BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF020D09

Length=488
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAD33240.1|  putative mitochondrial NAD-dependent malate dehy...    231   1e-71   Solanum tuberosum [potatoes]
ref|NP_001234001.1|  mitochondrial malate dehydrogenase                 228   1e-70   
ref|NP_001275034.1|  malate dehydrogenase, mitochondrial-like           227   3e-70   Solanum tuberosum [potatoes]
emb|CAD33241.1|  putative mitochondrial NAD-dependent malate dehy...    224   4e-69   Solanum tuberosum [potatoes]
ref|NP_001274946.1|  malate dehydrogenase, mitochondrial-like           220   2e-67   Solanum tuberosum [potatoes]
ref|XP_009611177.1|  PREDICTED: malate dehydrogenase 2, mitochond...    219   2e-67   Nicotiana tomentosiformis
ref|XP_006358950.1|  PREDICTED: malate dehydrogenase, mitochondri...    219   4e-67   Solanum tuberosum [potatoes]
emb|CDP05985.1|  unnamed protein product                                218   1e-66   Coffea canephora [robusta coffee]
ref|XP_006592546.1|  PREDICTED: malate dehydrogenase, mitochondrial     218   2e-66   
ref|XP_009593526.1|  PREDICTED: malate dehydrogenase, mitochondrial     216   5e-66   Nicotiana tomentosiformis
ref|XP_007133189.1|  hypothetical protein PHAVU_011G159000g             216   6e-66   Phaseolus vulgaris [French bean]
gb|AIE54296.1|  mitochondrial malate dehydrogenase                      216   6e-66   Nicotiana tabacum [American tobacco]
ref|XP_009760199.1|  PREDICTED: malate dehydrogenase 2, mitochond...    216   6e-66   Nicotiana sylvestris
ref|XP_010313914.1|  PREDICTED: malate dehydrogenase, mitochondrial     215   2e-65   
ref|XP_011006727.1|  PREDICTED: malate dehydrogenase, mitochondrial     214   2e-65   Populus euphratica
ref|NP_001276183.1|  malate dehydrogenase, mitochondrial-like           214   2e-65   Glycine max [soybeans]
ref|XP_004510039.1|  PREDICTED: malate dehydrogenase, mitochondri...    213   6e-65   Cicer arietinum [garbanzo]
ref|XP_002300420.2|  Malate dehydrogenase family protein                211   4e-64   Populus trichocarpa [western balsam poplar]
ref|XP_009803762.1|  PREDICTED: malate dehydrogenase, mitochondrial     211   8e-64   Nicotiana sylvestris
gb|AIY53988.1|  malate dehydrogenase                                    210   1e-63   Stylosanthes guianensis [stylo]
ref|XP_010527511.1|  PREDICTED: malate dehydrogenase 1, mitochond...    206   1e-63   Tarenaya hassleriana [spider flower]
gb|AFK45866.1|  unknown                                                 210   2e-63   Lotus japonicus
sp|P83373.1|MDHM_FRAAN  RecName: Full=Malate dehydrogenase, mitoc...    209   2e-63   Fragaria x ananassa
ref|XP_004294095.1|  PREDICTED: malate dehydrogenase, mitochondrial     209   2e-63   Fragaria vesca subsp. vesca
gb|KEH19548.1|  malate dehydrogenase                                    207   2e-63   Medicago truncatula
ref|XP_010542305.1|  PREDICTED: malate dehydrogenase 1, mitochond...    209   4e-63   Tarenaya hassleriana [spider flower]
ref|XP_010108267.1|  Malate dehydrogenase 1                             209   5e-63   Morus notabilis
gb|AAB99755.1|  malate dehydrogenase precursor                          208   8e-63   Medicago sativa [alfalfa]
ref|XP_006305270.1|  hypothetical protein CARUB_v10009646mg             207   1e-62   Capsella rubella
gb|AAF69549.1|AC008007_24  F12M16.14                                    208   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010279077.1|  PREDICTED: malate dehydrogenase, mitochondri...    208   1e-62   Nelumbo nucifera [Indian lotus]
ref|NP_564625.1|  malate dehydrogenase 1                                207   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002894430.1|  mitochondrial malate dehydrogenase                 207   2e-62   
ref|XP_009335198.1|  PREDICTED: malate dehydrogenase, mitochondrial     207   2e-62   Pyrus x bretschneideri [bai li]
ref|XP_008367914.1|  PREDICTED: malate dehydrogenase, mitochondrial     207   2e-62   Malus domestica [apple tree]
ref|XP_009340262.1|  PREDICTED: malate dehydrogenase, mitochondri...    207   2e-62   Pyrus x bretschneideri [bai li]
gb|KEH19547.1|  malate dehydrogenase                                    207   3e-62   Medicago truncatula
gb|AAM64855.1|  mitochondrial NAD-dependent malate dehydrogenase        206   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011044945.1|  PREDICTED: malate dehydrogenase, mitochondri...    206   4e-62   Populus euphratica
gb|KFK35713.1|  hypothetical protein AALP_AA4G027400                    206   6e-62   Arabis alpina [alpine rockcress]
ref|XP_010479877.1|  PREDICTED: malate dehydrogenase 1, mitochond...    206   7e-62   Camelina sativa [gold-of-pleasure]
ref|XP_009106989.1|  PREDICTED: malate dehydrogenase 1, mitochond...    206   7e-62   Brassica rapa
ref|XP_010277741.1|  PREDICTED: malate dehydrogenase, mitochondrial     205   1e-61   Nelumbo nucifera [Indian lotus]
ref|XP_008226502.1|  PREDICTED: malate dehydrogenase, mitochondrial     205   1e-61   Prunus mume [ume]
ref|XP_010462202.1|  PREDICTED: malate dehydrogenase 1, mitochond...    205   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010500961.1|  PREDICTED: malate dehydrogenase 1, mitochond...    204   2e-61   Camelina sativa [gold-of-pleasure]
sp|P46487.1|MDHM_EUCGU  RecName: Full=Malate dehydrogenase, mitoc...    205   2e-61   Eucalyptus gunnii
ref|XP_006852481.1|  hypothetical protein AMTR_s00021p00133930          205   2e-61   Amborella trichopoda
sp|Q43744.1|MDHM_BRANA  RecName: Full=Malate dehydrogenase, mitoc...    204   2e-61   Brassica napus [oilseed rape]
ref|XP_007213810.1|  hypothetical protein PRUPE_ppa008270mg             204   2e-61   Prunus persica
gb|AHN85657.1|  mitochondrial malate dehydrogenase                      204   2e-61   Prunus persica
ref|XP_002316794.1|  Malate dehydrogenase family protein                204   2e-61   Populus trichocarpa [western balsam poplar]
emb|CDY02518.1|  BnaA08g01250D                                          204   3e-61   
emb|CDY25868.1|  BnaA05g14590D                                          204   3e-61   Brassica napus [oilseed rape]
emb|CDY59402.1|  BnaC03g78200D                                          203   8e-61   Brassica napus [oilseed rape]
ref|XP_006392810.1|  hypothetical protein EUTSA_v10011552mg             202   8e-61   
emb|CDY55845.1|  BnaCnng29330D                                          202   1e-60   Brassica napus [oilseed rape]
ref|XP_011098245.1|  PREDICTED: malate dehydrogenase, mitochondrial     202   1e-60   Sesamum indicum [beniseed]
gb|KDP32500.1|  hypothetical protein JCGZ_14703                         202   2e-60   Jatropha curcas
ref|XP_002524262.1|  malate dehydrogenase, putative                     202   2e-60   Ricinus communis
ref|XP_007021667.1|  Lactate/malate dehydrogenase family protein        201   2e-60   Theobroma cacao [chocolate]
ref|XP_010912571.1|  PREDICTED: malate dehydrogenase, mitochondrial     202   3e-60   Elaeis guineensis
ref|XP_006392811.1|  hypothetical protein EUTSA_v10011552mg             202   4e-60   
gb|KFK38851.1|  hypothetical protein AALP_AA3G168500                    201   4e-60   Arabis alpina [alpine rockcress]
ref|XP_006392812.1|  hypothetical protein EUTSA_v10011552mg             202   7e-60   
ref|XP_010915605.1|  PREDICTED: malate dehydrogenase, mitochondri...    200   1e-59   Elaeis guineensis
ref|NP_001078156.1|  malate dehydrogenase 2                             199   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001268095.1|  malate dehydrogenase                               200   1e-59   Vitis vinifera
ref|XP_002882909.1|  hypothetical protein ARALYDRAFT_478929             199   2e-59   
ref|NP_188120.1|  malate dehydrogenase 2                                199   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225206.1|  PREDICTED: malate dehydrogenase, mitochondri...    199   3e-59   Prunus mume [ume]
ref|XP_009386638.1|  PREDICTED: malate dehydrogenase, mitochondrial     198   5e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010060663.1|  PREDICTED: malate dehydrogenase, mitochondrial     198   8e-59   Eucalyptus grandis [rose gum]
ref|XP_004961146.1|  PREDICTED: malate dehydrogenase, mitochondri...    197   1e-58   Setaria italica
ref|XP_008451713.1|  PREDICTED: malate dehydrogenase, mitochondrial     197   1e-58   
gb|KJB61647.1|  hypothetical protein B456_009G372600                    196   1e-58   Gossypium raimondii
ref|XP_008805887.1|  PREDICTED: malate dehydrogenase, mitochondri...    197   1e-58   Phoenix dactylifera
gb|KJB13224.1|  hypothetical protein B456_002G063300                    196   1e-58   Gossypium raimondii
gb|KDO48352.1|  hypothetical protein CISIN_1g018314mg                   192   2e-58   Citrus sinensis [apfelsine]
gb|KJB61646.1|  hypothetical protein B456_009G372600                    196   2e-58   Gossypium raimondii
ref|XP_002522546.1|  malate dehydrogenase, putative                     196   2e-58   Ricinus communis
ref|XP_007212766.1|  hypothetical protein PRUPE_ppa022676mg             196   4e-58   Prunus persica
gb|KJB13223.1|  hypothetical protein B456_002G063300                    196   4e-58   Gossypium raimondii
gb|KHG11830.1|  Malate dehydrogenase-2C mitochondrial                   196   4e-58   Gossypium arboreum [tree cotton]
gb|KDO48351.1|  hypothetical protein CISIN_1g018314mg                   192   7e-58   Citrus sinensis [apfelsine]
gb|KDO48350.1|  hypothetical protein CISIN_1g018314mg                   193   2e-57   Citrus sinensis [apfelsine]
sp|P17783.1|MDHM_CITLA  RecName: Full=Malate dehydrogenase, mitoc...    194   3e-57   Citrullus lanatus [wild melon]
ref|XP_006485676.1|  PREDICTED: malate dehydrogenase, mitochondri...    192   9e-57   Citrus sinensis [apfelsine]
gb|KDO48348.1|  hypothetical protein CISIN_1g018314mg                   192   1e-56   Citrus sinensis [apfelsine]
