKEVENL  181



>emb|CDY11100.1| BnaC06g23520D [Brassica napus]
Length=506

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  316
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  317  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  496
             VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D+ F
Sbjct  70   KVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPDMKF  129

Query  497  SDESIDLIFSNWLLMYLSDQEVESL  571
            S ES+DL+FSNWLLMYLSD+EVE L
Sbjct  130  SSESMDLVFSNWLLMYLSDKEVEDL  154



>sp|Q9M571.1|PEAMT_SPIOL RecName: Full=Phosphoethanolamine N-methyltransferase [Spinacia 
oleracea]
 gb|AAF61950.1|AF237633_1 phosphoethanolamine N-methyltransferase [Spinacia oleracea]
Length=494

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +2

Query  146  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  325
            SAM   Q  EREV K YWIEHS +LTVEAMMLDS+A+DLDK ERPEVLSMLP YEGKSVL
Sbjct  4    SAMGVLQ--EREVFKKYWIEHSVDLTVEAMMLDSQASDLDKVERPEVLSMLPPYEGKSVL  61

Query  326  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  505
            ELGAGIGRFTGELA+KA QVIA+DFIESVIKKNE+INGH  N+KFMCADVTS  LN S  
Sbjct  62   ELGAGIGRFTGELAEKASQVIALDFIESVIKKNESINGHYKNVKFMCADVTSPSLNISPN  121

Query  506  SIDLIFSNWLLMYLSDQEVESL  571
            S+D+IFSNWLLMYLSD+EVE L
Sbjct  122  SVDIIFSNWLLMYLSDEEVERL  143



>ref|XP_010686587.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +EREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   QEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTG+LA+KAGQVIA+DFIES IKKNE +NGH  N+KFMCADVTS  LN S  S+D+IFSN
Sbjct  70   FTGDLAKKAGQVIALDFIESAIKKNECVNGHYKNVKFMCADVTSPSLNISPNSVDIIFSN  129

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EV+ L
Sbjct  130  WLLMYLSDEEVQRL  143



>dbj|BAE07178.1| phosphoethanolamine N-methyltransferase [Beta vulgaris]
Length=494

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +EREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   QEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTG+LA+KAGQVIA+DFIES IKKNE +NGH  N+KFMCADVTS  LN S  S+D+IFSN
Sbjct  70   FTGDLAKKAGQVIALDFIESAIKKNECVNGHYKNVKFMCADVTSPSLNISPNSVDIIFSN  129

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EV+ L
Sbjct  130  WLLMYLSDEEVQRL  143



>ref|XP_009782224.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=496

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            +AA   +ERE+QKSYW+E ++ELT+EAMMLDS+A+DLDKE+RPEVLS+LP+YEGKSVLEL
Sbjct  6    IAAAPEQEREIQKSYWMEQAAELTLEAMMLDSEASDLDKEDRPEVLSLLPSYEGKSVLEL  65

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTG+LA+KAGQ+ A+DF+E VIKKNE+INGH  N+KFMCADVTS DL FS ES+
Sbjct  66   GAGIGRFTGDLAEKAGQLTALDFVEGVIKKNESINGHHKNVKFMCADVTSPDLTFSPESV  125

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EV+ L
Sbjct  126  DLIFSNWLLMYLSDKEVQDL  145



>ref|XP_011014101.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Populus euphratica]
Length=490

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA Q EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAA-QVEEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLEL  59

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLNFS+ S+
Sbjct  60   GAGIGRFTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNFSEGSV  119

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE+L
Sbjct  120  DLIFSNWLLMYLSDKEVENL  139



>ref|XP_011039130.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Populus 
euphratica]
Length=490

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA Q EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAA-QVEEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLEL  59

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLNFS+ S+
Sbjct  60   GAGIGRFTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNFSEGSV  119

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE+L
Sbjct  120  DLIFSNWLLMYLSDKEVENL  139



>gb|KDP23923.1| hypothetical protein JCGZ_27083 [Jatropha curcas]
Length=491

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA   EERE+QK+YWIE+S  LTVEAMMLDS A+ LDKEERPEVLSMLP YEGKSVLE 
Sbjct  1    MAAAHVEEREIQKNYWIENSDGLTVEAMMLDSNASLLDKEERPEVLSMLPPYEGKSVLEF  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGE+AQ AGQ++A+DFI++VIKKNE INGH  N+KF+CADVTS+DL FS+ES+
Sbjct  61   GAGIGRFTGEIAQNAGQLVAVDFIDNVIKKNERINGHHKNVKFICADVTSEDLKFSEESV  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+E+E+L
Sbjct  121  DLIFSNWLLMYLSDKEIENL  140



>ref|XP_008799221.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Phoenix dactylifera]
Length=492

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +2

Query  152  MAAFQGEE-REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  328
            MAAF GEE R VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSVLE
Sbjct  1    MAAFSGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSVLE  60

Query  329  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  508
            LGAGIGRFTGELA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS DL    ES
Sbjct  61   LGAGIGRFTGELAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPDLMIEAES  120

Query  509  IDLIFSNWLLMYLSDQEVESL  571
            +DLIFSNWLLMYLSD EVE L
Sbjct  121  VDLIFSNWLLMYLSDNEVEGL  141



>gb|EYU24136.1| hypothetical protein MIMGU_mgv1a005261mg [Erythranthe guttata]
Length=491

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA   +EREVQK+YW+EHS  LT+E MMLDSKA+DLDKEERPEVL+MLP YEGKS+LEL
Sbjct  1    MAAITEQEREVQKNYWVEHSVNLTLEDMMLDSKASDLDKEERPEVLAMLPPYEGKSILEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELA+KAG V A+DFIESVIKKNE IN H  N++FMCADVTS DLNF + S+
Sbjct  61   GAGIGRFTGELAKKAGHVTALDFIESVIKKNEAINKHHKNVEFMCADVTSPDLNFPEGSL  120

Query  512  DLIFSNWLLMYLSDQEVESL  571
            D+IFSNWLLMYLSD EVE L
Sbjct  121  DMIFSNWLLMYLSDAEVEKL  140



>ref|XP_008799219.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Phoenix dactylifera]
Length=494

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 3/143 (2%)
 Frame = +2

Query  152  MAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  322
            MAAF G   EER VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSV
Sbjct  1    MAAFSGAGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSV  60

Query  323  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSD  502
            LELGAGIGRFTGELA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS DL    
Sbjct  61   LELGAGIGRFTGELAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPDLMIEA  120

Query  503  ESIDLIFSNWLLMYLSDQEVESL  571
            ES+DLIFSNWLLMYLSD EVE L
Sbjct  121  ESVDLIFSNWLLMYLSDNEVEGL  143



>gb|AAM97038.1| phosphoethanolamine N-methyltransferase, putative [Arabidopsis 
thaliana]
Length=376

 Score =   223 bits (569),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEFGAGIGR  79

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+DLIFSN
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESMDLIFSN  139

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSDQEVE L
Sbjct  140  WLLMYLSDQEVEDL  153



>ref|NP_177501.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 sp|Q9C6B9.2|PEAM3_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35481.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=490

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MA++ GEERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE 
Sbjct  1    MASY-GEEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEF  59

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+
Sbjct  60   GAGIGRFTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESM  119

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSDQEVE L
Sbjct  120  DLIFSNWLLMYLSDQEVEDL  139



>ref|XP_010678114.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EEREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   EEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTG+LA KA QVIA+DFIES IKKNE +NGH  N+KFMCADVTS  LN S  S+D+IFSN
Sbjct  70   FTGDLANKADQVIALDFIESAIKKNECVNGHYKNVKFMCADVTSPSLNISPNSVDIIFSN  129

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EV+ L
Sbjct  130  WLLMYLSDEEVQHL  143



>ref|XP_008799258.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Phoenix dactylifera]
Length=447

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 124/144 (86%), Gaps = 4/144 (3%)
 Frame = +2

Query  152  MAAFQG----EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  319
            MAA  G    EER VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS
Sbjct  1    MAAINGGGGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKS  60

Query  320  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  499
            VLELGAGIGRFTGELA++AG V+A+DFIE+VIKKNE+ NGHL NI F+CADVTS DL   
Sbjct  61   VLELGAGIGRFTGELAKEAGHVLALDFIENVIKKNESANGHLKNISFVCADVTSPDLMIE  120

Query  500  DESIDLIFSNWLLMYLSDQEVESL  571
             ES+DLIFSNWLLMYLSD EVE L
Sbjct  121  AESVDLIFSNWLLMYLSDNEVEKL  144



>ref|XP_007152684.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
 gb|ESW24678.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
Length=497

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 3/145 (2%)
 Frame = +2

Query  146  SAMAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  316
            +++A  QG   +ER VQKSYWIEH++EL+VE+MMLDS A+ LDKEERPEVLS+LPAYEGK
Sbjct  2    ASLAMVQGGGVDERCVQKSYWIEHTTELSVESMMLDSNASHLDKEERPEVLSLLPAYEGK  61

Query  317  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  496
            SVLELGAGIGRFTGELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +L  
Sbjct  62   SVLELGAGIGRFTGELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPNLQI  121

Query  497  SDESIDLIFSNWLLMYLSDQEVESL  571
            S+ S+DLIFSNWLLMYLSD+EVE+L
Sbjct  122  SEGSVDLIFSNWLLMYLSDKEVENL  146



>ref|XP_006390538.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
 gb|ESQ27824.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
Length=504

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  140  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  319
            + S+ +    EERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+L++LP  +G++
Sbjct  10   IASSFSKNSWEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILALLPPIDGRT  69

Query  320  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  499
            VLE GAGIGRFT ELAQKAG+VIA+DFI+SVIKKNE INGH  N++FMCADVTS D+NFS
Sbjct  70   VLEFGAGIGRFTSELAQKAGKVIAVDFIDSVIKKNENINGHYKNVEFMCADVTSPDMNFS  129

Query  500  DESIDLIFSNWLLMYLSDQEVESL  571
            DES+DLIFSNWLLMYLSD+EVE L
Sbjct  130  DESMDLIFSNWLLMYLSDKEVEDL  153



>gb|EMT21187.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=503

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  20   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  79

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  80   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  139

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD EVE L
Sbjct  140  WLLMYLSDAEVEKL  153



>ref|XP_006843796.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
 gb|ERN05471.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
Length=489

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 127/140 (91%), Gaps = 2/140 (1%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA QGE RE+QKSYWIEHSS+LTVEAMMLDSKAA+LDKEERPEVLS+LP ++GK+VLEL
Sbjct  1    MAA-QGE-REIQKSYWIEHSSDLTVEAMMLDSKAAELDKEERPEVLSLLPPFKGKNVLEL  58

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTGELA++AG V A+DFI+SVIKKNE INGH  NIKF+CADVTS +L F+ ES+
Sbjct  59   GAGIGRFTGELAKEAGHVTALDFIKSVIKKNEKINGHYKNIKFVCADVTSPELQFAPESV  118

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DL+FSNWLLMYLSD EVE L
Sbjct  119  DLLFSNWLLMYLSDAEVEDL  138



>gb|ACV89824.1| S-adenosyl-L-methionine:phosphoethanolamine N-methyltransferase 
[Triticum aestivum]
Length=505

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  22   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  81

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  82   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  141

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD EVE L
Sbjct  142  WLLMYLSDAEVEKL  155



>emb|CDM83845.1| unnamed protein product [Triticum aestivum]
Length=504

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  21   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  80

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  81   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  140

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD EVE L
Sbjct  141  WLLMYLSDAEVEKL  154



>gb|EMS54147.1| Phosphoethanolamine N-methyltransferase 1 [Triticum urartu]
Length=504

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  21   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  80

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  81   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  140

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD EVE L
Sbjct  141  WLLMYLSDAEVEKL  154



>ref|XP_004161835.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
1 [Cucumis sativus]
Length=527

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  161  FQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAG  340
            F G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPEVLS+LP  +GK+VLELGAG
Sbjct  40   FTGQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEVLSLLPPCDGKTVLELGAG  99

Query  341  IGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLI  520
            IGRFTGELAQKAG VIA+DFIE+ IKKNE+ N H  N+KF+CADVTS +L  SDESIDLI
Sbjct  100  IGRFTGELAQKAGNVIALDFIENAIKKNESTNSHHKNVKFVCADVTSSELKISDESIDLI  159

Query  521  FSNWLLMYLSDQEVESL  571
            FSNWLLMYLSD+EVESL
Sbjct  160  FSNWLLMYLSDKEVESL  176



>ref|XP_004503268.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cicer 
arietinum]
Length=490

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ERE+QKSYW++H ++L+VEAMMLDSKA+DLDKEERPEVLS+LPAYEGKSV+ELGAGIGR
Sbjct  6    DEREIQKSYWVQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPAYEGKSVIELGAGIGR  65

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS ++  S+ S+D+IFSN
Sbjct  66   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPNMKVSEGSVDVIFSN  125

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD EVE+L
Sbjct  126  WLLMYLSDNEVENL  139



>ref|XP_003569614.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Brachypodium 
distachyon]
Length=502

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EERE QK YW EHS +LTVEAMMLDS AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  19   EEREAQKKYWEEHSRDLTVEAMMLDSHAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  78

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  79   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  138

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  139  WLLMYLSDEEVEKL  152



>ref|XP_011008809.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X2 [Populus euphratica]
Length=490

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  6    EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  65

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ S+DLIFSN
Sbjct  66   FTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEGSVDLIFSN  125

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE+L
Sbjct  126  WLLMYLSDKEVENL  139



>ref|XP_011008808.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Populus euphratica]
Length=506

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  22   EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  81

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ S+DLIFSN
Sbjct  82   FTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEGSVDLIFSN  141

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE+L
Sbjct  142  WLLMYLSDKEVENL  155



>ref|XP_008464197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=493

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  167  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  346
            G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPE+LS+LP Y+GK+VLELGAGIG
Sbjct  8    GQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEILSLLPPYDGKTVLELGAGIG  67

Query  347  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  526
            RFTGELAQKAG VIA+DFIE+ IKKNE IN H  N+KF+CADVTS +L  SDES+DLIFS
Sbjct  68   RFTGELAQKAGNVIALDFIENAIKKNERINSHHKNVKFVCADVTSSELKISDESVDLIFS  127

Query  527  NWLLMYLSDQEVESL  571
            NWLLMYLSD+EVE+ 
Sbjct  128  NWLLMYLSDKEVENF  142



>ref|XP_006644536.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=499

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER+ QKSYW EHS +LTVEAMMLDS+A DLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRATDLDKEERPEILSLLPSYEGKSVLELGAGIGR  75

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  76   FTGELAKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTSPDLMIEDNSIDLIFSN  135

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  136  WLLMYLSDEEVEKL  149



>gb|ACJ83326.1| unknown [Medicago truncatula]
Length=221

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  149  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  328
            AM     +EREVQ+SYW EH   L+VE+MMLDS A+ LDKEERPEVLS+LP+YEGKSVLE
Sbjct  6    AMKQGGEDEREVQRSYWKEHCVNLSVESMMLDSNASHLDKEERPEVLSLLPSYEGKSVLE  65

Query  329  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  508
            LGAGIGRFT ELAQKAGQ++A+DFIES IKKNE  NGH  N+KFMCADVTS +L+ S+ S
Sbjct  66   LGAGIGRFTAELAQKAGQLLAVDFIESAIKKNENTNGHHKNVKFMCADVTSPNLHISEGS  125

Query  509  IDLIFSNWLLMYLSDQEVESL  571
            +DLIFSNWLLMYLSD+EV++L
Sbjct  126  VDLIFSNWLLMYLSDEEVKNL  146



>ref|XP_010416170.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Camelina 
sativa]
Length=490

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA+ GEERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  1    MAAY-GEEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  59

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+
Sbjct  60   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKNINGHYRNVKFMCADVTSPDMKFPNDSM  119

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  120  DLIFSNWLLMYLSDKEVEDL  139



>ref|XP_002322102.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
 gb|EEF06229.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
Length=516

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  22   EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  81

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ S+DLIFSN
Sbjct  82   FTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEGSVDLIFSN  141

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE+L
Sbjct  142  WLLMYLSDKEVENL  155



>dbj|BAH01482.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64589.1| hypothetical protein OsJ_19441 [Oryza sativa Japonica Group]
Length=495

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            ER+ Q+SYW EHS +LTVEAMMLDS+AADLDKEERPEVLS+LP+Y+GKSVLELGAGIGRF
Sbjct  13   ERKAQRSYWEEHSKDLTVEAMMLDSRAADLDKEERPEVLSVLPSYKGKSVLELGAGIGRF  72

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            TGELA++AG V+A+DFIESVIKKNE INGH  NI FMCADVTS DL   D SIDLIFSNW
Sbjct  73   TGELAKEAGHVLALDFIESVIKKNENINGHHKNITFMCADVTSPDLTIEDNSIDLIFSNW  132

Query  533  LLMYLSDQEVESL  571
            LLMYLSD+EVE L
Sbjct  133  LLMYLSDEEVEKL  145



>ref|XP_009595958.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=496

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            +AA   +ERE+QKSYWIE ++ELT++AMMLDS+A+DLDKE+RPEVLS+LP YEGKSVLEL
Sbjct  6    IAAAPEQEREIQKSYWIEQAAELTLKAMMLDSEASDLDKEDRPEVLSLLPPYEGKSVLEL  65

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFTG LA+KAGQ+  +DF+E VIKKNE+INGH  N+KFMCADVTS DL FS ES+
Sbjct  66   GAGIGRFTGGLAEKAGQLTTLDFVEDVIKKNESINGHHKNVKFMCADVTSPDLTFSPESV  125

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EV+ L
Sbjct  126  DLIFSNWLLMYLSDKEVQDL  145



>ref|XP_010428286.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Camelina sativa]
Length=492

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 124/140 (89%), Gaps = 1/140 (1%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA+ GEERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  3    MAAY-GEEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  61

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+
Sbjct  62   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKYINGHYKNVKFMCADVTSPDMKFPNDSM  121

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  122  DLIFSNWLLMYLSDKEVEDL  141



>gb|KEH21430.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=456

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD EVE+L
Sbjct  131  WLLMYLSDNEVENL  144



>gb|KEH21429.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=469

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD EVE+L
Sbjct  131  WLLMYLSDNEVENL  144



>gb|AAF79704.1|AC020889_12 T1N15.22 [Arabidopsis thaliana]
Length=180

 Score =   214 bits (546),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  200  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  379
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFTGELAQKAG  60

Query  380  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  559
            +VIA+DFIES I+KNE++NGH  NIKFMCADVTS DL   D SIDLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSIDLIFSNWLLMYLSDKE  120

Query  560  VE  565
            VE
Sbjct  121  VE  122



>ref|XP_004137500.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004161836.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
2 [Cucumis sativus]
 gb|KGN64173.1| hypothetical protein Csa_1G042800 [Cucumis sativus]
Length=493

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  167  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  346
            G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPEVLS+LP  +GK+VLELGAGIG
Sbjct  8    GQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEVLSLLPPCDGKTVLELGAGIG  67

Query  347  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  526
            RFTGELAQKAG VIA+DFIE+ IKKNE+ N H  N+KF+CADVTS +L  SDESIDLIFS
Sbjct  68   RFTGELAQKAGNVIALDFIENAIKKNESTNSHHKNVKFVCADVTSSELKISDESIDLIFS  127

Query  527  NWLLMYLSDQEVESL  571
            NWLLMYLSD+EVESL
Sbjct  128  NWLLMYLSDKEVESL  142



>ref|XP_003631125.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AET05601.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=488

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  5    DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  64

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  65   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  124

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD EVE+L
Sbjct  125  WLLMYLSDNEVENL  138



>dbj|BAJ97525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  25   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  84

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+ AG V+AMDFI SVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  85   FTGELAKTAGHVLAMDFIGSVIKKNESINGHYENASFMCADVTSPDLVIEDNSIDLIFSN  144

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  145  WLLMYLSDEEVEKL  158



>ref|XP_003631124.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=495

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD EVE+L
Sbjct  131  WLLMYLSDNEVENL  144



>gb|AET05600.2| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=494

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD EVE+L
Sbjct  131  WLLMYLSDNEVENL  144



>gb|AAS57723.1| phosphoethanolamine N-methyltransferase [Oryza sativa]
Length=499

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  DL   D SIDLIFSN
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPDLMIEDNSIDLIFSN  135

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  136  WLLMYLSDEEVEKL  149



>ref|NP_001043957.1| Os01g0695100 [Oryza sativa Japonica Group]
 dbj|BAF05871.1| Os01g0695100 [Oryza sativa Japonica Group]
Length=499

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  DL   D SIDLIFSN
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPDLMIEDNSIDLIFSN  135

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  136  WLLMYLSDEEVEKL  149



>ref|XP_002887491.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63750.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +2

Query  158  AFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGA  337
            A  GEERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L++LP  EGK+VLE GA
Sbjct  2    AVYGEEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILALLPPIEGKTVLEFGA  61

Query  338  GIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDL  517
            GIGRFT  LA KAGQ+IA+DFIESVIKKN+ INGH  N+KF+CADVTS D+NF +ES+DL
Sbjct  62   GIGRFTTNLAHKAGQLIAVDFIESVIKKNQNINGHYKNVKFLCADVTSPDMNFPNESMDL  121

Query  518  IFSNWLLMYLSDQEVESL  571
            IFSNWLLMYLSD+EVE L
Sbjct  122  IFSNWLLMYLSDREVEDL  139



>ref|NP_001148925.1| LOC100282545 [Zea mays]
 gb|ACG33501.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +2

Query  134  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  313
            A V S       EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEG
Sbjct  7    ATVVSLNGKMGAEERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEG  66

Query  314  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLN  493
            KSVLELGAGIGRFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL 
Sbjct  67   KSVLELGAGIGRFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQDLV  126

Query  494  FSDESIDLIFSNWLLMYLSDQEVESL  571
                SIDLIFSNWLLMYLSD+EVE L
Sbjct  127  LQANSIDLIFSNWLLMYLSDEEVEQL  152



>gb|EEE55232.1| hypothetical protein OsJ_03109 [Oryza sativa Japonica Group]
Length=509

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  DL   D SIDLIFSN
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPDLMIEDNSIDLIFSN  135

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  136  WLLMYLSDEEVEKL  149



>gb|KFK41794.1| hypothetical protein AALP_AA2G173000 [Arabis alpina]
Length=505

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  137  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  316
            ++ S+     GEERE+QK+YW EHS++L+VE+MMLDS+AADLDKEERPE++++LP  EGK
Sbjct  10   MISSSFPKNLGEEREIQKNYWKEHSADLSVESMMLDSQAADLDKEERPEIVALLPPIEGK  69

Query  317  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  496
            +VLE GAGIGRFT ELA+KAG VIA+DFI++ IKKN+ INGH  N+KFMCADVTS D+ F
Sbjct  70   TVLEFGAGIGRFTTELARKAGHVIAVDFIDNAIKKNQNINGHYKNVKFMCADVTSPDMKF  129

Query  497  SDESIDLIFSNWLLMYLSDQEVESL  571
            SDES+DLIFSNWLLMYLSD+EVE L
Sbjct  130  SDESMDLIFSNWLLMYLSDKEVEDL  154



>ref|NP_974139.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35480.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=504

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEFGAGIGR  79

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+DLIFSN
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESMDLIFSN  139

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSDQEVE L
Sbjct  140  WLLMYLSDQEVEDL  153



>ref|XP_006302164.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
 gb|EOA35062.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
Length=503

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+L++LP  EGK+VLE GAGIGR
Sbjct  19   EEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILALLPPIEGKTVLEFGAGIGR  78

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+DLIFSN
Sbjct  79   FTTELAQKAGQLIAVDFIESVIKKNKKINGHYKNVKFMCADVTSPDMKFPNDSVDLIFSN  138

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  139  WLLMYLSDKEVEDL  152



>ref|XP_002456194.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
 gb|EES01314.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
Length=501

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  131  TAIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYE  310
            TA V S       EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP++E
Sbjct  5    TAAVVSVNGKMGVEERQAQKSYWEEHSRNLTVEAMMLDSRAADLDKEERPEVLSLLPSFE  64

Query  311  GKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL  490
            GKSVLELGAGIGRFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL
Sbjct  65   GKSVLELGAGIGRFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSEDL  124

Query  491  NFSDESIDLIFSNWLLMYLSDQEVESL  571
                 SIDLIFSNWLLMYLSD+EVE L
Sbjct  125  VLPASSIDLIFSNWLLMYLSDEEVEQL  151



>ref|XP_006365411.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Solanum 
tuberosum]
Length=494

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  146  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  325
            +A+A   G+ERE+QKSYW+E ++EL +EAMMLDS A+DLDKE+RPEVLS+LP+YEGKSVL
Sbjct  2    AAIAPGVGQEREIQKSYWMEQTTELNLEAMMLDSAASDLDKEDRPEVLSLLPSYEGKSVL  61

Query  326  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  505
            ELGAGIGRFTG++A+KAG+++ +DFIE VIKKNE+INGH  N+KF+CADVTS DL F  E
Sbjct  62   ELGAGIGRFTGDIAEKAGELVTVDFIEEVIKKNESINGHHKNVKFVCADVTSPDLTFLPE  121