ref|XP_004137217.1|  PREDICTED: malate dehydrogenase, mitochondri...    192   2e-56   Cucumis sativus [cucumbers]
emb|CBI20215.3|  unnamed protein product                                192   2e-56   Vitis vinifera
ref|XP_002285356.1|  PREDICTED: malate dehydrogenase, mitochondrial     192   2e-56   Vitis vinifera
ref|NP_001141337.1|  uncharacterized protein LOC100273428               191   2e-56   Zea mays [maize]
ref|XP_002441555.1|  hypothetical protein SORBIDRAFT_09g029240          191   2e-56   Sorghum bicolor [broomcorn]
ref|XP_002456051.1|  hypothetical protein SORBIDRAFT_03g029570          191   2e-56   
ref|XP_009395766.1|  PREDICTED: malate dehydrogenase, mitochondri...    191   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006451738.1|  hypothetical protein CICLE_v10008562mg             192   2e-56   
gb|ADP03323.1|  malate dehydrogenase                                    185   3e-56   Pinus pinaster [cluster pine]
ref|NP_001043717.1|  Os01g0649100                                       191   3e-56   
gb|ADP03262.1|  malate dehydrogenase                                    184   3e-56   Pinus sylvestris [Scotch pine]
gb|ADP03279.1|  malate dehydrogenase                                    184   3e-56   Pinus sylvestris [Scotch pine]
gb|ADP03255.1|  malate dehydrogenase                                    184   4e-56   Pinus sylvestris [Scotch pine]
ref|NP_001140825.1|  uncharacterized protein LOC100272900               190   5e-56   Zea mays [maize]
ref|XP_011082746.1|  PREDICTED: malate dehydrogenase, mitochondrial     191   5e-56   Sesamum indicum [beniseed]
ref|NP_001142100.1|  malate dehydrogenase2                              190   8e-56   Zea mays [maize]
gb|ACG36184.1|  malate dehydrogenase                                    190   8e-56   Zea mays [maize]
gb|ADP03277.1|  malate dehydrogenase                                    183   1e-55   Pinus sylvestris [Scotch pine]
tpg|DAA58328.1|  TPA: malate dehydrogenase                              191   2e-55   
ref|XP_004969321.1|  PREDICTED: malate dehydrogenase, mitochondri...    189   2e-55   Setaria italica
ref|XP_010675402.1|  PREDICTED: malate dehydrogenase, mitochondrial     189   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003567846.1|  PREDICTED: malate dehydrogenase 1, mitochond...    189   2e-55   Brachypodium distachyon [annual false brome]
emb|CDY24107.1|  BnaA06g01050D                                          188   3e-55   Brassica napus [oilseed rape]
emb|CDY26002.1|  BnaC06g06220D                                          187   6e-55   Brassica napus [oilseed rape]
ref|XP_006654824.1|  PREDICTED: malate dehydrogenase, mitochondri...    187   9e-55   Oryza brachyantha
ref|XP_007025436.1|  Malate dehydrogenase                               187   2e-54   Theobroma cacao [chocolate]
emb|CBL95261.1|  malate dehydrogenase                                   186   4e-54   Pinus pinaster [cluster pine]
gb|EPS74425.1|  malate dehydrogenase, mitochondrial                     184   1e-53   Genlisea aurea
ref|XP_009147616.1|  PREDICTED: malate dehydrogenase 1, mitochond...    184   2e-53   Brassica rapa
ref|XP_006644438.1|  PREDICTED: malate dehydrogenase, mitochondri...    183   2e-53   Oryza brachyantha
ref|XP_002305754.2|  hypothetical protein POPTR_0004s05340g             183   3e-53   
ref|XP_003569456.1|  PREDICTED: malate dehydrogenase 1, mitochond...    183   4e-53   Brachypodium distachyon [annual false brome]
dbj|BAJ85181.1|  predicted protein                                      181   2e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011397587.1|  Malate dehydrogenase, mitochondrial                180   3e-52   Auxenochlorella protothecoides
ref|XP_002990694.1|  hypothetical protein SELMODRAFT_131967             181   5e-52   Selaginella moellendorffii
ref|NP_001056389.1|  Os05g0574400                                       179   1e-51   
ref|XP_001767253.1|  predicted protein                                  177   6e-51   
ref|XP_005649665.1|  malate dehydrogenase                               176   1e-50   Coccomyxa subellipsoidea C-169
emb|CDM83547.1|  unnamed protein product                                176   3e-50   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001776138.1|  predicted protein                                  175   3e-50   
ref|XP_002969028.1|  hypothetical protein SELMODRAFT_90290              175   5e-50   Selaginella moellendorffii
emb|CCD74506.1|  mitochondrial malate dehydrogenase                     167   1e-48   Arabidopsis halleri subsp. halleri
gb|EMS58229.1|  Malate dehydrogenase 1, mitochondrial                   173   1e-48   Triticum urartu
ref|XP_010062799.1|  PREDICTED: malate dehydrogenase, mitochondrial     169   5e-48   Eucalyptus grandis [rose gum]
gb|KDD74483.1|  lactate/malate dehydrogenase                            171   6e-48   Helicosporidium sp. ATCC 50920
ref|XP_005843566.1|  hypothetical protein CHLNCDRAFT_59812              169   6e-48   Chlorella variabilis
ref|XP_002968321.1|  hypothetical protein SELMODRAFT_89860              168   3e-47   
ref|XP_002976052.1|  hypothetical protein SELMODRAFT_232627             167   3e-47   
ref|XP_003228877.1|  PREDICTED: malate dehydrogenase, mitochondrial     165   3e-46   Anolis carolinensis [Carolina anole]
emb|CEF98358.1|  Lactate dehydrogenase/glycoside hydrolase, famil...    165   3e-46   Ostreococcus tauri
gb|AHB50501.1|  malate dehydrogenase 2                                  164   4e-46   Mayetiola destructor
ref|XP_002507824.1|  nad-dependent malate dehydrogenase                 164   6e-46   Micromonas commoda
gb|ACP18839.1|  malate dehydrogenase                                    159   8e-46   Chrysomela tremula
ref|XP_008904152.1|  malate dehydrogenase, NAD-dependent                163   2e-45   Phytophthora parasitica INRA-310
ref|XP_009048353.1|  hypothetical protein LOTGIDRAFT_225558             162   2e-45   Lottia gigantea
ref|XP_005743241.1|  PREDICTED: malate dehydrogenase, mitochondri...    161   3e-45   
ref|XP_002732229.1|  PREDICTED: malate dehydrogenase, mitochondri...    162   3e-45   Saccoglossus kowalevskii
ref|XP_003062229.1|  predicted protein                                  162   3e-45   Micromonas pusilla CCMP1545
ref|XP_010617282.1|  PREDICTED: malate dehydrogenase, mitochondri...    162   4e-45   Fukomys damarensis [Damara mole rat]
ref|XP_007904356.1|  PREDICTED: malate dehydrogenase, mitochondrial     162   6e-45   Callorhinchus milii [Australian ghost shark]
ref|XP_008638592.1|  PREDICTED: malate dehydrogenase, mitochondri...    160   7e-45   
ref|XP_004568150.1|  PREDICTED: malate dehydrogenase, mitochondri...    161   7e-45   Maylandia zebra
ref|XP_005096166.1|  PREDICTED: malate dehydrogenase, mitochondri...    161   8e-45   Aplysia californica
emb|CDR41585.1|  CYFA0S07e03818g1_1                                     161   9e-45   Cyberlindnera fabianii
ref|XP_002323942.2|  hypothetical protein POPTR_0017s00790g             159   9e-45   
ref|NP_179863.1|  peroxisomal NAD-malate dehydrogenase                  161   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001418230.1|  predicted protein                                  160   2e-44   Ostreococcus lucimarinus CCE9901
ref|XP_008638591.1|  PREDICTED: malate dehydrogenase, mitochondri...    160   2e-44   Corvus brachyrhynchos
ref|XP_005525897.1|  PREDICTED: malate dehydrogenase, mitochondri...    160   2e-44   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_002500632.1|  malate dehydrogenase                               159   2e-44   Micromonas commoda
ref|XP_009529225.1|  hypothetical protein PHYSODRAFT_286325             160   2e-44   Phytophthora sojae
ref|XP_007433827.1|  PREDICTED: malate dehydrogenase, mitochondrial     160   2e-44   Python bivittatus
gb|ACH45805.1|  putative malate dehydrogenase mitochondrial varia...    160   3e-44   Taeniopygia guttata
gb|KFB40725.1|  AGAP001903-PA-like protein                              160   3e-44   Anopheles sinensis
gb|ACH45802.1|  putative malate dehydrogenase mitochondrial varia...    159   3e-44   Taeniopygia guttata
gb|AAF27650.1|AF218064_1  malate dehydrogenase precursor                160   3e-44   Nucella lapillus
gb|ETN58378.1|  mitochondrial malate dehydrogenase 2                    159   3e-44   Anopheles darlingi [American malaria mosquito]
ref|XP_001979676.1|  GG22759                                            159   4e-44   Drosophila erecta
ref|XP_002899810.1|  malate dehydrogenase, mitochondrial precursor      159   4e-44   Phytophthora infestans T30-4
ref|XP_003443722.1|  PREDICTED: malate dehydrogenase, mitochondri...    159   4e-44   Oreochromis niloticus
ref|XP_321163.4|  AGAP001903-PA                                         159   5e-44   Anopheles gambiae str. PEST
ref|NP_001232112.1|  putative malate dehydrogenase mitochondrial ...    159   6e-44   Taeniopygia guttata
gb|ETE65153.1|  Malate dehydrogenase, mitochondrial                     160   6e-44   Ophiophagus hannah
ref|XP_002096156.1|  GE25523                                            159   7e-44   Drosophila yakuba
ref|XP_002880457.1|  peroxisomal NAD-malate dehydrogenase 1             159   7e-44   
ref|NP_650696.1|  malate dehydrogenase 2                                159   7e-44   Drosophila melanogaster
ref|XP_001849862.1|  mitochondrial malate dehydrogenase 2               159   7e-44   Culex quinquefasciatus
ref|XP_002054903.1|  GJ22544                                            159   8e-44   Drosophila virilis
ref|XP_004448330.1|  PREDICTED: malate dehydrogenase, mitochondrial     159   8e-44   Dasypus novemcinctus
gb|KHN10168.1|  Malate dehydrogenase 1, mitochondrial                   157   8e-44   Glycine soja [wild soybean]
ref|XP_005648549.1|  malate dehydrogenase                               158   8e-44   Coccomyxa subellipsoidea C-169
ref|XP_008928643.1|  PREDICTED: malate dehydrogenase, mitochondri...    157   8e-44   