Query  506  SIDLIFSNWLLMYLSDQEVESL  571
            S+DLIFSNWLLMYLSD+EV+ L
Sbjct  122  SVDLIFSNWLLMYLSDEEVQDL  143



>ref|XP_010471422.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Camelina sativa]
Length=490

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MAA+  EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  1    MAAYV-EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  59

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+
Sbjct  60   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKNINGHYKNVKFMCADVTSPDMKFPNDSM  119

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE L
Sbjct  120  DLIFSNWLLMYLSDKEVEDL  139



>ref|XP_010921161.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Elaeis 
guineensis]
Length=494

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +2

Query  152  MAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  322
            MAA  G   EER VQKSYW+EHS +LTV AMMLDS+A +LDKEERPEVLS+LP Y+GKSV
Sbjct  1    MAAVSGAGEEERMVQKSYWMEHSKDLTVAAMMLDSRATNLDKEERPEVLSLLPPYKGKSV  60

Query  323  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSD  502
            LELGAGIGRFTGELA++AG V+A+DFIE+VIKKNE+INGH  N  FMCADVTS DL   +
Sbjct  61   LELGAGIGRFTGELAKEAGHVLALDFIENVIKKNESINGHFTNTSFMCADVTSPDLLIEE  120

Query  503  ESIDLIFSNWLLMYLSDQEVESL  571
            ES+DLIFSNWLLMYLSD EVE L
Sbjct  121  ESVDLIFSNWLLMYLSDNEVERL  143



>ref|XP_003567962.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Brachypodium distachyon]
Length=501

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = +2

Query  134  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  313
            A++      F G ER+VQKSYW EHS +LTVE+MMLDS+A DLDKEERPEVLS+LP+YEG
Sbjct  5    AVIAVVENGFVGVERKVQKSYWEEHSRDLTVESMMLDSRAKDLDKEERPEVLSILPSYEG  64

Query  314  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHL-GNIKFMCADVTSKDL  490
            K+VLELGAGIGRFTGELA++AG V+A+DFI+SVIKKNE INGH+  NI FMCADVTS +L
Sbjct  65   KTVLELGAGIGRFTGELAKEAGHVLALDFIDSVIKKNEEINGHIHNNITFMCADVTSPEL  124

Query  491  NFSDESIDLIFSNWLLMYLSDQEVESL  571
               D SIDL+FSNWLLMYLSD+EVE L
Sbjct  125  KIEDNSIDLVFSNWLLMYLSDEEVEKL  151



>ref|XP_004969638.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  16   EERQAQKSYWEEHSRDLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLELGAGIGR  75

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL     SID+IFSN
Sbjct  76   FTGELAKTAGNVLALDFIESAIKKNESINGHFKNASFMCADVTSQDLVIQANSIDMIFSN  135

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  136  WLLMYLSDEEVEQL  149



>gb|AFW83642.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   222 bits (565),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  19   EERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEGKSVLELGAGIGR  78

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL     SIDLIFSN
Sbjct  79   FTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQDLVLQANSIDLIFSN  138

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  139  WLLMYLSDEEVEQL  152



>ref|XP_004166029.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase-like 
[Cucumis sativus]
Length=500

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +2

Query  146  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  325
            +   A   EER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVL
Sbjct  5    TPAPALNDEERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVL  64

Query  326  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  505
            ELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S+ 
Sbjct  65   ELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKISEN  124

Query  506  SIDLIFSNWLLMYLSDQEVESL  571
            S+DLIFSNWLLMYLSD EV++L
Sbjct  125  SVDLIFSNWLLMYLSDIEVKNL  146



>ref|XP_004137341.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cucumis 
sativus]
Length=500

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +2

Query  146  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  325
            +   A   EER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVL
Sbjct  5    TPAPALNDEERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVL  64

Query  326  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  505
            ELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S+ 
Sbjct  65   ELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKISEN  124

Query  506  SIDLIFSNWLLMYLSDQEVESL  571
            S+DLIFSNWLLMYLSD EV++L
Sbjct  125  SVDLIFSNWLLMYLSDIEVKNL  146



>dbj|BAE99185.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
Length=504

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG + LE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTALEFGAGIGR  79

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+DLIFSN
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESMDLIFSN  139

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSDQEVE L
Sbjct  140  WLLMYLSDQEVEDL  153



>ref|XP_009385384.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=497

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +2

Query  167  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  346
            GEEREVQK YWIEHS ELTVEAMMLDS A++LDKEERPEVLS+LP Y+GKSVLELGAGIG
Sbjct  12   GEEREVQKIYWIEHSKELTVEAMMLDSHASELDKEERPEVLSLLPPYKGKSVLELGAGIG  71

Query  347  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  526
            RFTGELA++AG V+A+DFIESVI+KNE++NGH  N  FMCADV+S DL+   +S DLIFS
Sbjct  72   RFTGELAKEAGHVLALDFIESVIEKNESLNGHYKNTSFMCADVSSPDLSIEADSFDLIFS  131

Query  527  NWLLMYLSDQEVESL  571
            NWLLMYLSD+EVE L
Sbjct  132  NWLLMYLSDKEVEKL  146



>ref|XP_010921197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Elaeis guineensis]
Length=499

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER VQKS+W+EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGR
Sbjct  10   EERTVQKSFWMEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGR  69

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA++AG V+A+DFIE VIKKNE++NGH  NI FMCADVTS DL    ES+DLIFSN
Sbjct  70   FTGELAKEAGHVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPDLMIEAESVDLIFSN  129

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD EVE L
Sbjct  130  WLLMYLSDNEVEKL  143



>ref|XP_004961340.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=498

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  149  AMAAFQGE-EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  325
            A+A   GE ER+VQKSYW EHS  LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVL
Sbjct  7    AVANGIGEVERKVQKSYWEEHSKSLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVL  66

Query  326  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  505
            ELGAGIGRFTG+LA++AG V+A+DFIESVIKKNE+INGH  NI FMCADVTS +L   D 
Sbjct  67   ELGAGIGRFTGDLAKEAGHVLALDFIESVIKKNESINGHHKNITFMCADVTSPNLKIEDN  126

Query  506  SIDLIFSNWLLMYLSDQEVESL  571
            S DLIFSNWLLMYLSD+EVE L
Sbjct  127  SFDLIFSNWLLMYLSDEEVEKL  148



>ref|XP_008453479.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=500

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +2

Query  146  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  325
            +   A   +ER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVL
Sbjct  5    TPAPALNDDERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVL  64

Query  326  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  505
            ELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S+ 
Sbjct  65   ELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKISEN  124

Query  506  SIDLIFSNWLLMYLSDQEVESL  571
            S+DLIFSNWLLMYLSD EV++L
Sbjct  125  SVDLIFSNWLLMYLSDIEVKNL  146



>ref|XP_010471421.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Camelina sativa]
Length=504

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE GAGIGR
Sbjct  20   EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEFGAGIGR  79

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+DLIFSN
Sbjct  80   FTTELAQKAGQLIAVDFIESVIKKNKNINGHYKNVKFMCADVTSPDMKFPNDSMDLIFSN  139

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  140  WLLMYLSDKEVEDL  153



>ref|XP_009404071.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=497

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EEREVQKSYW+EHS +LT+EAMMLDS+A++LDKEERPEVLS+LP Y+GKSVLELGAGIGR
Sbjct  13   EEREVQKSYWMEHSRDLTLEAMMLDSRASELDKEERPEVLSLLPPYKGKSVLELGAGIGR  72

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FT ELA++AG V+A+DFIESVIKKNE++NGH  N  FMCADVTS DL    +S+DLIFSN
Sbjct  73   FTSELAKEAGHVLALDFIESVIKKNESLNGHYKNTSFMCADVTSPDLTIEADSVDLIFSN  132

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  133  WLLMYLSDKEVEKL  146



>ref|XP_004512744.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +2

Query  149  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  328
            AM   + +EREVQ++YW EH + L+VE+MMLDS A+ LDKEERPEVLS+LPAYEGKS+LE
Sbjct  6    AMTQVEEDEREVQRNYWREHCANLSVESMMLDSNASHLDKEERPEVLSLLPAYEGKSILE  65

Query  329  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  508
            LGAGIGRFT ELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +L+ S+ S
Sbjct  66   LGAGIGRFTSELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPNLHISEGS  125

Query  509  IDLIFSNWLLMYLSDQEVESL  571
            +DLIFSNWLLMYLSD+EVE+L
Sbjct  126  VDLIFSNWLLMYLSDEEVENL  146



>ref|XP_006393388.1| hypothetical protein EUTSA_v10012068mg, partial [Eutrema salsugineum]
 gb|ESQ30674.1| hypothetical protein EUTSA_v10012068mg, partial [Eutrema salsugineum]
Length=258

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MA    EER +QKSY  E+SS+LTVEA+MLDSK +D DKEERPEVLS++P YEGK+VLEL
Sbjct  1    MATPYKEERVIQKSYLKENSSDLTVEAIMLDSKDSDPDKEERPEVLSLIPPYEGKTVLEL  60

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIG FTGELAQKAG+VIA+DFIES IKKN ++NGH  N+KFMCADV S DL  +D SI
Sbjct  61   GAGIGHFTGELAQKAGEVIALDFIESAIKKNASVNGHYKNVKFMCADVRSPDLKITDASI  120

Query  512  DLIFSNWLLMYLSDQEVE  565
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>ref|XP_006655550.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=495

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            ER+ Q+SYW EHS  LTVEAMMLDS+AADLDKEERPE+LS+LP+Y+GKSVLELGAGIGRF
Sbjct  13   ERKAQRSYWEEHSKALTVEAMMLDSRAADLDKEERPEILSVLPSYKGKSVLELGAGIGRF  72

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            TGELA++AG V+A+DFIESVIKKNE  NGH  NI FMCADVTS DL   D SIDLIFSNW
Sbjct  73   TGELAKEAGHVLALDFIESVIKKNENTNGHHKNITFMCADVTSADLKIEDNSIDLIFSNW  132

Query  533  LLMYLSDQEVESL  571
            LLMYLSD+EV+ L
Sbjct  133  LLMYLSDEEVKKL  145



>ref|XP_010428285.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Camelina sativa]
Length=504

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE GAGIGR
Sbjct  20   EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEFGAGIGR  79

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+DLIFSN
Sbjct  80   FTTELAQKAGQLIAVDFIESVIKKNKYINGHYKNVKFMCADVTSPDMKFPNDSMDLIFSN  139

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  140  WLLMYLSDKEVEDL  153



>ref|XP_003534138.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN43631.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=490

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 126/140 (90%), Gaps = 1/140 (1%)
 Frame = +2

Query  152  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  331
            MA  Q +ER VQKSYWIEH+++L+VE+MMLDS A+DLDKEERPEVLS+LP YEGKSV+EL
Sbjct  1    MAMVQ-DERCVQKSYWIEHTTDLSVESMMLDSNASDLDKEERPEVLSLLPPYEGKSVVEL  59

Query  332  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  511
            GAGIGRFT ELA+KAGQ++A+DFIES IKKNE+INGH  N+KFMCADVTS +L  S+ S+
Sbjct  60   GAGIGRFTVELAKKAGQLLAVDFIESAIKKNESINGHHKNVKFMCADVTSPNLYISEGSV  119

Query  512  DLIFSNWLLMYLSDQEVESL  571
            DLIFSNWLLMYLSD+EVE+L
Sbjct  120  DLIFSNWLLMYLSDKEVENL  139



>ref|XP_010921188.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Elaeis guineensis]
Length=537

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER VQKS+W+EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGR
Sbjct  48   EERTVQKSFWMEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGR  107

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA++AG V+A+DFIE VIKKNE++NGH  NI FMCADVTS DL    ES+DLIFSN
Sbjct  108  FTGELAKEAGHVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPDLMIEAESVDLIFSN  167

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD EVE L
Sbjct  168  WLLMYLSDNEVEKL  181



>dbj|BAC57432.1| phosphoethanolamine N-methyltransferase [Suaeda japonica]
Length=494

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS  L+F   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTSPTLSFPPHSLDVIFSN  129

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE+L
Sbjct  130  WLLMYLSDEEVENL  143



>gb|AFW04224.1| phosphoethanolamine N-methyl transferase [Suaeda maritima]
Length=494

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS  L+F   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTSPTLSFPPHSLDVIFSN  129

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  130  WLLMYLSDEEVEDL  143



>gb|ABK42071.1| phosphoethanolamine N-methyltransferase [Suaeda liaotungensis]
Length=494

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS  L+F   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTSPTLSFPPHSLDVIFSN  129

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  130  WLLMYLSDEEVEDL  143



>ref|XP_002441466.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
 gb|EES19896.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
Length=510

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            ER+VQKSYW EHS +LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVLELGAGIGRF
Sbjct  28   ERKVQKSYWEEHSKDLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVLELGAGIGRF  87

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            TG+LA++AG V+A+DFIESVIKKN++INGH  NI F CADVTS +L   D S+DLIFSNW
Sbjct  88   TGDLAKEAGHVLALDFIESVIKKNQSINGHHKNITFKCADVTSPELKIEDNSVDLIFSNW  147

Query  533  LLMYLSDQEVESL  571
            LLMYLSD+EVE L
Sbjct  148  LLMYLSDEEVEKL  160



>ref|NP_001169597.1| uncharacterized LOC100383478 [Zea mays]
 gb|ABF83429.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
 gb|ACN34220.1| unknown [Zea mays]
 gb|AFW78993.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
Length=501

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  149  AMAAFQGE-EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  325
            A+A   GE ER+VQKSYW EHS  LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVL
Sbjct  10   AVANGIGEVERKVQKSYWEEHSKCLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVL  69

Query  326  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  505
            ELGAGIGRFTG+LA++AG V+A+DFIESVIKKN++INGH  NI F CADVTS DL   D 
Sbjct  70   ELGAGIGRFTGDLAKEAGHVLALDFIESVIKKNQSINGHHKNITFRCADVTSNDLKIEDN  129

Query  506  SIDLIFSNWLLMYLSDQEVESL  571
            S+DLIFSNWLLMYLSD+EV+ L
Sbjct  130  SVDLIFSNWLLMYLSDEEVQKL  151



>ref|XP_004512745.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Cicer arietinum]
Length=496

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +EREVQ++YW EH + L+VE+MMLDS A+ LDKEERPEVLS+LPAYEGKS+LELGAGIGR
Sbjct  12   DEREVQRNYWREHCANLSVESMMLDSNASHLDKEERPEVLSLLPAYEGKSILELGAGIGR  71

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FT ELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +L+ S+ S+DLIFSN
Sbjct  72   FTSELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPNLHISEGSVDLIFSN  131

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE+L
Sbjct  132  WLLMYLSDEEVENL  145



>ref|XP_008799222.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X3 [Phoenix dactylifera]
Length=482

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +2

Query  182  VQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGE  361
            VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSVLELGAGIGRFTGE
Sbjct  2    VQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSVLELGAGIGRFTGE  61

Query  362  LAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLM  541
            LA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS DL    ES+DLIFSNWLLM
Sbjct  62   LAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPDLMIEAESVDLIFSNWLLM  121

Query  542  YLSDQEVESL  571
            YLSD EVE L
Sbjct  122  YLSDNEVEGL  131



>dbj|BAG50404.1| methyltransferase [Cardamine sp. SIM-2007]
Length=148

 Score =   206 bits (525),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  206  HSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQV  385
            HS++LTVEAMMLDS+A+DLDKEERP VLS+LP+YEGKSVLELGAGIGRFT ELAQKAG++
Sbjct  1    HSADLTVEAMMLDSRASDLDKEERPGVLSLLPSYEGKSVLELGAGIGRFTSELAQKAGEL  60

Query  386  IAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVE  565
            IA+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  +D S+DLIFSNWLLMYLSD+EVE
Sbjct  61   IALDFIDSVIKKNESINGHYKNVKFMCADVTSPDLKITDGSLDLIFSNWLLMYLSDKEVE  120

Query  566  SL  571
             L
Sbjct  121  LL  122



>ref|XP_004241642.1| PREDICTED: phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=494

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  146  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  325
            +A+A   GEERE+QKSYW+E +SEL +EAMM DS A+DLDKE+RPEVLS+LP+YEGKSVL
Sbjct  2    AAIAPEVGEEREIQKSYWMEQTSELNLEAMMRDSAASDLDKEDRPEVLSLLPSYEGKSVL  61

Query  326  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  505
            ELGAGIGRFTG+LA+KAG+++A+DFIE V KKNE+INGH  N+KF+CADVTS DL    E
Sbjct  62   ELGAGIGRFTGDLAEKAGELVAVDFIEEVTKKNESINGHHKNVKFVCADVTSPDLTVLPE  121

Query  506  SIDLIFSNWLLMYLSDQEVESL  571
            S+DLIFSNWLLMYLS++EV+ L
Sbjct  122  SVDLIFSNWLLMYLSNEEVQDL  143



>ref|XP_004969637.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER+ Q+SYW EHS +LTVEAMMLDS+AA+LDKE+RPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  16   EERKAQRSYWEEHSRDLTVEAMMLDSRAAELDKEDRPEVLSLLPSYEGKSVLELGAGIGR  75

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+ AG V A+DFIESVIKKNE+ NGH  N  FMCADVTS DL   + S+DLIFSN
Sbjct  76   FTGELAKTAGHVFALDFIESVIKKNESTNGHYKNTSFMCADVTSPDLIIEENSVDLIFSN  135

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+E++ L
Sbjct  136  WLLMYLSDEEIDKL  149



>gb|ABG57185.1| phosphoethanolamine N-methyltransferase [Salicornia europaea]
Length=494

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER V K YW+EH+++LTVE+MMLDS+A+DLDKEERPE+LS+LP  EGK VLELGAGIGR
Sbjct  10   EERNVFKKYWVEHTTDLTVESMMLDSQASDLDKEERPEILSLLPNLEGKCVLELGAGIGR  69

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+KAGQVIA+DFI+  IKKNE I+GH  N+KFMCADVTS  LNF   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIDKAIKKNEYIDGHYKNVKFMCADVTSPTLNFPPNSLDVIFSN  129

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EVE L
Sbjct  130  WLLMYLSDEEVEHL  143



>ref|XP_003619836.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AES76054.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=497

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  149  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  328
            AM     +EREVQ+SYW EH   L+VE+MMLDS A+ LDKEERPEVLS+LP+YEGKSVLE
Sbjct  6    AMKQGGEDEREVQRSYWKEHCVNLSVESMMLDSNASHLDKEERPEVLSLLPSYEGKSVLE  65

Query  329  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  508
            LGAGIGRFT ELAQKAGQ++A+DFIES IKKNE  NGH  N+KFMCADVTS +L+ S+ S
Sbjct  66   LGAGIGRFTAELAQKAGQLLAVDFIESAIKKNENTNGHHKNVKFMCADVTSPNLHISEGS  125

Query  509  IDLIFSNWLLMYLSDQEVESL  571
            +DLIFSNWLLMYLSD+EV++L
Sbjct  126  VDLIFSNWLLMYLSDEEVKNL  146



>ref|NP_175293.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 gb|AAL16223.1|AF428454_1 At1g48600/T1N15_20 [Arabidopsis thaliana]
 gb|AAL36222.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AAM91745.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AEE32324.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=475

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  200  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  379
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFTGELAQKAG  60

Query  380  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  559
            +VIA+DFIES I+KNE++NGH  NIKFMCADVTS DL   D SIDLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSIDLIFSNWLLMYLSDKE  120

Query  560  VE  565
            VE
Sbjct  121  VE  122



>ref|XP_002317875.2| Phosphoethanolamine N-methyltransferase 1 family protein, partial 
[Populus trichocarpa]
 gb|EEE96095.2| Phosphoethanolamine N-methyltransferase 1 family protein, partial 
[Populus trichocarpa]
Length=129

 Score =   203 bits (517),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  200  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  379
            +++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGRFTGELAQKA 
Sbjct  1    MDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGRFTGELAQKAS  60

Query  380  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  559
            QV+A+DFIES IKKNE INGH  N+KFMCADV S DLNFS+ S+DLIFSNWLLMYLSD+E
Sbjct  61   QVVALDFIESAIKKNENINGHYKNVKFMCADVKSPDLNFSEGSVDLIFSNWLLMYLSDKE  120

Query  560  VESL  571
            V  L
Sbjct  121  VNRL  124



>emb|CDX93681.1| BnaA06g03670D [Brassica napus]
Length=473

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +2

Query  200  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  379
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLELGAGIGRFTGELAQKAG  60

Query  380  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  559
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS DL   D S+DLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPDLKIEDGSVDLIFSNWLLMYLSDKE  120

Query  560  VESL  571
            VE L
Sbjct  121  VELL  124



>emb|CDY40594.1| BnaC06g02100D [Brassica napus]
Length=473

 Score =   213 bits (542),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +2

Query  200  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  379
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLELGAGIGRFTGELAQKAG  60

Query  380  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  559
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS DL   D S+DLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPDLKIEDGSVDLIFSNWLLMYLSDKE  120

Query  560  VESL  571
            VE L
Sbjct  121  VELL  124



>ref|XP_006393387.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
 gb|ESQ30673.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
Length=475

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  200  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  379
            +E+SS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK+VLELGAGIGRFTGELAQKAG
Sbjct  1    MENSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKTVLELGAGIGRFTGELAQKAG  60

Query  380  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  559
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS+DL  +D SIDLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSQDLKITDGSIDLIFSNWLLMYLSDKE  120

Query  560  VESL  571
            VE L
Sbjct  121  VELL  124



>ref|XP_003525185.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
Length=488

 Score =   210 bits (535),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 122/136 (90%), Gaps = 2/136 (1%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ER +QKSYW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP +EGKSV+ELGAGIGR
Sbjct  2    DERHIQKSYWLQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPFEGKSVIELGAGIGR  61

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIF  523
            FTGELA KAGQ++A+DFI++ IKKNETINGH  ++KF+CADVTS ++  N S+ S+D++F
Sbjct  62   FTGELALKAGQLLAVDFIDTAIKKNETINGHHNHVKFLCADVTSPNMSNNVSEGSVDVVF  121

Query  524  SNWLLMYLSDQEVESL  571
            SNWLLMYLSD EVE L
Sbjct  122  SNWLLMYLSDIEVEKL  137



>ref|XP_010461685.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
 ref|XP_010461686.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=234

 Score =   203 bits (516),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = +2

Query  200  IEHSSELTVEAMMLDSKAADLDKEERPE-VLSMLPAYEGKSVLELGAGIGRFTGELAQKA  376
            +EHSS+LTVEAMMLDSKA+DLDKEERPE VLS++P YEGKSVLELGAGIGRFT ELAQKA
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEEVLSLVPPYEGKSVLELGAGIGRFTVELAQKA  60

Query  377  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQ  556
            G+VIA+DFIES I+KNE+INGH   +KFMCADVTS DL  +D SIDLIFSNWLLMYLSD+
Sbjct  61   GEVIAVDFIESDIQKNESINGHYKKVKFMCADVTSPDLKIADGSIDLIFSNWLLMYLSDK  120

Query  557  EVE  565
            EVE
Sbjct  121  EVE  123



>ref|XP_007160542.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32536.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=496

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 121/135 (90%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            ER++QK YW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP  EGKSV+ELGAGIGRF
Sbjct  11   ERDMQKLYWVQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPCEGKSVIELGAGIGRF  70

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIFS  526
            TGELAQKAGQ++A+DFIES IKKNE+INGH  N+KF+CADVTS ++  + S+ S+D+IFS
Sbjct  71   TGELAQKAGQLLAVDFIESAIKKNESINGHHKNVKFLCADVTSPNMSSSVSEGSVDVIFS  130

Query  527  NWLLMYLSDQEVESL  571
            NWLLMYLSD EVE L
Sbjct  131  NWLLMYLSDNEVEKL  145



>ref|XP_007160543.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32537.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=517

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 121/135 (90%), Gaps = 2/135 (1%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            ER++QK YW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP  EGKSV+ELGAGIGRF
Sbjct  11   ERDMQKLYWVQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPCEGKSVIELGAGIGRF  70

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIFS  526
            TGELAQKAGQ++A+DFIES IKKNE+INGH  N+KF+CADVTS ++  + S+ S+D+IFS
Sbjct  71   TGELAQKAGQLLAVDFIESAIKKNESINGHHKNVKFLCADVTSPNMSSSVSEGSVDVIFS  130

Query  527  NWLLMYLSDQEVESL  571
            NWLLMYLSD EVE L
Sbjct  131  NWLLMYLSDNEVEKL  145



>ref|XP_002456193.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
 gb|EES01313.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
Length=499

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
             ER+ Q+SYW EHS ELT+EAMMLDS+AA+LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  16   HERKAQRSYWEEHSGELTLEAMMLDSRAAELDKEERPEVLSLLPSYEGKSVLELGAGIGR  75

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+ +G V A+DFIES IKKNE+ NGH  N  FMCADVTS +L     SIDLIFSN
Sbjct  76   FTGELAKTSGHVFAVDFIESAIKKNESTNGHYDNTSFMCADVTSPNLMIEANSIDLIFSN  135

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+E++ L
Sbjct  136  WLLMYLSDEEIDKL  149



>ref|XP_008675146.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Zea mays]
Length=483