ref|XP_010417035.1|  PREDICTED: probable malate dehydrogenase, gl...    159   9e-44   
ref|XP_008035924.1|  malate dehydrogenase                               158   1e-43   Trametes versicolor FP-101664 SS1
ref|XP_005187487.1|  PREDICTED: malate dehydrogenase, mitochondrial     158   1e-43   Musca domestica
ref|XP_006294611.1|  hypothetical protein CARUB_v10023648mg             158   1e-43   
emb|CAG12894.1|  unnamed protein product                                158   1e-43   Tetraodon nigroviridis
gb|ACI66609.1|  Malate dehydrogenase, mitochondrial precursor           154   1e-43   Salmo salar
ref|XP_007002564.1|  hypothetical protein TREMEDRAFT_42859              158   1e-43   Tremella mesenterica DSM 1558
ref|XP_007513166.1|  predicted protein                                  158   1e-43   Bathycoccus prasinos
gb|KFW86389.1|  hypothetical protein N305_15033                         157   2e-43   Manacus vitellinus
ref|XP_006640874.1|  PREDICTED: malate dehydrogenase, mitochondri...    156   2e-43   
ref|XP_004343487.1|  malate dehydrogenase                               157   2e-43   Capsaspora owczarzaki ATCC 30864
ref|XP_008928641.1|  PREDICTED: malate dehydrogenase, mitochondri...    157   2e-43   Manacus vitellinus
ref|XP_003848892.1|  malate dehydrogenase                               157   2e-43   Zymoseptoria tritici IPO323
ref|XP_001759853.1|  predicted protein                                  158   2e-43   
gb|KFK33003.1|  hypothetical protein AALP_AA6G317500                    158   2e-43   Arabis alpina [alpine rockcress]
ref|XP_003055830.1|  malate dehydrogenase                               158   2e-43   Micromonas pusilla CCMP1545
ref|XP_008056240.1|  PREDICTED: malate dehydrogenase, mitochondrial     157   2e-43   Carlito syrichta
emb|CEI99232.1|  Putative Malate dehydrogenase                          157   3e-43   Rhizopus microsporus
ref|XP_001359972.1|  GA20754                                            157   3e-43   Drosophila pseudoobscura pseudoobscura
gb|KGB76526.1|  malate dehydrogenase                                    156   3e-43   
ref|XP_009955651.1|  PREDICTED: malate dehydrogenase, mitochondri...    156   3e-43   Leptosomus discolor
ref|XP_005154369.1|  PREDICTED: malate dehydrogenase, mitochondrial     157   3e-43   Melopsittacus undulatus
emb|CDS03373.1|  Putative Malate dehydrogenase                          157   3e-43   Lichtheimia ramosa
gb|EIE83614.1|  malate dehydrogenase, NAD-dependent                     157   4e-43   Rhizopus delemar RA 99-880
ref|XP_005892889.1|  PREDICTED: malate dehydrogenase, mitochondri...    156   4e-43   Bos mutus
dbj|GAA96214.1|  hypothetical protein E5Q_02878                         157   4e-43   Mixia osmundae IAM 14324
ref|XP_007468863.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   4e-43   Lipotes vexillifer [baiji]
ref|XP_010429212.1|  PREDICTED: probable malate dehydrogenase, gl...    157   4e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006180996.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   4e-43   
ref|XP_005662012.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   4e-43   
ref|XP_004630505.1|  PREDICTED: malate dehydrogenase, mitochondrial     157   4e-43   Octodon degus
ref|XP_007186626.1|  PREDICTED: malate dehydrogenase, mitochondrial     157   4e-43   Balaenoptera acutorostrata scammoni
ref|XP_006733971.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   5e-43   Leptonychotes weddellii
gb|KFM73959.1|  Malate dehydrogenase, mitochondrial                     156   5e-43   Stegodyphus mimosarum
ref|XP_006640873.1|  PREDICTED: malate dehydrogenase, mitochondri...    156   5e-43   Lepisosteus oculatus
ref|XP_010363204.1|  PREDICTED: malate dehydrogenase, mitochondri...    153   5e-43   Rhinopithecus roxellana
ref|XP_006794972.1|  PREDICTED: malate dehydrogenase, mitochondri...    156   5e-43   Neolamprologus brichardi [lyretail cichlid]
ref|XP_010472275.1|  PREDICTED: probable malate dehydrogenase, gl...    157   5e-43   Camelina sativa [gold-of-pleasure]
ref|XP_002596683.1|  hypothetical protein BRAFLDRAFT_114460             156   6e-43   Branchiostoma floridae
ref|XP_003416634.1|  PREDICTED: malate dehydrogenase, mitochondrial     156   6e-43   Loxodonta africana [African bush elephant]
ref|XP_010695343.1|  PREDICTED: malate dehydrogenase, chloroplast...    158   6e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006859745.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   6e-43   Chrysochloris asiatica
ref|XP_001999857.1|  GI24757                                            156   6e-43   Drosophila mojavensis
gb|AAA39509.1|  malate dehydrogenase                                    156   6e-43   Mus musculus [mouse]
ref|XP_004840144.1|  PREDICTED: malate dehydrogenase, mitochondrial     156   7e-43   Heterocephalus glaber [naked mole rat]
emb|CEG68956.1|  Putative Malate dehydrogenase                          156   7e-43   Rhizopus microsporus
ref|XP_004399137.1|  PREDICTED: malate dehydrogenase, mitochondrial     156   7e-43   Odobenus rosmarus divergens
ref|XP_001703167.1|  malate dehydrogenase                               157   7e-43   Chlamydomonas reinhardtii
ref|XP_005284503.1|  PREDICTED: malate dehydrogenase, mitochondrial     156   7e-43   Chrysemys picta bellii
ref|XP_003770242.1|  PREDICTED: malate dehydrogenase, mitochondrial     156   7e-43   
gb|ACY66481.1|  malate dehydrogenase                                    151   7e-43   Scylla paramamosain
ref|XP_009955650.1|  PREDICTED: malate dehydrogenase, mitochondri...    156   7e-43   Leptosomus discolor
ref|XP_006971340.1|  PREDICTED: malate dehydrogenase, mitochondrial     156   8e-43   Peromyscus maniculatus bairdii
ref|XP_003195123.1|  malate dehydrogenase                               156   8e-43   Cryptococcus gattii WM276
gb|KIR27685.1|  malate dehydrogenase, NAD-dependent                     156   8e-43   Cryptococcus gattii VGII LA55
ref|XP_005080427.1|  PREDICTED: malate dehydrogenase, mitochondrial     156   8e-43   Mesocricetus auratus [Syrian golden hamster]
ref|XP_007518009.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   8e-43   Erinaceus europaeus [common hedgehog]
emb|CAA27812.1|  unnamed protein product                                156   8e-43   Rattus norvegicus [brown rat]
gb|AFA55184.1|  mitochondrial malate dehydrogenase 2                    156   8e-43   Ochotona curzoniae [plateau pika]
ref|XP_792004.2|  PREDICTED: malate dehydrogenase, mitochondrial-...    156   8e-43   Strongylocentrotus purpuratus [purple urchin]
ref|XP_008592813.1|  PREDICTED: malate dehydrogenase, mitochondrial     156   8e-43   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004666330.1|  PREDICTED: malate dehydrogenase, mitochondrial     156   8e-43   Jaculus jaculus
ref|XP_011197045.1|  PREDICTED: malate dehydrogenase, mitochondrial     156   8e-43   Zeugodacus cucurbitae [melon fruit fly]
emb|CDH57483.1|  malate dehydrogenase                                   156   9e-43   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_006155702.1|  PREDICTED: malate dehydrogenase, mitochondrial     156   9e-43   Tupaia chinensis
ref|XP_007104038.1|  PREDICTED: malate dehydrogenase, mitochondrial     156   9e-43   Physeter catodon
ref|XP_415765.1|  PREDICTED: malate dehydrogenase, mitochondrial        156   9e-43   
ref|XP_003211747.1|  PREDICTED: malate dehydrogenase, mitochondrial     156   9e-43   Meleagris gallopavo [common turkey]
ref|XP_005892888.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   9e-43   Bos mutus
ref|XP_005621038.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   9e-43   
ref|XP_001759620.1|  predicted protein                                  156   9e-43   
gb|ELR58454.1|  Malate dehydrogenase, mitochondrial                     155   1e-42   Bos mutus
ref|NP_032643.2|  malate dehydrogenase, mitochondrial precursor         155   1e-42   Mus musculus [mouse]
ref|XP_003741774.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   1e-42   Galendromus occidentalis
ref|XP_005396867.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   1e-42   Chinchilla lanigera
emb|CAA30274.1|  malate dehydrogenase                                   155   1e-42   Mus musculus [mouse]
ref|NP_001277813.1|  malate dehydrogenase 2, NAD (mitochondrial)        155   1e-42   Bubalus bubalis [domestic water buffalo]
ref|NP_112413.2|  malate dehydrogenase, mitochondrial precursor         155   1e-42   Rattus norvegicus [brown rat]
ref|NP_001265782.1|  malate dehydrogenase, mitochondrial                155   1e-42   Felis catus [cat]
ref|XP_005225065.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   1e-42   Bos taurus [bovine]
ref|XP_007468862.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   1e-42   Lipotes vexillifer [baiji]
ref|XP_004587040.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   1e-42   Ochotona princeps [southern American pika]
ref|XP_004268863.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   1e-42   Orcinus orca [Orca]
ref|XP_006733970.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   1e-42   Leptonychotes weddellii
ref|XP_004321604.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   1e-42   
ref|XP_973533.1|  PREDICTED: malate dehydrogenase, mitochondrial        155   1e-42   Tribolium castaneum [rust-red flour beetle]
ref|NP_001269332.1|  malate dehydrogenase, mitochondrial isoform ...    154   1e-42   Homo sapiens [man]
ref|NP_001231082.1|  malate dehydrogenase, mitochondrial                155   1e-42   Sus scrofa [pigs]
ref|XP_004077823.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   1e-42   Oryzias latipes [Japanese rice fish]
dbj|BAG56955.1|  unnamed protein product                                154   1e-42   Homo sapiens [man]
ref|XP_572038.1|  malate dehydrogenase                                  155   1e-42   Cryptococcus neoformans var. neoformans JEC21
ref|XP_004688335.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   1e-42   Condylura cristata