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +2

Query  140  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  319
            V  ++      ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS
Sbjct  8    VNGSLDRLDVHERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKS  67

Query  320  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  499
            +LELGAGIGRFTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL   
Sbjct  68   ILELGAGIGRFTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTDLMIE  127

Query  500  DESIDLIFSNWLLMYLSDQEVESL  571
              SIDLIFSNWLLMYLSD+E++ L
Sbjct  128  ANSIDLIFSNWLLMYLSDEEIDKL  151



>gb|AFZ78648.1| methyl transferase [Populus tomentosa]
Length=485

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  200  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  379
            ++++S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGRFTGELAQKAG
Sbjct  1    MDNTSDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGRFTGELAQKAG  60

Query  380  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  559
            QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ S+DLIFSNWLLMYLSD+E
Sbjct  61   QVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEGSVDLIFSNWLLMYLSDKE  120

Query  560  VESL  571
            VE+L
Sbjct  121  VENL  124



>ref|XP_008675144.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Zea mays]
 ref|XP_008675145.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Zea mays]
Length=501

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +2

Query  140  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  319
            V  ++      ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS
Sbjct  8    VNGSLDRLDVHERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKS  67

Query  320  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  499
            +LELGAGIGRFTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL   
Sbjct  68   ILELGAGIGRFTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTDLMIE  127

Query  500  DESIDLIFSNWLLMYLSDQEVESL  571
              SIDLIFSNWLLMYLSD+E++ L
Sbjct  128  ANSIDLIFSNWLLMYLSDEEIDKL  151



>tpg|DAA57997.1| TPA: putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=498

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
             ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS+LELGAGIGR
Sbjct  15   HERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKSILELGAGIGR  74

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL     SIDLIFSN
Sbjct  75   FTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTDLMIEANSIDLIFSN  134

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+E++ L
Sbjct  135  WLLMYLSDEEIDKL  148



>gb|AAV67950.1| putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=495

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
             ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS+LELGAGIGR
Sbjct  12   HERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKSILELGAGIGR  71

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL     SIDLIFSN
Sbjct  72   FTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSPDLMIEANSIDLIFSN  131

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+E++ L
Sbjct  132  WLLMYLSDEEIDKL  145



>gb|AAL40895.1| phosphoethanolamine methyltransferase [Triticum aestivum]
Length=498

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 118/134 (88%), Gaps = 1/134 (1%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            ER+VQKSYW EHS +LTVE+MMLDS+A DLDKEERPEVL++LP+Y GK+VLELGAGIGRF
Sbjct  15   ERKVQKSYWEEHSKDLTVESMMLDSRAKDLDKEERPEVLAILPSYAGKTVLELGAGIGRF  74

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHL-GNIKFMCADVTSKDLNFSDESIDLIFSN  529
            TGELA++AG VIA+DFI+SVIKKNE ING +  NI FMCADVTS +L   D S+D++FSN
Sbjct  75   TGELAKEAGHVIALDFIDSVIKKNEEINGDIYKNITFMCADVTSPELKIEDNSVDIVFSN  134

Query  530  WLLMYLSDQEVESL  571
            WLLMYL+D+EVE L
Sbjct  135  WLLMYLNDEEVEKL  148



>ref|XP_010500398.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=474

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +2

Query  200  IEHSSELTVEAMMLDSKAADLDKEERPE-VLSMLPAYEGKSVLELGAGIGRFTGELAQKA  376
            +EHSS+LTVEAMMLDSKA+DLDKEERPE VLS++P YEGKSVLELGAGIGRFTGELAQKA
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEEVLSLIPPYEGKSVLELGAGIGRFTGELAQKA  60

Query  377  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQ  556
            G+VIA+DFIES I+KNE++NG   N+KF+CADVTS DL  +D SIDLIFSNWLLMYLSD+
Sbjct  61   GEVIALDFIESAIQKNESVNGQYKNVKFICADVTSPDLKIADGSIDLIFSNWLLMYLSDK  120

Query  557  EVE  565
            EVE
Sbjct  121  EVE  123



>ref|XP_010921205.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921212.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921222.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921230.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921238.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
Length=480

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  200  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  379
            +EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGRFTGELA++AG
Sbjct  1    MEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGRFTGELAKEAG  60

Query  380  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  559
             V+A+DFIE VIKKNE++NGH  NI FMCADVTS DL    ES+DLIFSNWLLMYLSD E
Sbjct  61   HVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPDLMIEAESVDLIFSNWLLMYLSDNE  120

Query  560  VESL  571
            VE L
Sbjct  121  VEKL  124



>gb|KJB53041.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=448

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  125

Query  533  LLMYLSDQEVESL  571
            LLMYLS++EVE+L
Sbjct  126  LLMYLSNEEVENL  138



>gb|KJB53038.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=480

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  125

Query  533  LLMYLSDQEVESL  571
            LLMYLS++EVE+L
Sbjct  126  LLMYLSNEEVENL  138



>gb|KJB53039.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=488

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  5    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  64

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  65   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  124

Query  533  LLMYLSDQEVESL  571
            LLMYLS++EVE+L
Sbjct  125  LLMYLSNEEVENL  137



>gb|KJB53040.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=489

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  125

Query  533  LLMYLSDQEVESL  571
            LLMYLS++EVE+L
Sbjct  126  LLMYLSNEEVENL  138



>ref|XP_001763293.1| predicted protein [Physcomitrella patens]
 gb|EDQ71823.1| predicted protein [Physcomitrella patens]
Length=491

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            ER +Q +YW EHS E +VEAMMLDS+A+ LDKEERPE+LS+LP YE K V+ELGAGIGRF
Sbjct  6    ERSLQSTYWKEHSVEPSVEAMMLDSQASKLDKEERPEILSLLPPYENKDVMELGAGIGRF  65

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            TGELA+ AG V+AMDF+E++IKKNE +NGH  NI F CADVTS DLN +  S DL+FSNW
Sbjct  66   TGELAKHAGHVLAMDFMENLIKKNEDVNGHYNNIDFKCADVTSPDLNIAAGSADLVFSNW  125

Query  533  LLMYLSDQEVESL  571
            LLMYLSD+EV+ L
Sbjct  126  LLMYLSDEEVKGL  138



>emb|CDX92181.1| BnaA05g22260D [Brassica napus]
Length=464

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  233  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  412
            MMLDS+AADLDKEERPEVLS+LP YEGKSVLELGAGIGRFTGELAQKAG++IA+DFI+SV
Sbjct  1    MMLDSRAADLDKEERPEVLSLLPPYEGKSVLELGAGIGRFTGELAQKAGELIALDFIDSV  60

Query  413  IKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESL  571
            IKKN+++NGH  N+KFMCADVTS DLN +D SIDLIFSNWLLMYLSD+EVE L
Sbjct  61   IKKNKSVNGHYKNVKFMCADVTSPDLNITDGSIDLIFSNWLLMYLSDKEVELL  113



>ref|XP_002284594.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Vitis vinifera]
Length=490

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  167  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  346
            GEER+VQKSYW+EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIG
Sbjct  5    GEERDVQKSYWMEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIG  64

Query  347  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  526
            RFTGELA++AGQV+A+DFIESVI++NE ING   N KF+CADVTS DL+ S  S+DLIFS
Sbjct  65   RFTGELAKQAGQVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPDLDISPGSVDLIFS  124

Query  527  NWLLMYLSDQEVESL  571
            NWLLMYLSD+EVE L
Sbjct  125  NWLLMYLSDKEVEDL  139



>ref|XP_002454522.1| hypothetical protein SORBIDRAFT_04g032625 [Sorghum bicolor]
 gb|EES07498.1| hypothetical protein SORBIDRAFT_04g032625 [Sorghum bicolor]
Length=136

 Score =   187 bits (476),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +2

Query  218  LTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMD  397
            LTVEAMMLDS+AADL++EERPEVLS+LP+YEGKSVLELGAGIG FTGELA+ AG V+A+D
Sbjct  19   LTVEAMMLDSRAADLNREERPEVLSLLPSYEGKSVLELGAGIGHFTGELAKIAGNVLALD  78

Query  398  FIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEV  562
            FIES IKKNE+INGH  N  FMCA VTS+DL     SIDLIFSNWLLMYLSD+EV
Sbjct  79   FIESAIKKNESINGHYNNASFMCAYVTSEDLVLPASSIDLIFSNWLLMYLSDEEV  133



>gb|KJB30120.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=465

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  233  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  412
            MMLDSKAAD+DKEERPEVLS+LP YEGK++LELGAGIGRFTG+LA+KAG VIA+DFIE+V
Sbjct  1    MMLDSKAADIDKEERPEVLSLLPPYEGKTILELGAGIGRFTGDLAKKAGHVIALDFIENV  60

Query  413  IKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESL  571
            IKKNETINGH  N+KF+CADVTS DL F++ S+DLIFSNWLLMYLSD+EVE+L
Sbjct  61   IKKNETINGHYKNVKFLCADVTSPDLAFTEGSLDLIFSNWLLMYLSDKEVENL  113



>ref|XP_010655650.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Vitis vinifera]
Length=494

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  167  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  346
            GEER+VQKSYW+EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIG
Sbjct  5    GEERDVQKSYWMEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIG  64

Query  347  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  526
            RFTGELA++AGQV+A+DFIESVI++NE ING   N KF+CADVTS DL+ S  S+DLIFS
Sbjct  65   RFTGELAKQAGQVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPDLDISPGSVDLIFS  124

Query  527  NWLLMYLSDQEVESL  571
            NWLLMYLSD+EV ++
Sbjct  125  NWLLMYLSDKEVVTM  139



>gb|EEC79642.1| hypothetical protein OsI_20868 [Oryza sativa Indica Group]
Length=504

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 111/142 (78%), Gaps = 9/142 (6%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERP---------EVLSMLPAYEGKSVL  325
            ER+ Q+SYW EHS +LTVEAMMLDS+     +   P         +VLS+LP+Y+GKSVL
Sbjct  13   ERKAQRSYWEEHSKDLTVEAMMLDSRPRRPRQGGAPRGLIGTVDAQVLSVLPSYKGKSVL  72

Query  326  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  505
            ELGAGIGRFTGELA++AG V+A+DFIESVIKKNE INGH  NI FMCADVTS DL   D 
Sbjct  73   ELGAGIGRFTGELAKEAGHVLALDFIESVIKKNENINGHHKNITFMCADVTSPDLTIEDN  132

Query  506  SIDLIFSNWLLMYLSDQEVESL  571
            SIDLIFSNWLLMYLSD+EVE L
Sbjct  133  SIDLIFSNWLLMYLSDEEVEKL  154



>ref|XP_006306318.1| hypothetical protein CARUB_v10012188mg, partial [Capsella rubella]
 gb|EOA39216.1| hypothetical protein CARUB_v10012188mg, partial [Capsella rubella]
Length=354

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 111/125 (89%), Gaps = 3/125 (2%)
 Frame = +2

Query  200  IEHSSELTVEAMMLDS-KAADLDKEE--RPEVLSMLPAYEGKSVLELGAGIGRFTGELAQ  370
            +EHSS+LT EAMMLDS +A+DLD+EE  RPEVLS++P YEGKSVLELGAGI RF GE+AQ
Sbjct  1    MEHSSDLTAEAMMLDSTEASDLDEEEERRPEVLSLIPPYEGKSVLELGAGIDRFIGEVAQ  60

Query  371  KAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLS  550
            KAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +D S++LIFSNWLLMYLS
Sbjct  61   KAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIADGSVELIFSNWLLMYLS  120

Query  551  DQEVE  565
            D+EVE
Sbjct  121  DKEVE  125



>emb|CDX95799.1| BnaC05g35500D [Brassica napus]
Length=481

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 106/130 (82%), Gaps = 17/130 (13%)
 Frame = +2

Query  233  MMLDSKAADLDKEERPE-----------------VLSMLPAYEGKSVLELGAGIGRFTGE  361
            MMLDS+AADLDKEERPE                 VLS+LP YEGKSVLELGAGIGRFTGE
Sbjct  1    MMLDSRAADLDKEERPEEMFSLSLSLLRFRESDGVLSLLPPYEGKSVLELGAGIGRFTGE  60

Query  362  LAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLM  541
            LAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DLN +D SIDLIFSNWLLM
Sbjct  61   LAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLNITDGSIDLIFSNWLLM  120

Query  542  YLSDQEVESL  571
            YLSD+EVE L
Sbjct  121  YLSDKEVELL  130



>gb|ABK24808.1| unknown [Picea sitchensis]
Length=472

 Score =   189 bits (480),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            ER +Q +YW EHS  L++EAMMLDS+A+ LD+EERPE++S+LP  EGKSV+ELGAGIGR+
Sbjct  6    ERALQLNYWKEHSVVLSLEAMMLDSQASKLDQEERPEIISLLPPLEGKSVIELGAGIGRY  65

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            T ELAQKA  ++AMDFIES IKKNE  NGH  N++FMCADVTS DL     S DL+FSNW
Sbjct  66   TVELAQKADHILAMDFIESAIKKNEETNGHFKNVEFMCADVTSADLKIEPGSADLVFSNW  125

Query  533  LLMYLSDQEVESL  571
            LLMYLSD+EV  L
Sbjct  126  LLMYLSDEEVVEL  138



>ref|XP_001768934.1| predicted protein [Physcomitrella patens]
 gb|EDQ66288.1| predicted protein [Physcomitrella patens]
Length=431

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            ER +Q +YW EHS   +VE MMLDS+A  LD EERPE+LS+LP Y+GK V+ELGAGIGRF
Sbjct  17   ERTLQSNYWKEHSVNPSVETMMLDSQAPKLDLEERPEILSLLPPYKGKDVIELGAGIGRF  76

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            TG+LA+ AG V+AMDF+E++IKKNE ++GH+ NI F CADVTS  L+ S  S DL+FSNW
Sbjct  77   TGDLAKSAGHVLAMDFMENLIKKNEDVHGHMNNIDFKCADVTSPQLDISSASADLVFSNW  136

Query  533  LLMYLSDQEVESL  571
            LLM LSD+EVE L
Sbjct  137  LLMSLSDEEVEGL  149



>ref|XP_002969650.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
 gb|EFJ29738.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
Length=495

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            ER+ Q SYW EHS+ LTVE M+LDS+AA LD+EERPE+LSMLP  EG SV+ELGAGIGRF
Sbjct  9    ERDAQLSYWKEHSTALTVEEMLLDSQAAKLDQEERPEILSMLPPLEGISVVELGAGIGRF  68

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            TG+LA+ A  V+AMDF++SVI KN+ +NG   N++F+CADVTS  L F   S DLIFSNW
Sbjct  69   TGDLAKSAKHVVAMDFVQSVIDKNKEVNGCHKNVEFLCADVTSPSLTFPRSSKDLIFSNW  128

Query  533  LLMYLSDQEVESL  571
            LLMYLSD EV +L
Sbjct  129  LLMYLSDDEVTAL  141



>ref|XP_002970912.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
 gb|EFJ28238.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
Length=495

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            ER+ Q SYW EHS+ LTVE M+LDS+AA LD+EERPE+LSMLP  EG SV+ELGAGIGRF
Sbjct  9    ERDAQLSYWKEHSTALTVEEMLLDSQAAKLDQEERPEILSMLPPLEGISVVELGAGIGRF  68

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            TG+LA+ A  V+AMDF++SVI KN+ +NG   N++F+CADVTS  L F   S DLIFSNW
Sbjct  69   TGDLAKSAKHVVAMDFVQSVIDKNKEVNGCHRNVEFLCADVTSPSLTFPRSSKDLIFSNW  128

Query  533  LLMYLSDQEVESL  571
            LLMYLSD EV +L
Sbjct  129  LLMYLSDDEVTAL  141



>ref|XP_006303561.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
 gb|EOA36459.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
Length=475

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 106/123 (86%), Gaps = 5/123 (4%)
 Frame = +2

Query  200  IEHSSELTVEAMMLDSKAADLDKEERP-EVLSMLPAYEGKSVLELGAGIGRFTGELAQKA  376
            +EHSS++ V++    ++A+DLDKEE P E+L ++P YEGK+VLELGAGIGRFTGELAQKA
Sbjct  1    MEHSSDVMVDS----TEASDLDKEELPHELLCLIPPYEGKTVLELGAGIGRFTGELAQKA  56

Query  377  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQ  556
            G+VIA+DFIES I KNE++NGH  N+KFMCADVTS DL  +D SIDLIFSNWLLMYLSD+
Sbjct  57   GEVIALDFIESAIHKNESVNGHYKNVKFMCADVTSPDLKIADGSIDLIFSNWLLMYLSDK  116

Query  557  EVE  565
            EVE
Sbjct  117  EVE  119



>gb|KHN10536.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=466

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 102/115 (89%), Gaps = 2/115 (2%)
 Frame = +2

Query  233  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  412
            MMLDSKAA LDKEERPEVLS+LP +EGKSV+ELGAGIGRFTGELA KAGQ++A+DFI++ 
Sbjct  1    MMLDSKAAHLDKEERPEVLSLLPPFEGKSVIELGAGIGRFTGELALKAGQLLAVDFIDTA  60

Query  413  IKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIFSNWLLMYLSDQEVESL  571
            IKKNETINGH  ++KF+CADVTS ++  N S+ S+D++FSNWLLMYLSD EVE L
Sbjct  61   IKKNETINGHHNHVKFLCADVTSPNMSNNVSEGSVDVVFSNWLLMYLSDIEVEKL  115



>emb|CBI26879.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  200  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  379
            +EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIGRFTGELA++AG
Sbjct  1    MEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIGRFTGELAKQAG  60

Query  380  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  559
            QV+A+DFIESVI++NE ING   N KF+CADVTS DL+ S  S+DLIFSNWLLMYLSD+E
Sbjct  61   QVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPDLDISPGSVDLIFSNWLLMYLSDKE  120

Query  560  VESL  571
            VE L
Sbjct  121  VEDL  124



>gb|AGO59019.1| heat responsive transcription factor protein, partial [Triticum 
aestivum]
Length=460

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = +2

Query  233  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  412
            MMLDS+A DLDKEERPEVL++LP+Y GK+VLELGAGIGRFTGELA++AG VIA+DFI+SV
Sbjct  1    MMLDSRAKDLDKEERPEVLAILPSYAGKTVLELGAGIGRFTGELAKEAGHVIALDFIDSV  60

Query  413  IKKNETINGHL-GNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESL  571
            IKKNE ING +  NI FMCADVTS +L   D SID++FSNWLLMYL+D+EVE L
Sbjct  61   IKKNEEINGDIYKNITFMCADVTSPELKIEDNSIDIVFSNWLLMYLNDEEVEKL  114



>ref|XP_010540184.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Tarenaya hassleriana]
Length=457

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +2

Query  272  ERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGN  451
            ERPE+LS+LP +EGKSVLE GAGIGRFTGE AQ+A QVIA+DFIESVIKKNE INGH  N
Sbjct  6    ERPEILSVLPPFEGKSVLEFGAGIGRFTGEFAQRASQVIAVDFIESVIKKNEDINGHHKN  65

Query  452  IKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESL  571
            +KFMCADVTS DL FSDES+DLIFSNWLLMYLSD+EVE L
Sbjct  66   VKFMCADVTSPDLKFSDESVDLIFSNWLLMYLSDKEVEGL  105



>gb|KDD75565.1| hypothetical protein H632_c615p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=278

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = +2

Query  173  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  352
            ER VQK YWIEHS+  TVE MMLDSKAAD+DK ERPEVL +L + EGK V+ELGAGIGRF
Sbjct  10   ERAVQKQYWIEHSANATVETMMLDSKAADIDKMERPEVLELLGSVEGKDVVELGAGIGRF  69

Query  353  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  532
            T  LA  A  V+A+DF+E++I++N   N H GNI F C D T  +L     S DL+FSNW
Sbjct  70   TAPLASTAKSVVALDFMENLIEENRRTNSHYGNIDFRCGDAT--ELELPASSQDLVFSNW  127

Query  533  LLMYLSDQEVESL  571
            LLMYL+D EV  L
Sbjct  128  LLMYLNDDEVRRL  140



>gb|KIZ00652.1| hypothetical protein MNEG_7307 [Monoraphidium neglectum]
Length=252

 Score =   166 bits (420),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = +2

Query  146  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  325
            +A A    +EREVQ +YW+EHS E TVEAMMLDSKA+++D+ ERPEVLS L + +GK VL
Sbjct  2    AAAAEVGVQEREVQLNYWLEHSKEPTVEAMMLDSKASEIDQMERPEVLSTLGSIKGKRVL  61

Query  326  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  505
            ELGAGIGRFTGE+A+ A  V+A DF+E  I +N   NGHL N+ F  ADVT   L     
Sbjct  62   ELGAGIGRFTGEIAKTASSVLACDFMEVSIDENRRRNGHLPNVDFRVADVTQ--LRCEPR  119

Query  506  SIDLIFSNWLLMYLSDQEVESL  571
              D++FSNWLLMYLSD+EV  L
Sbjct  120  QFDVVFSNWLLMYLSDEEVSQL  141



>gb|EPS69227.1| hypothetical protein M569_05544 [Genlisea aurea]
Length=333

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  218  LTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMD  397
            L++E MM D+KA+DLD+EERPEVLS++P Y+GKS+LELGAG+GRFT E A+ A Q++A++
Sbjct  69   LSIEDMMADTKASDLDREERPEVLSLVPPYDGKSILELGAGVGRFTAEFAKTAAQIVAVE  128

Query  398  FIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEV  562
             IES  +KNE  NGH  N KF+CADV S DL+F D S DLIFSNWLL+YLS+ EV
Sbjct  129  LIESAAEKNEITNGHHKNAKFICADVRSPDLSFPDGSFDLIFSNWLLLYLSENEV  183



>ref|XP_011399976.1| Phosphoethanolamine N-methyltransferase [Auxenochlorella protothecoides]
 gb|KFM27020.1| Phosphoethanolamine N-methyltransferase [Auxenochlorella protothecoides]
Length=503

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 100/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ERE QKSYW EHSS  TVE+MMLDS+AAD+DK ERPEVL +L + +G  V+ELGAGIGR
Sbjct  5    QEREAQKSYWAEHSSNATVESMMLDSQAADIDKLERPEVLKLLGSVDGLDVVELGAGIGR  64

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FT  LA++A  V+A+DF+ ++I++N   NGHLGNI F C D T  DL       DL+FSN
Sbjct  65   FTRPLAEEARSVVALDFMPNLIEQNRVDNGHLGNIDFRCGDATELDLPAG--CADLVFSN  122

Query  530  WLLMYLSDQEVESL  571
            WLLMYL+D EV  L
Sbjct  123  WLLMYLADDEVAKL  136



>ref|XP_002730517.1| PREDICTED: phosphoethanolamine N-methyltransferase-like, partial 
[Saccoglossus kowalevskii]
Length=160

 Score =   156 bits (394),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  167  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  346
             E R+V  SYW++HS + ++E MMLD++A  L + E PE+LS+LP YEGK ++ELGAGIG
Sbjct  4    NEVRQVMSSYWMDHSKDASLEEMMLDTQAESLAQSEHPEILSLLPPYEGKRIIELGAGIG  63

Query  347  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  526
            RFTG LA+KA  V A+DF+ES IKKN+  N H  N+ F  ADVT   L   ++S DL+FS
Sbjct  64   RFTGVLAKKASHVTAVDFMESFIKKNKDANSHHKNVDFKQADVTV--LKCPEKSFDLVFS  121

Query  527  NWLLMYLSDQEVESL  571
            NWL+MYL+++EV +L
Sbjct  122  NWLMMYLTNEEVLAL  136



>ref|XP_002594091.1| hypothetical protein BRAFLDRAFT_68467 [Branchiostoma floridae]
 gb|EEN50102.1| hypothetical protein BRAFLDRAFT_68467 [Branchiostoma floridae]
Length=242

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 98/132 (74%), Gaps = 2/132 (2%)
 Frame = +2

Query  176  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  355
            R+    +W EHSS+ ++E MMLD  A +L K+E PE+LS+LP  EGK++LELGAGIGR+T
Sbjct  10   RDKMSQFWREHSSQASIEEMMLDDAAKELSKDELPEILSLLPGIEGKTILELGAGIGRYT  69

Query  356  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  535
              LAQ+A  V A+DF+E  I+KNE +NGH  N++FM ADVT   L    +S D++FSNWL
Sbjct  70   APLAQQAKHVTAVDFMEPFIRKNEEVNGHHKNVRFMQADVTK--LEMPPKSFDIVFSNWL  127

Query  536  LMYLSDQEVESL  571
            +MYLSD EV++L
Sbjct  128  MMYLSDAEVQAL  139



>gb|EAY75471.1| hypothetical protein OsI_03371 [Oryza sativa Indica Group]
Length=456

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  251  AADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNET  430
             ADLD      +LS+LP YEGKSVLELGAGIGRFTGEL + AG V+AMDFIESVIKKNE+
Sbjct  8    TADLDIVASHRILSLLPPYEGKSVLELGAGIGRFTGELVKTAGHVLAMDFIESVIKKNES  67

Query  431  INGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESL  571
            INGH  N  FMCADVT  DL   D SIDLIFSNWLLMYLSD+EVE L
Sbjct  68   INGHHKNASFMCADVTCPDLMIEDNSIDLIFSNWLLMYLSDEEVEKL  114