ref|XP_003470157.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   1e-42   Cavia porcellus [guinea pig]
ref|NP_001013605.1|  malate dehydrogenase, mitochondrial                154   1e-42   Bos taurus [bovine]
ref|XP_006180995.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   1e-42   Camelus ferus
ref|XP_008139681.1|  PREDICTED: malate dehydrogenase, mitochondri...    154   1e-42   
ref|XP_004045662.1|  PREDICTED: malate dehydrogenase, mitochondri...    154   1e-42   
ref|XP_006859744.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   1e-42   Chrysochloris asiatica
gb|ADG65261.1|  malate dehydrogenase                                    155   1e-42   
ref|XP_004536932.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   1e-42   
emb|CDP18386.1|  unnamed protein product                                154   1e-42   
gb|EIE75494.1|  malate dehydrogenase, NAD-dependent                     155   1e-42   
ref|XP_002953466.1|  malate dehydrogenase                               155   1e-42   
ref|XP_005056570.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   1e-42   
ref|XP_001964397.1|  GF23071                                            155   2e-42   
ref|NP_001127677.1|  malate dehydrogenase, mitochondrial precursor      155   2e-42   
gb|ABG22106.1|  Malate dehydrogenase, glyoxysomal precursor, puta...    153   2e-42   
gb|EPE10964.1|  malate dehydrogenase                                    155   2e-42   
ref|XP_010105100.1|  Malate dehydrogenase                               155   2e-42   
gb|KDO78776.1|  hypothetical protein CISIN_1g018265mg                   154   2e-42   
gb|KDO78778.1|  hypothetical protein CISIN_1g018265mg                   153   2e-42   
ref|XP_004385997.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   2e-42   
ref|XP_002711952.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   2e-42   
ref|XP_006918628.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   2e-42   
ref|XP_006088318.1|  PREDICTED: malate dehydrogenase, mitochondri...    154   2e-42   
gb|AAQ18808.1|  mitochondrial malate dehydrogenase precursor            155   2e-42   
ref|XP_007518008.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   2e-42   
ref|XP_001839443.1|  malate dehydrogenase                               155   2e-42   
ref|XP_011369846.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   2e-42   
gb|AEE63021.1|  unknown                                                 155   2e-42   
ref|XP_004761688.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   2e-42   
ref|NP_001085326.1|  malate dehydrogenase 2, NAD (mitochondrial)        155   2e-42   
sp|P00346.2|MDHM_PIG  RecName: Full=Malate dehydrogenase, mitocho...    155   2e-42   
ref|NP_998296.1|  malate dehydrogenase, mitochondrial                   155   2e-42   
ref|XP_010780749.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   2e-42   
emb|CAG38785.1|  MDH2                                                   155   2e-42   
ref|XP_849944.1|  PREDICTED: malate dehydrogenase, mitochondrial ...    155   2e-42   
ref|XP_007259481.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   2e-42   
gb|AAC03787.1|  malate dehydrogenase precursor                          155   2e-42   
ref|XP_007923449.1|  hypothetical protein MYCFIDRAFT_88245              155   2e-42   
ref|XP_002923512.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   2e-42   
ref|NP_005909.2|  malate dehydrogenase, mitochondrial isoform 1 p...    155   3e-42   
gb|ENN81433.1|  hypothetical protein YQE_02126                          154   3e-42   
ref|XP_001156205.1|  PREDICTED: malate dehydrogenase, mitochondri...    154   3e-42   
ref|XP_004045660.1|  PREDICTED: malate dehydrogenase, mitochondri...    154   3e-42   
gb|KDO78775.1|  hypothetical protein CISIN_1g018265mg                   154   3e-42   
ref|XP_005328566.1|  PREDICTED: malate dehydrogenase, mitochondrial     154   3e-42   
ref|XP_006426175.1|  hypothetical protein CICLE_v10025945mg             154   3e-42   
gb|ACH45806.1|  putative malate dehydrogenase mitochondrial varia...    154   3e-42   
ref|XP_001989871.1|  GH18558                                            154   3e-42   
gb|ELW56437.1|  Malate dehydrogenase, mitochondrial                     156   3e-42   
ref|XP_011203018.1|  PREDICTED: malate dehydrogenase, mitochondrial     154   3e-42   
ref|XP_002072326.1|  GK22386                                            154   3e-42   
ref|XP_005344664.1|  PREDICTED: malate dehydrogenase, mitochondrial     154   3e-42   
gb|AFR96450.1|  malate dehydrogenase, NAD-dependent                     154   3e-42   
ref|XP_005598719.1|  PREDICTED: malate dehydrogenase 2, NAD (mito...    153   4e-42   
gb|ABA99939.2|  Malate dehydrogenase, glyoxysomal precursor, puta...    154   4e-42   
ref|XP_009558458.1|  PREDICTED: malate dehydrogenase, mitochondrial     154   4e-42   
ref|XP_008139680.1|  PREDICTED: malate dehydrogenase, mitochondri...    154   4e-42   
ref|XP_001659012.1|  AAEL008166-PA                                      156   4e-42   
ref|XP_004761687.1|  PREDICTED: malate dehydrogenase, mitochondri...    155   4e-42   
gb|AFX00023.1|  malate dehydrogenase                                    155   4e-42   
ref|XP_011088014.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    154   4e-42   
ref|XP_008696758.1|  PREDICTED: malate dehydrogenase, mitochondrial     154   4e-42   
ref|XP_002402153.1|  malate dehydrogenase, putative                     154   4e-42   
emb|CDX89514.1|  BnaC04g35330D                                          154   5e-42   
ref|XP_003895900.1|  PREDICTED: malate dehydrogenase, mitochondrial     154   5e-42   
ref|XP_006088317.1|  PREDICTED: malate dehydrogenase, mitochondri...    154   5e-42   
gb|EYU44539.1|  hypothetical protein MIMGU_mgv1a008933mg                154   5e-42   
gb|EHH17233.1|  hypothetical protein EGK_13581                          154   5e-42   
gb|ACH45801.1|  putative malate dehydrogenase mitochondrial varia...    154   5e-42   
emb|CDQ84176.1|  unnamed protein product                                154   5e-42   
ref|XP_005852212.1|  hypothetical protein CHLNCDRAFT_18230              154   5e-42   
ref|NP_001270089.1|  malate dehydrogenase, mitochondrial                154   5e-42   
ref|NP_001188130.1|  mitochondrial malate dehydrogenase                 154   5e-42   
ref|XP_006057186.1|  PREDICTED: malate dehydrogenase, mitochondri...    153   5e-42   
ref|XP_004021309.1|  PREDICTED: malate dehydrogenase, mitochondrial     155   6e-42   
gb|ACI67899.1|  Malate dehydrogenase, mitochondrial precursor           153   6e-42   
ref|XP_002835806.1|  hypothetical protein                               154   6e-42   
gb|ACN62414.1|  malate dehydrogenase                                    154   6e-42   
gb|AAK69767.1|AF390561_1  malate dehydrogenase                          154   6e-42   
ref|XP_006680274.1|  hypothetical protein BATDEDRAFT_17222              153   6e-42   
ref|XP_010869200.1|  PREDICTED: malate dehydrogenase, mitochondrial     154   6e-42   
ref|XP_010373951.1|  PREDICTED: malate dehydrogenase, mitochondri...    152   6e-42   
ref|XP_008275186.1|  PREDICTED: malate dehydrogenase, mitochondrial     154   6e-42   
ref|XP_010385737.1|  PREDICTED: malate dehydrogenase, mitochondrial     154   6e-42   
ref|NP_001133198.1|  malate dehydrogenase 2-2, NAD (mitochondrial)      154   7e-42   
ref|XP_006426177.1|  hypothetical protein CICLE_v10025945mg             154   7e-42   
gb|ACI68220.1|  Malate dehydrogenase, mitochondrial precursor           154   7e-42   
ref|XP_006852732.1|  hypothetical protein AMTR_s00033p00085320          154   7e-42   
ref|XP_006466391.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    154   7e-42   
ref|NP_001135174.1|  malate dehydrogenase 2-1, NAD (mitochondrial)      153   7e-42   
ref|XP_008430320.1|  PREDICTED: malate dehydrogenase, mitochondrial     153   7e-42   
gb|ADO28004.1|  mitochondrial malate dehydrogenase                      153   8e-42   
gb|ACH70948.1|  malate dehydrogenase 2-1, NAD (mitochondrial)           153   8e-42   
ref|XP_003934176.1|  PREDICTED: malate dehydrogenase, mitochondrial     153   8e-42   
ref|XP_007549979.1|  PREDICTED: malate dehydrogenase, mitochondrial     153   8e-42   
ref|XP_005799054.1|  PREDICTED: malate dehydrogenase, mitochondri...    152   8e-42   
ref|NP_001182455.1|  malate dehydrogenase 2, NAD (mitochondrial)        153   8e-42   
ref|XP_006346883.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    153   9e-42   
ref|XP_010646909.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    153   9e-42   
ref|XP_004233467.1|  PREDICTED: malate dehydrogenase, glyoxysomal       154   9e-42   
ref|XP_002743993.1|  PREDICTED: malate dehydrogenase, mitochondrial     153   9e-42   
gb|EPS61366.1|  hypothetical protein M569_13431                         155   9e-42   
ref|XP_007067189.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    154   9e-42   
gb|ACN40042.1|  unknown                                                 154   9e-42   
gb|ABK25446.1|  unknown                                                 154   9e-42   
gb|AEI88109.1|  malate dehydrogenase mitochondrial variant 1            147   1e-41   
gb|ACO12404.1|  Malate dehydrogenase, mitochondrial precursor           149   1e-41   
ref|XP_004235981.1|  PREDICTED: malate dehydrogenase, chloroplast...    154   1e-41   
emb|CAA76361.1|  malate dehydrogenase                                   152   1e-41   
sp|Q42972.3|MDHG_ORYSJ  RecName: Full=Malate dehydrogenase, glyox...    153   1e-41   
ref|XP_010417036.1|  PREDICTED: probable malate dehydrogenase, gl...    153   1e-41   
ref|XP_010004342.1|  PREDICTED: malate dehydrogenase, mitochondrial     151   1e-41   
ref|XP_010738316.1|  PREDICTED: malate dehydrogenase, mitochondrial     153   1e-41   
ref|XP_003611508.1|  Malate dehydrogenase, glyoxysomal                  153   1e-41   
gb|KFP01814.1|  hypothetical protein N300_03449                         152   1e-41   
ref|NP_001011412.1|  malate dehydrogenase, mitochondrial                153   1e-41   
ref|XP_004442189.1|  PREDICTED: malate dehydrogenase, mitochondrial     153   1e-41   
ref|XP_010373950.1|  PREDICTED: malate dehydrogenase, mitochondri...    153   1e-41   
ref|XP_009544309.1|  NAD-malate dehydrogenase                           153   1e-41   
gb|KFW68513.1|  hypothetical protein AS28_06434                         150   1e-41   
emb|CBI30662.3|  unnamed protein product                                152   1e-41   
ref|XP_006346882.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    153   1e-41   
ref|NP_001239889.1|  malate dehydrogenase, glyoxysomal-like             153   1e-41   
ref|NP_001067346.2|  Os12g0632700                                       153   1e-41   
gb|KFW94243.1|  hypothetical protein N336_05507                         150   1e-41   
ref|XP_005096165.1|  PREDICTED: malate dehydrogenase, mitochondri...    153   1e-41   
ref|XP_003966008.1|  PREDICTED: malate dehydrogenase, mitochondri...    152   2e-41   
ref|XP_008787239.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    152   2e-41   
ref|XP_005799053.1|  PREDICTED: malate dehydrogenase, mitochondri...    152   2e-41   
emb|CBI29427.3|  unnamed protein product                                153   2e-41   
ref|XP_010400948.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    153   2e-41   
gb|EPB88250.1|  malate dehydrogenase, NAD-dependent                     152   2e-41   
ref|XP_004289711.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    153   2e-41   
dbj|BAK05961.1|  predicted protein                                      153   2e-41   
ref|XP_011457778.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    153   2e-41   
gb|ABB88841.1|  malate dehydrogenase                                    148   2e-41   
gb|KDE02587.1|  malate dehydrogenase                                    152   2e-41   
gb|KFU95884.1|  hypothetical protein M959_10959                         152   2e-41   
gb|ERG87207.1|  putative malate                                         152   2e-41   
gb|ACU17415.1|  unknown                                                 149   2e-41   
gb|KFP45870.1|  hypothetical protein N324_07336                         152   2e-41   
ref|XP_001484850.1|  conserved hypothetical protein                     152   2e-41   
gb|AFA55186.1|  mitochondrial malate dehydrogenase 2                    152   2e-41   
ref|XP_006364593.1|  PREDICTED: malate dehydrogenase, chloroplast...    154   2e-41   
ref|XP_009625012.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    152   2e-41   
ref|XP_011273384.1|  Malate dehydrogenase, mitochondrial                152   2e-41   
ref|XP_004706038.1|  PREDICTED: malate dehydrogenase, mitochondrial     151   2e-41   
dbj|GAN06308.1|  malate dehydrogenase                                   152   2e-41   
ref|XP_001884463.1|  NAD-malate dehydrogenase                           152   2e-41   
ref|XP_008493331.1|  PREDICTED: malate dehydrogenase, mitochondrial     152   2e-41   
gb|KIZ03193.1|  malate dehydrogenase                                    152   2e-41   
emb|CDH58972.1|  malate dehydrogenase                                   152   2e-41   
gb|KIY74254.1|  malate dehydrogenase                                    152   2e-41   
gb|ACF87717.1|  unknown                                                 152   3e-41   
ref|XP_009900530.1|  PREDICTED: malate dehydrogenase, mitochondrial     152   3e-41   
gb|KFP86726.1|  hypothetical protein N310_09243                         152   3e-41   
ref|XP_007305278.1|  malate dehydrogenase                               152   3e-41   
gb|KFV61776.1|  hypothetical protein N307_13393                         151   3e-41   
gb|KGL93367.1|  hypothetical protein N301_12316                         151   3e-41   
gb|ACG24454.1|  malate dehydrogenase, glyoxysomal precursor             152   3e-41   
ref|NP_001132077.2|  uncharacterized protein LOC100193491               152   3e-41   
ref|XP_008016570.1|  PREDICTED: malate dehydrogenase, mitochondri...    154   3e-41   
gb|KHG09742.1|  Malate dehydrogenase-2C glyoxysomal                     152   3e-41   
gb|KIW35379.1|  malate dehydrogenase, NAD-dependent                     152   3e-41   
gb|KFP56162.1|  hypothetical protein N323_12358                         151   3e-41   
ref|XP_009883505.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    152   3e-41   
gb|ADG23098.1|  NAD-dependent malate dehydrogenase                      149   3e-41   
ref|XP_003137632.1|  malate dehydrogenase                               152   3e-41   
gb|KFV95633.1|  hypothetical protein N326_00455                         150   3e-41   
gb|KFV97259.1|  hypothetical protein N327_04853                         151   3e-41   
gb|ABO26695.1|  malate dehydrogenase precursor                          149   3e-41   
gb|KJB18107.1|  hypothetical protein B456_003G034300                    152   4e-41   
ref|XP_011310556.1|  PREDICTED: malate dehydrogenase, mitochondrial     152   4e-41   
gb|KJB18106.1|  hypothetical protein B456_003G034300                    152   4e-41   
gb|KFQ15133.1|  hypothetical protein N330_05720                         151   4e-41   
ref|XP_009643299.1|  PREDICTED: malate dehydrogenase, mitochondrial     152   4e-41   
gb|KFQ97769.1|  hypothetical protein N306_05621                         151   4e-41   
gb|KFM01560.1|  hypothetical protein AS27_04257                         151   4e-41   
ref|XP_009577564.1|  PREDICTED: malate dehydrogenase, mitochondrial     151   4e-41   
ref|XP_010268647.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    152   4e-41   
gb|KCW59619.1|  hypothetical protein EUGRSUZ_H02358                     150   4e-41   
gb|KFZ53514.1|  hypothetical protein N321_05235                         151   4e-41   
gb|KCW59620.1|  hypothetical protein EUGRSUZ_H02358                     150   4e-41   
ref|XP_008342632.1|  PREDICTED: malate dehydrogenase, glyoxysomal       150   4e-41   
emb|CDQ68732.1|  unnamed protein product                                151   4e-41   
emb|CBI22223.3|  unnamed protein product                                149   4e-41   
ref|XP_002310874.2|  malate dehydrogenase family protein                149   4e-41   
ref|XP_003576179.1|  PREDICTED: malate dehydrogenase, glyoxysomal       152   4e-41   
gb|KFV11953.1|  hypothetical protein N339_11022                         151   4e-41   
ref|XP_009079183.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    152   4e-41   
ref|XP_007209183.1|  hypothetical protein PRUPE_ppa006378mg             153   4e-41   
ref|XP_009937859.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    152   5e-41   
ref|XP_002443645.1|  hypothetical protein SORBIDRAFT_08g022770          152   5e-41   
gb|KFQ33716.1|  hypothetical protein N331_09455                         151   5e-41   
ref|XP_009508992.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    151   5e-41   
gb|KFZ63322.1|  hypothetical protein N338_12814                         151   5e-41   
ref|XP_008942843.1|  PREDICTED: malate dehydrogenase, mitochondrial     151   5e-41   
gb|ACR36673.1|  unknown                                                 151   5e-41   
gb|KDR74310.1|  hypothetical protein GALMADRAFT_250114                  151   5e-41   
gb|KCW59621.1|  hypothetical protein EUGRSUZ_H02358                     150   5e-41   
gb|KHN46221.1|  Malate dehydrogenase, glyoxysomal                       152   5e-41   
gb|KFV53476.1|  hypothetical protein N328_01403                         150   5e-41   
ref|XP_006664772.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    152   5e-41   
ref|XP_010941983.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    151   5e-41   
ref|XP_005502018.1|  PREDICTED: malate dehydrogenase, mitochondrial     151   5e-41   
gb|KFQ40408.1|  hypothetical protein N332_03389                         150   5e-41   
ref|XP_004963290.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    152   5e-41   
ref|XP_004963291.1|  PREDICTED: malate dehydrogenase, glyoxysomal...    152   6e-41   
ref|XP_010126913.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    152   6e-41   
ref|XP_002491128.1|  Mitochondrial malate dehydrogenase, catalyze...    151   6e-41   
ref|XP_005425510.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    151   6e-41   
gb|KDO67932.1|  hypothetical protein CISIN_1g016424mg                   149   6e-41   
gb|EPS68273.1|  malate dehydrogenase                                    150   6e-41   
ref|XP_002531998.1|  malate dehydrogenase, putative                     151   6e-41   
gb|KIM21393.1|  hypothetical protein M408DRAFT_333473                   151   6e-41   
gb|KFV22894.1|  hypothetical protein N340_07230                         150   6e-41   
gb|KGN63672.1|  hypothetical protein Csa_1G009760                       151   6e-41   
ref|XP_001366592.1|  PREDICTED: malate dehydrogenase, mitochondrial     151   7e-41   
ref|XP_009810230.1|  PREDICTED: malate dehydrogenase, mitochondrial     150   7e-41   
ref|XP_010077736.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    151   7e-41   
ref|XP_010190180.1|  PREDICTED: LOW QUALITY PROTEIN: malate dehyd...    151   7e-41   
gb|KIK42964.1|  hypothetical protein CY34DRAFT_804374                   151   7e-41   
gb|KFP21136.1|  hypothetical protein Z169_00590                         150   7e-41   
gb|ACU20055.1|  unknown                                                 151   7e-41   
ref|NP_001086452.1|  malate dehydrogenase 2, NAD (mitochondrial)        151   7e-41   
gb|EOB07860.1|  Malate dehydrogenase, mitochondrial                     150   7e-41   
gb|EPS70103.1|  malate dehydrogenase, glyoxysomal                       151   7e-41   