>ref|XP_010231068.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Brachypodium distachyon]
Length=472

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 92/108 (85%), Gaps = 1/108 (1%)
 Frame = +2

Query  251  AADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNET  430
            AA+LD E    VLS+LP+YEGK+VLELGAGIGRFTGELA++AG V+A+DFI+SVIKKNE 
Sbjct  15   AAELDPESDQWVLSILPSYEGKTVLELGAGIGRFTGELAKEAGHVLALDFIDSVIKKNEE  74

Query  431  INGHL-GNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESL  571
            INGH+  NI FMCADVTS +L   D SIDL+FSNWLLMYLSD+EVE L
Sbjct  75   INGHIHNNITFMCADVTSPELKIEDNSIDLVFSNWLLMYLSDEEVEKL  122



>ref|XP_004166030.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase 
1-like [Cucumis sativus]
Length=468

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  224  VEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFI  403
            +E+MM+DS + +LD EE  EV+S+LP YEGK+V+ELGAGIGRFT ELAQ+A QVIA+DF+
Sbjct  1    MESMMVDSDSHELDSEETAEVISLLPPYEGKTVVELGAGIGRFTSELAQRAAQVIAVDFV  60

Query  404  ESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESL  571
            E VI+KNE+INGH  N+KF CADVT  +L+  ++S+D IFSN LLMYLSD+EV+ L
Sbjct  61   EDVIRKNESINGHHKNVKFQCADVTFSELDIHEDSVDFIFSNLLLMYLSDEEVKLL  116



>ref|XP_004137342.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 gb|KGN63873.1| hypothetical protein Csa_1G025050 [Cucumis sativus]
Length=468

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  224  VEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFI  403
            +E+MM+DS + +LD EE  EV+S+LP YEGK+V+ELGAGIGRFT ELAQ+A QVIA+DF+
Sbjct  1    MESMMVDSDSHELDSEETAEVISLLPPYEGKTVVELGAGIGRFTSELAQRAAQVIAVDFV  60

Query  404  ESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESL  571
            E VI+KNE+INGH  N+KF CADVT  +L+  ++S+D IFSN LLMYLSD+EV+ L
Sbjct  61   EDVIRKNESINGHHKNVKFQCADVTFSELDIHEDSVDFIFSNLLLMYLSDEEVKLL  116



>ref|XP_002594077.1| hypothetical protein BRAFLDRAFT_68483 [Branchiostoma floridae]
 gb|EEN50088.1| hypothetical protein BRAFLDRAFT_68483 [Branchiostoma floridae]
Length=274

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 97/126 (77%), Gaps = 2/126 (2%)
 Frame = +2

Query  194  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  373
            +W E S + +++ MMLD  A +LD+EERPE+L+MLP  +GK VLELGAGIGRFT  LA++
Sbjct  56   FWREQSHDGSLQEMMLDENADELDQEERPEILAMLPDLKGKRVLELGAGIGRFTPSLARQ  115

Query  374  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  553
            A  V A+DF+ES IKKNE  N HLGNI F+ ADVT  DL    ES+D++FSNWL+MYL+D
Sbjct  116  ADHVTAVDFMESFIKKNEEANRHLGNINFLQADVTRLDL--PQESVDVVFSNWLMMYLAD  173

Query  554  QEVESL  571
            +EV +L
Sbjct  174  EEVSAL  179



>ref|XP_002594089.1| hypothetical protein BRAFLDRAFT_118790 [Branchiostoma floridae]
 gb|EEN50100.1| hypothetical protein BRAFLDRAFT_118790 [Branchiostoma floridae]
Length=577

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 106/146 (73%), Gaps = 8/146 (5%)
 Frame = +2

Query  152  MAAFQGEEREVQKS------YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  313
            M++ QGE  E + +      +W EHSS+ ++E MMLD  A +L K+E PE+LS+LP  EG
Sbjct  1    MSSDQGESAEYEATRDKMSQFWREHSSKASLEEMMLDDNAKELSKDELPEILSLLPGIEG  60

Query  314  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLN  493
            K++LELGAGIGR+T  LAQ+A  V A+DF+ES I+KNE +NGH  N++FM ADVT   L 
Sbjct  61   KTILELGAGIGRYTAPLAQQAKHVTAVDFMESFIRKNEEVNGHHKNVRFMQADVTK--LE  118

Query  494  FSDESIDLIFSNWLLMYLSDQEVESL  571
               +S D++FSNWL+MYLSD EV++L
Sbjct  119  MPPKSFDIVFSNWLMMYLSDAEVQAL  144



>ref|XP_009011308.1| hypothetical protein HELRODRAFT_71964 [Helobdella robusta]
 gb|ESO11039.1| hypothetical protein HELRODRAFT_71964 [Helobdella robusta]
Length=215

 Score =   151 bits (382),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 96/128 (75%), Gaps = 2/128 (2%)
 Frame = +2

Query  188  KSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELA  367
            +++W EHS++   E MMLDS A  L +EE PE+LS+LP  EGKSVLELGAGIGRF+G +A
Sbjct  2    QNFWKEHSTKANEEEMMLDSDADTLGREEVPEILSLLPGLEGKSVLELGAGIGRFSGRIA  61

Query  368  QKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYL  547
             KA  V+A+DF+E+ IK NE+ NGH GNI+F+ ADV    L F + S DL+FSNWLLMYL
Sbjct  62   AKAKSVVAVDFMENFIKCNESTNGHHGNIQFVQADVML--LKFPENSFDLVFSNWLLMYL  119

Query  548  SDQEVESL  571
             + EV +L
Sbjct  120  EEDEVCTL  127



>ref|XP_005643867.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE19323.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=498

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            EER  QKSYW +HS+  +VEAMMLDS+A+ +DKEERPEVL+ML   EG  ++ELGAGIGR
Sbjct  16   EERAAQKSYWADHSATASVEAMMLDSQASVIDKEERPEVLTMLGCVEGARIVELGAGIGR  75

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FTGELA  A  V+A+DF+E++I +N   N H  N+++   D T  +L     S D++FSN
Sbjct  76   FTGELAVAARSVLAVDFMENLIAENRRANSHRRNVRWQVGDAT--ELELPAGSADVVFSN  133

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+EV  L
Sbjct  134  WLLMYLSDKEVAKL  147



>ref|XP_008324912.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Cynoglossus semilaevis]
Length=495

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 93/132 (70%), Gaps = 2/132 (2%)
 Frame = +2

Query  176  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  355
            R    ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T
Sbjct  5    RNNMAAFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYT  64

Query  356  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  535
             +L  KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT   L     S+D IFSNWL
Sbjct  65   SQLLTKAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVTK--LEIPKTSLDFIFSNWL  122

Query  536  LMYLSDQEVESL  571
            LMYLSD E++ L
Sbjct  123  LMYLSDDEIQPL  134



>ref|XP_005096334.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Aplysia californica]
Length=494

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            E R+V  +YW EHS + +VE MMLD+ A +L KEE PE+LS LP Y GK V+ELGAGIGR
Sbjct  4    EVRQVMAAYWKEHSKQGSVEEMMLDNTAEELSKEELPEILSYLPEYAGKDVIELGAGIGR  63

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FT E+A+KA  V A+DF+E  I KN+  N +  NI+++ ADVT   L+   ES DLIFSN
Sbjct  64   FTTEIAKKAKSVAAVDFMEEFINKNKKTNQNFNNIEYVVADVTK--LDRPKESADLIFSN  121

Query  530  WLLMYLSDQEVESL  571
            WLLMYL+D EV+  
Sbjct  122  WLLMYLNDNEVQEF  135



>ref|XP_008324913.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Cynoglossus semilaevis]
Length=491

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 93/132 (70%), Gaps = 2/132 (2%)
 Frame = +2

Query  176  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  355
            R    ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T
Sbjct  5    RNNMAAFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYT  64

Query  356  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  535
             +L  KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT   L     S+D IFSNWL
Sbjct  65   SQLLTKAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVTK--LEIPKTSLDFIFSNWL  122

Query  536  LMYLSDQEVESL  571
            LMYLSD E++ L
Sbjct  123  LMYLSDDEIQPL  134



>ref|XP_008324914.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324916.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324917.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
Length=488

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 92/127 (72%), Gaps = 2/127 (2%)
 Frame = +2

Query  191  SYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQ  370
            ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T +L  
Sbjct  3    AFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYTSQLLT  62

Query  371  KAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLS  550
            KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT   L     S+D IFSNWLLMYLS
Sbjct  63   KAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVTK--LEIPKTSLDFIFSNWLLMYLS  120

Query  551  DQEVESL  571
            D E++ L
Sbjct  121  DDEIQPL  127



>ref|XP_008418601.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Poecilia reticulata]
Length=491

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 90/126 (71%), Gaps = 2/126 (2%)
 Frame = +2

Query  194  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  373
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  10   FWKEHSKAATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  69

Query  374  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  553
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  70   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLDI--PQHSIDFIFSNWLLMYLSD  127

Query  554  QEVESL  571
            +E++S 
Sbjct  128  EELKSF  133



>ref|XP_008418600.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Poecilia reticulata]
Length=492

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 90/126 (71%), Gaps = 2/126 (2%)
 Frame = +2

Query  194  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  373
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  70

Query  374  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  553
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLDI--PQHSIDFIFSNWLLMYLSD  128

Query  554  QEVESL  571
            +E++S 
Sbjct  129  EELKSF  134



>ref|XP_007550439.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Poecilia 
formosa]
Length=492

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 90/126 (71%), Gaps = 2/126 (2%)
 Frame = +2

Query  194  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  373
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKGATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  70

Query  374  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  553
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLDI--PQHSIDFIFSNWLLMYLSD  128

Query  554  QEVESL  571
            +E++S 
Sbjct  129  EELKSF  134



>ref|XP_006003521.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Latimeria chalumnae]
Length=264

 Score =   144 bits (364),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 94/125 (75%), Gaps = 2/125 (2%)
 Frame = +2

Query  188  KSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELA  367
            K +W EHS E +VE MMLDS A  + +E+R E+++MLP  EGK VLELGAGIGRF+G+LA
Sbjct  2    KQFWEEHSKEASVEEMMLDSNAQAIAEEDRSEIIAMLPCVEGKDVLELGAGIGRFSGQLA  61

Query  368  QKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYL  547
            +KA +V A+DF+++ ++KN  +N   GN+ F+ ADVT+ DL     S DLIFSNWL MYL
Sbjct  62   KKARRVTAVDFMKTFMEKNREVNKVYGNVTFLQADVTNLDL--PPNSFDLIFSNWLFMYL  119

Query  548  SDQEV  562
            +D+E+
Sbjct  120  TDKEL  124



>ref|XP_005806845.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Xiphophorus 
maculatus]
Length=492

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 88/126 (70%), Gaps = 2/126 (2%)
 Frame = +2

Query  194  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  373
            +W EHS   TVE MMLDS+A  L + E PE+LSMLP  EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSQAKKLTEHELPEILSMLPPLEGRRVLELGAGIGRFTSHLLTK  70

Query  374  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  553
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLDI--PQHSIDFIFSNWLLMYLSD  128

Query  554  QEVESL  571
            +E++S 
Sbjct  129  EELKSF  134



>gb|AHY01341.1| phosphoethanolamine methyltransferase, partial [Carassius gibelio]
Length=172

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 90/126 (71%), Gaps = 2/126 (2%)
 Frame = +2

Query  194  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  373
            +W EHS   TVE MMLD+ A +L + E PE+LS+LP+     VLELGAGIGRFT  L  K
Sbjct  4    FWKEHSKFATVEEMMLDTNAQELTQHELPEILSLLPSLAASDVLELGAGIGRFTRHLIGK  63

Query  374  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  553
            A  V A+DF+E  ++KN+  N HLG+++F+ ADVT   L+F     D++FSNWLLMYLSD
Sbjct  64   ARHVTAVDFMEKFVEKNKKDNSHLGSVEFIQADVTK--LDFPKHGFDVVFSNWLLMYLSD  121

Query  554  QEVESL  571
            QE++SL
Sbjct  122  QELKSL  127



>ref|XP_005096335.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Aplysia californica]
 ref|XP_005096336.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Aplysia californica]
Length=486

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 92/127 (72%), Gaps = 2/127 (2%)
 Frame = +2

Query  191  SYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQ  370
            +YW EHS + +VE MMLD+ A +L KEE PE+LS LP Y GK V+ELGAGIGRFT E+A+
Sbjct  3    AYWKEHSKQGSVEEMMLDNTAEELSKEELPEILSYLPEYAGKDVIELGAGIGRFTTEIAK  62