>emb|CAD33240.1| putative mitochondrial NAD-dependent malate dehydrogenase [Solanum 
tuberosum]
Length=346

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 127/136 (93%), Gaps = 1/136 (1%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDG-SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            MR+SML+S+++ S + G S V+RRGFASGSAPERKVA+LGAAGGIGQPLSLLMKLNPLVS
Sbjct  1    MRTSMLKSIVRRSSTAGESYVSRRGFASGSAPERKVAVLGAAGGIGQPLSLLMKLNPLVS  60

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             LSL+DIAGTPGVAADVSHINTRSEVVGF+G+E LGKALEGAD+VIIPAGVPRKPGMTRD
Sbjct  61   SLSLYDIAGTPGVAADVSHINTRSEVVGFAGEEQLGKALEGADIVIIPAGVPRKPGMTRD  120

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVKSL  A
Sbjct  121  DLFNINAGIVKSLCTA  136



>ref|NP_001234001.1| mitochondrial malate dehydrogenase [Solanum lycopersicum]
 gb|AAU29198.1| mitochondrial malate dehydrogenase [Solanum lycopersicum]
Length=346

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 126/136 (93%), Gaps = 1/136 (1%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDG-SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            MR+SML+S+++ S + G S V+RRGFASGSAPERKVA+LGAAGGIGQPLSLLMKLNPLVS
Sbjct  1    MRTSMLKSIVRRSSTAGASYVSRRGFASGSAPERKVAVLGAAGGIGQPLSLLMKLNPLVS  60

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             LSL+DIAGTPGVAADVSHINTRSEV GF+G+E LG+ALEGADVVIIPAGVPRKPGMTRD
Sbjct  61   SLSLYDIAGTPGVAADVSHINTRSEVAGFAGEEQLGQALEGADVVIIPAGVPRKPGMTRD  120

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVKSL  A
Sbjct  121  DLFNINAGIVKSLCTA  136



>ref|NP_001275034.1| malate dehydrogenase, mitochondrial-like [Solanum tuberosum]
 emb|CAD33244.1| putative mitochondrial NAD-dependent malate dehydrogenase [Solanum 
tuberosum]
Length=346

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 126/136 (93%), Gaps = 1/136 (1%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDG-SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            MR+SML+S+++ S + G S V+RRGFASGSAPERKVA+LGAAGGIGQPLSL MKLNPLVS
Sbjct  1    MRTSMLKSIVRRSSTAGASYVSRRGFASGSAPERKVAVLGAAGGIGQPLSLPMKLNPLVS  60

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             LSL+DIAGTPGVAADVSHINTRSEVVGF+G+E LGKALEGAD+VIIPAGVPRKPGMTRD
Sbjct  61   SLSLYDIAGTPGVAADVSHINTRSEVVGFAGEEQLGKALEGADIVIIPAGVPRKPGMTRD  120

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVKSL  A
Sbjct  121  DLFNINAGIVKSLCTA  136



>emb|CAD33241.1| putative mitochondrial NAD-dependent malate dehydrogenase [Solanum 
tuberosum]
 emb|CAD33242.1| putative mitochondrial NAD-dependent malate dehydrogenase [Solanum 
tuberosum]
Length=342

 Score =   224 bits (571),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 123/132 (93%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLLKNSVSDG-SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            ML+S+++ S + G S V+RRGFASGSAPERKVA+LGAAGGIGQPLSLLMKLNPLVS LSL
Sbjct  1    MLKSIVRRSSTAGASYVSRRGFASGSAPERKVAVLGAAGGIGQPLSLLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIAGTPGVAADVSHINTRSEVVGF+G+E LGKALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIAGTPGVAADVSHINTRSEVVGFAGEEQLGKALEGADIVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVKSL  A
Sbjct  121  INAGIVKSLCTA  132



>ref|NP_001274946.1| malate dehydrogenase, mitochondrial-like [Solanum tuberosum]
 emb|CAD33243.1| putative mitochondrial NAD-dependent malate dehydrogenase [Solanum 
tuberosum]
Length=344

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 3/135 (2%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MR+SMLR+L + + + G+R   RGFAS SAP+RKVAILGAAGGIGQPLSLLMKLNPLVS 
Sbjct  1    MRTSMLRTLARRTSTAGTR---RGFASESAPDRKVAILGAAGGIGQPLSLLMKLNPLVSR  57

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            L+L+DIAGTPGVAADVSHINTRSE++G++G+E LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct  58   LALYDIAGTPGVAADVSHINTRSEILGYAGEEQLGKALEGADVVIIPAGVPRKPGMTRDD  117

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVKSL  A
Sbjct  118  LFNINAGIVKSLCTA  132



>ref|XP_009611177.1| PREDICTED: malate dehydrogenase 2, mitochondrial [Nicotiana tomentosiformis]
Length=341

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            MLRS+ + + + G+ + RRGFAS SAP+RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+
Sbjct  1    MLRSIARKTSTTGAYLTRRGFASESAPDRKVAILGAAGGIGQPLSLLMKLNPLVSQLSLY  60

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DIAGTPGVAADVSHINTRS+V GF+GDE LG+ALEGADVVIIPAGVPRKPGMTRDDLFNI
Sbjct  61   DIAGTPGVAADVSHINTRSQVSGFAGDEQLGQALEGADVVIIPAGVPRKPGMTRDDLFNI  120

Query  455  NAGIVKSLSAA  487
            NAGIVKSL  A
Sbjct  121  NAGIVKSLCTA  131



>ref|XP_006358950.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Solanum 
tuberosum]
Length=341

 Score =   219 bits (558),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 122/135 (90%), Gaps = 3/135 (2%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MR+SMLR+L + + + G R   RGFAS SAP+RKVAILGAAGGIGQPLSLLMKLNPLVS 
Sbjct  1    MRTSMLRTLARRTSTAGRR---RGFASESAPDRKVAILGAAGGIGQPLSLLMKLNPLVSR  57

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            L+L+DIAGTPGVAADVSHINTRSE++G++G+E LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct  58   LALYDIAGTPGVAADVSHINTRSEILGYAGEEQLGKALEGADVVIIPAGVPRKPGMTRDD  117

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVKSL  A
Sbjct  118  LFNINAGIVKSLCTA  132



>emb|CDP05985.1| unnamed protein product [Coffea canephora]
Length=351

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 6/141 (4%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSD------GSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKL  244
            MR++MLRS+LK S S+       +   RRGFAS SAPERKVA+LGAAGGIGQPL+LLMKL
Sbjct  1    MRTAMLRSVLKRSSSNLMNSTTSAYGVRRGFASESAPERKVAVLGAAGGIGQPLALLMKL  60

Query  245  NPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKP  424
            NPLVS L+L+DIAGTPGVAADVSHINTRSEVVGF G+E LG+ALEG+DVVIIPAGVPRKP
Sbjct  61   NPLVSKLALYDIAGTPGVAADVSHINTRSEVVGFMGEEQLGQALEGSDVVIIPAGVPRKP  120

Query  425  GMTRDDLFNINAGIVKSLSAA  487
            GMTRDDLFNINAGIVKSL  A
Sbjct  121  GMTRDDLFNINAGIVKSLCTA  141



>ref|XP_006592546.1| PREDICTED: malate dehydrogenase, mitochondrial [Glycine max]
 gb|AAD56659.1| malate dehydrogenase [Glycine max]
Length=345

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            M+ SMLRSL   +    S + RRG+AS   PERKVA+LGAAGGIGQPLSLLMKLNPLVS 
Sbjct  2    MKPSMLRSLHSAATRGASHLFRRGYASEPVPERKVAVLGAAGGIGQPLSLLMKLNPLVSS  61

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            LSL+DIAGTPGVAAD+SHINTRSEVVG+ GDE LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct  62   LSLYDIAGTPGVAADISHINTRSEVVGYQGDEELGKALEGADVVIIPAGVPRKPGMTRDD  121

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVK+L  A
Sbjct  122  LFNINAGIVKTLCTA  136



>ref|XP_009593526.1| PREDICTED: malate dehydrogenase, mitochondrial [Nicotiana tomentosiformis]
Length=346

 Score =   216 bits (551),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = +2

Query  83   MRSSMLRSLLK-NSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            M  SMLRS+++  S S  SR+ RR FAS SAPERKVAILGAAGGIGQPLSLLMKLNPLVS
Sbjct  1    MTLSMLRSVVRRTSTSGASRLTRRQFASESAPERKVAILGAAGGIGQPLSLLMKLNPLVS  60

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             LSL+DIAGTPGVAADVSHINTRS+V GF+G++ LG+ALEG+DVVIIPAGVPRKPGMTRD
Sbjct  61   SLSLYDIAGTPGVAADVSHINTRSQVAGFAGEDQLGQALEGSDVVIIPAGVPRKPGMTRD  120

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVKSL  A
Sbjct  121  DLFNINAGIVKSLCTA  136



>ref|XP_007133189.1| hypothetical protein PHAVU_011G159000g [Phaseolus vulgaris]
 gb|ESW05183.1| hypothetical protein PHAVU_011G159000g [Phaseolus vulgaris]
Length=345

 Score =   216 bits (550),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            M+ SMLRSL   +    S ++RRG+AS   PERKVA+LGAAGGIGQPLSLLMKLNPLVS 
Sbjct  2    MKPSMLRSLHSAATRGASNISRRGYASEPGPERKVAVLGAAGGIGQPLSLLMKLNPLVSS  61

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            LSL+DIAGTPGVAADVSHINTRS+VVG+ G+E LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct  62   LSLYDIAGTPGVAADVSHINTRSKVVGYQGEEELGKALEGADVVIIPAGVPRKPGMTRDD  121

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVK+L  A
Sbjct  122  LFNINAGIVKALCTA  136



>gb|AIE54296.1| mitochondrial malate dehydrogenase [Nicotiana tabacum]
Length=341

 Score =   216 bits (550),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            MLRS+ + + + G+ + RRGFAS SAP+RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+
Sbjct  1    MLRSIARRTSTTGAYLTRRGFASESAPDRKVAILGAAGGIGQPLSLLMKLNPLVSQLSLY  60

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DIAGTPGVAADVSHINTRS+V GF+GDE L +ALEGADVVIIPAGVPRKPGMTRDDLFNI
Sbjct  61   DIAGTPGVAADVSHINTRSQVSGFAGDEQLRQALEGADVVIIPAGVPRKPGMTRDDLFNI  120

Query  455  NAGIVKSLSAA  487
            NAGIVKSL  A
Sbjct  121  NAGIVKSLCTA  131



>ref|XP_009760199.1| PREDICTED: malate dehydrogenase 2, mitochondrial [Nicotiana sylvestris]
Length=341

 Score =   216 bits (550),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            MLRS+ + + + G+ + RRGFAS SAP+RKVAILGAAGGIGQPLSLLMKLNPLVS LSL+
Sbjct  1    MLRSIARRTSTTGAYLTRRGFASESAPDRKVAILGAAGGIGQPLSLLMKLNPLVSQLSLY  60

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DIAGTPGVAADVSHINTRS+V GF+GDE L +ALEGADVVIIPAGVPRKPGMTRDDLFNI
Sbjct  61   DIAGTPGVAADVSHINTRSQVSGFAGDEQLRQALEGADVVIIPAGVPRKPGMTRDDLFNI  120

Query  455  NAGIVKSLSAA  487
            NAGIVKSL  A
Sbjct  121  NAGIVKSLCTA  131



>ref|XP_010313914.1| PREDICTED: malate dehydrogenase, mitochondrial [Solanum lycopersicum]
Length=342

 Score =   215 bits (547),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 122/135 (90%), Gaps = 2/135 (1%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MR+S++R L + + + G  + RRGFAS SAP+RKVAILGAAGGIGQPLSLLMKLNPLVS 
Sbjct  1    MRTSVVRLLARRTSTAG--LTRRGFASESAPDRKVAILGAAGGIGQPLSLLMKLNPLVSR  58

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            L+L+DIAGTPGVAADVSHINTRSE++G++G+E LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct  59   LALYDIAGTPGVAADVSHINTRSEILGYAGEEQLGKALEGADVVIIPAGVPRKPGMTRDD  118

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVKSL  A
Sbjct  119  LFNINAGIVKSLCTA  133



>ref|XP_011006727.1| PREDICTED: malate dehydrogenase, mitochondrial [Populus euphratica]
 ref|XP_011010080.1| PREDICTED: malate dehydrogenase, mitochondrial [Populus euphratica]
Length=344

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MR+SMLRS+   + S  S + RRG+AS + PERKVA+LGAAGGIGQPLSLLMKLNPLVS+
Sbjct  1    MRASMLRSIKSLTTSASSHILRRGYASEAVPERKVAVLGAAGGIGQPLSLLMKLNPLVSN  60

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            L+L+DIA TPGVAADVSHINTRSEVVG++ D  LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct  61   LALYDIANTPGVAADVSHINTRSEVVGYASDAELGKALEGADVVIIPAGVPRKPGMTRDD  120

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVK L  A
Sbjct  121  LFNINAGIVKGLCEA  135



>ref|NP_001276183.1| malate dehydrogenase, mitochondrial-like [Glycine max]
 gb|ACU17786.1| unknown [Glycine max]
Length=345

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            M+ SMLRSL   +    S ++RRG+AS   PERKVA+LGAAGGIGQPLSLLMKLNPLVS 
Sbjct  2    MKPSMLRSLHSAATRGASHLSRRGYASEPVPERKVAVLGAAGGIGQPLSLLMKLNPLVSS  61

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            LSL+DIAGTPGVAADVSHINT SEVVG+ GDE LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct  62   LSLYDIAGTPGVAADVSHINTGSEVVGYQGDEELGKALEGADVVIIPAGVPRKPGMTRDD  121

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIV++L  A
Sbjct  122  LFNINAGIVETLCTA  136



>ref|XP_004510039.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Cicer arietinum]
Length=345

 Score =   213 bits (543),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MR SMLRS+        S++ RRG+A+   PERKVAILGAAGGIGQPLSLLMKLNPLVS 
Sbjct  1    MRPSMLRSVYSAVSRSSSKLVRRGYATEPVPERKVAILGAAGGIGQPLSLLMKLNPLVSS  60

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            LSL+DI GTPGVAADVSHIN+RSEV G+ G+E LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct  61   LSLYDIGGTPGVAADVSHINSRSEVAGYQGEEELGKALEGADVVIIPAGVPRKPGMTRDD  120

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVKSL  A
Sbjct  121  LFNINAGIVKSLCTA  135



>ref|XP_002300420.2| Malate dehydrogenase family protein [Populus trichocarpa]
 gb|EEE85225.2| Malate dehydrogenase family protein [Populus trichocarpa]
Length=344

 Score =   211 bits (538),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MR+SMLRS+   + S  S V RRG+AS + PERKVA+LGAAGGIGQ LSLLMKLNPLVS+
Sbjct  1    MRNSMLRSIKSLTTSPSSHVLRRGYASEAVPERKVAVLGAAGGIGQSLSLLMKLNPLVSN  60

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            L+L+DIA TPGVAADVSHINTRSEVVG++ D  LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct  61   LALYDIANTPGVAADVSHINTRSEVVGYASDAELGKALEGADVVIIPAGVPRKPGMTRDD  120

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVK L  A
Sbjct  121  LFNINAGIVKGLCEA  135



>ref|XP_009803762.1| PREDICTED: malate dehydrogenase, mitochondrial [Nicotiana sylvestris]
Length=346

 Score =   211 bits (536),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = +2

Query  83   MRSSMLRSLLK-NSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            M  SMLRS+++  S S  S + RR F+S +APERKVAILGAAGGIGQPLSLLMKLNPLVS
Sbjct  1    MTLSMLRSVVRRTSTSGASGLTRRQFSSEAAPERKVAILGAAGGIGQPLSLLMKLNPLVS  60

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             LSL+DIAGTPGVAADVSHINTRS+V GF+G++ LG+ALEG+DVVIIPAGVPRKPGMTRD
Sbjct  61   TLSLYDIAGTPGVAADVSHINTRSQVAGFAGEDQLGQALEGSDVVIIPAGVPRKPGMTRD  120

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVKSL  A
Sbjct  121  DLFNINAGIVKSLCTA  136



>gb|AIY53988.1| malate dehydrogenase [Stylosanthes guianensis]
Length=345

 Score =   210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 121/136 (89%), Gaps = 2/136 (1%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGS-RVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            ++ SMLRSL  ++VS GS  +ARRG++S S P+RKV +LGAAGGIGQPLSLLMKLNPLVS
Sbjct  2    IKPSMLRSL-HSAVSRGSSHLARRGYSSESTPDRKVVVLGAAGGIGQPLSLLMKLNPLVS  60

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             LSL+DIAGTPGVAADVSH+NTRSEVVG+ G+  LGKALEGADVVIIPAGVPRKPGMTRD
Sbjct  61   SLSLYDIAGTPGVAADVSHVNTRSEVVGYQGEGELGKALEGADVVIIPAGVPRKPGMTRD  120

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVKSL  A
Sbjct  121  DLFNINAGIVKSLCTA  136



>ref|XP_010527511.1| PREDICTED: malate dehydrogenase 1, mitochondrial-like, partial 
[Tarenaya hassleriana]
Length=220

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSR-VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L  S S   + + RRG +S S PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSMLVRSSSSAKQALLRRGISSESVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADVSHINTRS+VVG+ GD+NLGKALEGAD+V+IPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVSHINTRSQVVGYMGDDNLGKALEGADLVVIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVKSL  A
Sbjct  121  INAGIVKSLCTA  132



>gb|AFK45866.1| unknown [Lotus japonicus]
Length=341

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 118/135 (87%), Gaps = 4/135 (3%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            M+ SMLRS    +VS  S+++RRG+A+   PERKV +LGAAGGIGQPLSLLMKLNPLVS 
Sbjct  2    MKPSMLRS----AVSRCSQLSRRGYATNPVPERKVVVLGAAGGIGQPLSLLMKLNPLVSS  57

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            LSL+DIAGTPGVAA VSHINTRSEVVG+ G+E LGKALEGAD+VIIPAGVPRKPGMTRDD
Sbjct  58   LSLYDIAGTPGVAAAVSHINTRSEVVGYQGEEQLGKALEGADIVIIPAGVPRKPGMTRDD  117

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVK L +A
Sbjct  118  LFNINAGIVKGLCSA  132



>sp|P83373.1|MDHM_FRAAN RecName: Full=Malate dehydrogenase, mitochondrial; Flags: Precursor 
[Fragaria x ananassa]
Length=339