Query  371  KAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLS  550
            KA  V A+DF+E  I KN+  N +  NI+++ ADVT   L+   ES DLIFSNWLLMYL+
Sbjct  63   KAKSVAAVDFMEEFINKNKKTNQNFNNIEYVVADVTK--LDRPKESADLIFSNWLLMYLN  120

Query  551  DQEVESL  571
            D EV+  
Sbjct  121  DNEVQEF  127



>ref|NP_001096276.2| phosphoethanolamine methyltransferase [Xenopus (Silurana) tropicalis]
Length=494

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            + R+V   +W EHS + TVE MMLDS A  L  EE+PE++ +LP  +G SVLELGAGIGR
Sbjct  4    DTRQVMTQFWEEHSRDATVEEMMLDSSAKLLSLEEKPEIILLLPCLDGHSVLELGAGIGR  63

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            +TG LA+ A  V A+DF+++ I+KN+  NG  GNI F+ ADVT+ DL   +ES D IFSN
Sbjct  64   YTGHLAKLASHVTAVDFMQNFIEKNQKDNGFRGNITFLQADVTNLDL--PNESFDFIFSN  121

Query  530  WLLMYLSDQEVESL  571
            WL MYL+D E+ +L
Sbjct  122  WLFMYLTDAELLAL  135



>ref|XP_008453688.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cucumis 
melo]
Length=184

 Score =   140 bits (354),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +2

Query  281  EVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKF  460
            +V+S+LP YEGK+V+ELGAG+GRFT ELAQ+A QVIA+DF+E VI+KNE+INGH  N+KF
Sbjct  12   KVISLLPPYEGKTVVELGAGVGRFTAELAQRAAQVIAVDFVEDVIRKNESINGHHKNVKF  71

Query  461  MCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESL  571
            + ADVTS +L+  ++S+D IFSN LLMYLSD+EV+ L
Sbjct  72   LWADVTSPELDIHEDSVDFIFSNLLLMYLSDEEVKLL  108



>ref|XP_010864863.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Esox 
lucius]
Length=495

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ER     +W EHS + TVE MMLDS A +L + E PE+LS+LP+   + +LELGAGIGR
Sbjct  4    KERSSMTEFWKEHSRQATVEEMMLDSHAKELTQHELPEILSLLPSLHDQRILELGAGIGR  63

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            FT  L  +A  V A+DF+ES +KKN+  NGH  N  F+ ADVT   L+F   S D+IFSN
Sbjct  64   FTSHLLAQASHVTAVDFMESFVKKNQQENGHHSNAAFIQADVTK--LDFPKNSYDIIFSN  121

Query  530  WLLMYLSDQEVESL  571
            WL+MYLSD+E+ SL
Sbjct  122  WLMMYLSDEELRSL  135



>ref|XP_005723169.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Pundamilia nyererei]
Length=485

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 89/126 (71%), Gaps = 2/126 (2%)
 Frame = +2

Query  194  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  373
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  4    FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  63

Query  374  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  553
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  64   AAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  121

Query  554  QEVESL  571
            +E+ S+
Sbjct  122  EELNSV  127



>ref|XP_005723168.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Pundamilia nyererei]
Length=491

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 89/126 (71%), Gaps = 2/126 (2%)
 Frame = +2

Query  194  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  373
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  10   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  69

Query  374  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  553
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  70   AAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTKLDV--PQNSIDFIFSNWLLMYLSD  127

Query  554  QEVESL  571
            +E+ S+
Sbjct  128  EELNSV  133



>ref|XP_005723167.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Pundamilia nyererei]
Length=492

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 89/126 (71%), Gaps = 2/126 (2%)
 Frame = +2

Query  194  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  373
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  70

Query  374  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  553
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  128

Query  554  QEVESL  571
            +E+ S+
Sbjct  129  EELNSV  134



>ref|XP_008278560.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
 ref|XP_008278561.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
Length=492

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 90/126 (71%), Gaps = 2/126 (2%)
 Frame = +2

Query  194  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  373
            +W EHSSE TVE MMLDS+A +L  +E PE+LSMLP+ +G  VLELGAGIGR+T  L  K
Sbjct  11   FWKEHSSEATVEKMMLDSQARELTTQELPEILSMLPSLDGCRVLELGAGIGRYTSHLLTK  70

Query  374  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  553
            AG V A+DF+ES +++N   NGH  N+  + ADVT  D      S D+IFSNWLLMYLSD
Sbjct  71   AGHVTAVDFMESFVERNRKENGHHSNVSIIQADVTKMDN--PQNSFDIIFSNWLLMYLSD  128

Query  554  QEVESL  571
             EV++ 
Sbjct  129  DEVKTF  134



>ref|XP_008278559.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Stegastes partitus]
Length=510

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = +2

Query  176  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  355
            R     +W EHSSE TVE MMLDS+A +L  +E PE+LSMLP+ +G  VLELGAGIGR+T
Sbjct  23   RSNMTEFWKEHSSEATVEKMMLDSQARELTTQELPEILSMLPSLDGCRVLELGAGIGRYT  82

Query  356  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  535
              L  KAG V A+DF+ES +++N   NGH  N+  + ADVT  D      S D+IFSNWL
Sbjct  83   SHLLTKAGHVTAVDFMESFVERNRKENGHHSNVSIIQADVTKMDN--PQNSFDIIFSNWL  140

Query  536  LMYLSDQEVESL  571
            LMYLSD EV++ 
Sbjct  141  LMYLSDDEVKTF  152



>gb|ETM43048.1| hypothetical protein L914_11412, partial [Phytophthora parasitica]
Length=244

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 88/132 (67%), Gaps = 2/132 (2%)
 Frame = +2

Query  176  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  355
            R++ K+YW  HSS  TVE MMLDS A  L + E PE+L   P+ E K VLEL AGIGR+T
Sbjct  5    RDLMKAYWEGHSSSATVETMMLDSHAKTLTELEVPEILDKAPSMEHKDVLELAAGIGRYT  64

Query  356  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  535
              +A KA  V A++FIE  IK NE  NGHLGNIKF+C DV    L     S D+IFSNW+
Sbjct  65   SVIATKAKSVTAVEFIEDFIKVNEDKNGHLGNIKFLCKDVVH--LEAEPNSFDVIFSNWI  122

Query  536  LMYLSDQEVESL  571
            LMY+ D+EV+  
Sbjct  123  LMYMEDEEVKEF  134



>gb|EWM27854.1| phosphoethanolamine n-methyltransferase [Nannochloropsis gaditana]
Length=597

 Score =   146 bits (369),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 73/152 (48%), Positives = 97/152 (64%), Gaps = 6/152 (4%)
 Frame = +2

Query  128  FTAIVQSAMAAFQ--GEEREVQKSYWIEHSSE--LTVEAMMLDSKAADLDKEERPEVLSM  295
            F ++    M +F    EER VQ+ YW EHS +   ++E MMLD  A+ LD  +RPE+LSM
Sbjct  58   FLSLFDINMTSFSLTEEERTVQREYWQEHSKKHGSSMENMMLDDSASKLDLMDRPEILSM  117

Query  296  LPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADV  475
            LP Y    +LEL +GIGRFTG LA KAG V+ ++F+E  + KN+ ++ H GN  F+CADV
Sbjct  118  LPTYSDIRILELASGIGRFTGSLASKAGSVVTVEFMEEFVAKNKELHNHFGNCDFLCADV  177

Query  476  TSKDLNFSDESIDLIFSNWLLMYLSDQEVESL  571
                L     S DL+FS W+ MYL+DQEV  L
Sbjct  178  LK--LTLPPASFDLVFSCWIQMYLNDQEVRVL  207



>ref|XP_006781399.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Neolamprologus 
brichardi]
Length=492

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 88/126 (70%), Gaps = 2/126 (2%)
 Frame = +2

Query  194  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  373
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP  EG  VLELGAGIGR+T  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPRLEGCKVLELGAGIGRYTKHLLTK  70

Query  374  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  553
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  128

Query  554  QEVESL  571
            +E+ S+
Sbjct  129  EELNSV  134



>ref|NP_001167350.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
 gb|ACN11445.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
Length=495

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 91/134 (68%), Gaps = 2/134 (1%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            +ER     +W EHS + TVE MMLDS A +L + E PE+LS+LP+  G+ VLELGAGIGR
Sbjct  4    KERSTMTEFWKEHSRQATVEEMMLDSHAQELTQHELPEILSLLPSLSGQRVLELGAGIGR  63

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            +T  L   A  V A+DF+ES ++KN   N H  N  F+ ADVT   L+F   S D+IFSN
Sbjct  64   YTSHLLTLASHVTAVDFMESFVEKNRQDNSHYSNASFLQADVTK--LDFPKNSFDIIFSN  121

Query  530  WLLMYLSDQEVESL  571
            WLLMYLSD+E+ SL
Sbjct  122  WLLMYLSDEELTSL  135



>ref|XP_008872791.1| hypothetical protein H310_08714 [Aphanomyces invadans]
 gb|ETV98594.1| hypothetical protein H310_08714 [Aphanomyces invadans]
Length=503

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 91/134 (68%), Gaps = 2/134 (1%)
 Frame = +2

Query  170  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  349
            E R   K+YW+EHSS+  VE MMLDS A  L + E PE+LS +P+Y+ K VLE+ AGIGR
Sbjct  19   ETRTSMKAYWVEHSSDSNVETMMLDSNAKILTELETPEILSKMPSYKDKDVLEMAAGIGR  78

Query  350  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  529
            +TG +A+ A  V+A++FIE     N   NGH  N  F+C DV   DL    ES+D++FSN
Sbjct  79   YTGTIAEHAASVVAVEFIEGFHATNVETNGHRANCSFICGDVC--DLERPKESLDVVFSN  136

Query  530  WLLMYLSDQEVESL  571
            WLLMYL+D EV+ L
Sbjct  137  WLLMYLNDVEVKKL  150



>gb|EMT23240.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=497

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = +2

Query  284  VLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHL-GNIKF  460
            VL++LP+Y GK+VLELGAGIGRFTGELA++AG VIA+DFI+SVIKKNE ING +  NI F
Sbjct  51   VLAILPSYAGKTVLELGAGIGRFTGELAKEAGHVIALDFIDSVIKKNEEINGDIYKNITF  110

Query  461  MCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVESL  571
            MCADVTS +L   D S+D++FSNWLLMYL+D+EVE L
Sbjct  111  MCADVTSPELKIEDNSVDIVFSNWLLMYLNDEEVEKL  147



>gb|ETK83171.1| hypothetical protein L915_11577 [Phytophthora parasitica]
Length=185

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 87/132 (66%), Gaps = 2/132 (2%)
 Frame = +2

Query  176  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  355
            R++ K+YW  HSS  TVE MMLDS A  L + E PE+L   P+ E K VLEL AGIGR+T
Sbjct  5    RDLMKAYWEGHSSSATVETMMLDSHAKTLTELEVPEILDKAPSMEHKDVLELAAGIGRYT  64

Query  356  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  535
              +A  A  V A++FIE  IK NE  NGHLGNIKF+C DV    L     S D+IFSNW+
Sbjct  65   SVIATMAKSVTAVEFIEDFIKVNEDKNGHLGNIKFLCKDVVH--LEAEPNSFDVIFSNWI  122

Query  536  LMYLSDQEVESL  571
            LMY+ D+EV+  
Sbjct  123  LMYMEDEEVKEF  134



>ref|XP_004545582.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Maylandia zebra]
Length=491

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 88/126 (70%), Gaps = 2/126 (2%)
 Frame = +2

Query  194  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  373
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  10   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  69

Query  374  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  553
            A  V A+DF+E  I+KN   NGH  N  F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  70   AAHVTAVDFMERFIEKNRQKNGHHSNGTFLQADVTKLDV--PQNSIDFIFSNWLLMYLSD  127

Query  554  QEVESL  571
            +E+ S+
Sbjct  128  EELNSV  133



>ref|NP_001070105.1| phosphoethanolamine methyltransferase [Danio rerio]
 gb|AAI24222.1| Zgc:153034 [Danio rerio]
Length=489

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = +2

Query  194  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  373
            +W EHS + TVE MMLDS A +L + E PE+L +LPA     VLELGAGIGR+T  L  +
Sbjct  4    FWKEHSKQATVEEMMLDSHAQELTQHELPEILDLLPALSESCVLELGAGIGRYTKHLIGR  63

Query  374  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  553
            A  V A+DF+E  ++KN   NGHLG+++F+ ADVT   L+F + S DL+FSNWLLMYLSD
Sbjct  64   ARHVTAVDFMEKFVEKNRQDNGHLGSVEFIQADVTK--LDFPEHSFDLVFSNWLLMYLSD  121

Query  554  QEVESL  571
            QE++ L
Sbjct  122  QELQLL  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515