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 121/135 (90%), Gaps = 6/135 (4%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MR SM  SL+++     SRVARRG++S S P+RKVA+LGAAGGIGQPL+LLMKLNPLVS 
Sbjct  1    MRPSM--SLIRSV----SRVARRGYSSESVPQRKVAVLGAAGGIGQPLALLMKLNPLVSQ  54

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            LSL+DIAGTPGVAADVSHINTRSEV G++G+E LG+ALEG DVVIIPAGVPRKPGMTRDD
Sbjct  55   LSLYDIAGTPGVAADVSHINTRSEVKGYAGEEQLGEALEGCDVVIIPAGVPRKPGMTRDD  114

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIV+SL+AA
Sbjct  115  LFNINAGIVRSLTAA  129



>ref|XP_004294095.1| PREDICTED: malate dehydrogenase, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=339

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 121/135 (90%), Gaps = 6/135 (4%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MR SM  SL+++     SRVARRG++S S P+RKVA+LGAAGGIGQPL+LLMKLNPLVS 
Sbjct  1    MRPSM--SLIRSV----SRVARRGYSSESGPQRKVAVLGAAGGIGQPLALLMKLNPLVSQ  54

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            LSL+DIAGTPGVAADVSHINTRSEV G++G+E LG+ALEG DVVIIPAGVPRKPGMTRDD
Sbjct  55   LSLYDIAGTPGVAADVSHINTRSEVKGYAGEEQLGEALEGCDVVIIPAGVPRKPGMTRDD  114

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIV+SL+AA
Sbjct  115  LFNINAGIVRSLTAA  129



>gb|KEH19548.1| malate dehydrogenase [Medicago truncatula]
Length=251

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 121/135 (90%), Gaps = 3/135 (2%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MR S+LRS+ +++VS    + RRG+A+   PERKVAILGAAGGIGQPLSLLMKLNPLVS 
Sbjct  2    MRPSILRSV-QSAVS--RSITRRGYATEPVPERKVAILGAAGGIGQPLSLLMKLNPLVST  58

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            LSL+DIAGTPGVAADVSHIN+RS+V G++G++ LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct  59   LSLYDIAGTPGVAADVSHINSRSQVTGYAGEDELGKALEGADVVIIPAGVPRKPGMTRDD  118

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVKSL+ A
Sbjct  119  LFNINAGIVKSLATA  133



>ref|XP_010542305.1| PREDICTED: malate dehydrogenase 1, mitochondrial [Tarenaya hassleriana]
Length=342

 Score =   209 bits (531),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSR-VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L  S S   + + RRGF+S S PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSMLVRSSSSAKQALLRRGFSSESVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADVSHINTRS+VVG+ GD+NLGKALEGAD+V+IPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVSHINTRSQVVGYMGDDNLGKALEGADLVVIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVKSL  A
Sbjct  121  INAGIVKSLCTA  132



>ref|XP_010108267.1| Malate dehydrogenase 1 [Morus notabilis]
 gb|EXC18507.1| Malate dehydrogenase 1 [Morus notabilis]
Length=349

 Score =   209 bits (531),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 123/139 (88%), Gaps = 4/139 (3%)
 Frame = +2

Query  83   MRSSMLRSL----LKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNP  250
            MRSSMLRS+     ++S + G+++ RRG++  S PERKVA+LGAAGGIGQPL+LLMKLNP
Sbjct  1    MRSSMLRSVKSAIARSSSAAGAQIQRRGYSVHSGPERKVAVLGAAGGIGQPLALLMKLNP  60

Query  251  LVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGM  430
            LVSHLSL+DIA TPGVAADVSHINTRSEV G++G+EN+ +ALEGADVVIIPAGVPRKPGM
Sbjct  61   LVSHLSLYDIAATPGVAADVSHINTRSEVKGYAGEENIREALEGADVVIIPAGVPRKPGM  120

Query  431  TRDDLFNINAGIVKSLSAA  487
            TRDDLFNINAGIVKSL  A
Sbjct  121  TRDDLFNINAGIVKSLCTA  139



>gb|AAB99755.1| malate dehydrogenase precursor [Medicago sativa]
Length=343

 Score =   208 bits (529),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 121/135 (90%), Gaps = 3/135 (2%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MR S+LRS+ K++VS    + RRG+A+   PERKVAILGAAGGIGQPLSLLMKLNPLVS 
Sbjct  2    MRPSILRSV-KSAVS--RSITRRGYATEPVPERKVAILGAAGGIGQPLSLLMKLNPLVST  58

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            LSL+DIAGTPGVAADVSHIN+RS+V G++G++ LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct  59   LSLYDIAGTPGVAADVSHINSRSQVTGYAGEDELGKALEGADVVIIPAGVPRKPGMTRDD  118

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVKSL+ A
Sbjct  119  LFNINAGIVKSLATA  133



>ref|XP_006305270.1| hypothetical protein CARUB_v10009646mg [Capsella rubella]
 gb|EOA38168.1| hypothetical protein CARUB_v10009646mg [Capsella rubella]
Length=341

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLL-KNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L ++S S    V RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSMLVRSSASAKQAVIRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRSEVVG+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSEVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L  A
Sbjct  121  INAGIVKNLCTA  132



>gb|AAF69549.1|AC008007_24 F12M16.14 [Arabidopsis thaliana]
Length=352

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLL-KNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L ++S S    V RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSMLVRSSASAKQAVIRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRSEVVG+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSEVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L  A
Sbjct  121  INAGIVKNLCTA  132



>ref|XP_010279077.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Nelumbo 
nucifera]
Length=351

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 121/140 (86%), Gaps = 5/140 (4%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDG-----SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLN  247
            MR+SMLRS+ + ++  G     S + RR ++S SAPERKVA+LGAAGGIGQPL+LLMKLN
Sbjct  1    MRTSMLRSVAEAALRRGGGPSSSHLLRRCYSSESAPERKVAVLGAAGGIGQPLALLMKLN  60

Query  248  PLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPG  427
            PLVS L+L+DIAGTPGVAADVSHINTRSEV G+ G++ LG+ALEG+D+VIIPAGVPRKPG
Sbjct  61   PLVSKLALYDIAGTPGVAADVSHINTRSEVAGYMGEDQLGQALEGSDIVIIPAGVPRKPG  120

Query  428  MTRDDLFNINAGIVKSLSAA  487
            MTRDDLFNINAGIVKSL  A
Sbjct  121  MTRDDLFNINAGIVKSLCTA  140



>ref|NP_564625.1| malate dehydrogenase 1 [Arabidopsis thaliana]
 sp|Q9ZP06.1|MDHM1_ARATH RecName: Full=Malate dehydrogenase 1, mitochondrial; AltName: 
Full=mNAD-MDH 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG40021.1|AF324670_1 At1g53240 [Arabidopsis thaliana]
 gb|AAK00366.1|AF339684_1 putative mitochondrial NAD-dependent malate dehydrogenase [Arabidopsis 
thaliana]
 emb|CAA10320.1| mitochondrial NAD-dependent malate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL32658.1| similar to mitochondrial NAD-dependent malate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM91183.1| similar to mitochondrial NAD-dependent malate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE32910.1| malate dehydrogenase 1 [Arabidopsis thaliana]
Length=341

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLL-KNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L ++S S    V RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSMLVRSSASAKQAVIRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRSEVVG+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSEVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L  A
Sbjct  121  INAGIVKNLCTA  132



>ref|XP_002894430.1| mitochondrial malate dehydrogenase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70689.1| mitochondrial malate dehydrogenase [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSR-VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L  S S   + V RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSMLVRSSSSAKQAVIRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRSEVVG+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSEVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L  A
Sbjct  121  INAGIVKNLCTA  132



>ref|XP_009335198.1| PREDICTED: malate dehydrogenase, mitochondrial [Pyrus x bretschneideri]
Length=339

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  137  RVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSH  316
            RVARR ++S S PERKVA+LGAAGGIGQPL+LLMKLNPLVSHLSL+DIAGTPGVAADVSH
Sbjct  13   RVARRSYSSASVPERKVAVLGAAGGIGQPLALLMKLNPLVSHLSLYDIAGTPGVAADVSH  72

Query  317  INTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            INTRSEV G++G+E L +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L+ A
Sbjct  73   INTRSEVKGYAGEEQLAQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLTTA  129



>ref|XP_008367914.1| PREDICTED: malate dehydrogenase, mitochondrial [Malus domestica]
Length=339

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  137  RVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSH  316
            RVARR ++S S PERKVA+LGAAGGIGQPL+LLMKLNPLVSHLSL+DIAGTPGVAADVSH
Sbjct  13   RVARRSYSSASVPERKVAVLGAAGGIGQPLALLMKLNPLVSHLSLYDIAGTPGVAADVSH  72

Query  317  INTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            INTRSEV G++G+E L +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L+ A
Sbjct  73   INTRSEVKGYAGEEQLAQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLTTA  129



>ref|XP_009340262.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Pyrus x 
bretschneideri]
 gb|ADU20200.1| mitochondrial NAD-dependent malic acid dehydrogenase [Pyrus pyrifolia]
Length=339

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  137  RVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSH  316
            RVARR ++S S PERKVA+LGAAGGIGQPL+LLMKLNPLVSHLSL+DIAGTPGVAADVSH
Sbjct  13   RVARRSYSSASVPERKVAVLGAAGGIGQPLALLMKLNPLVSHLSLYDIAGTPGVAADVSH  72

Query  317  INTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            INTRSEV G++G+E L +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L+ A
Sbjct  73   INTRSEVKGYAGEEQLAQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLTTA  129



>gb|KEH19547.1| malate dehydrogenase [Medicago truncatula]
Length=343

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 121/135 (90%), Gaps = 3/135 (2%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MR S+LRS+ +++VS    + RRG+A+   PERKVAILGAAGGIGQPLSLLMKLNPLVS 
Sbjct  2    MRPSILRSV-QSAVS--RSITRRGYATEPVPERKVAILGAAGGIGQPLSLLMKLNPLVST  58

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            LSL+DIAGTPGVAADVSHIN+RS+V G++G++ LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct  59   LSLYDIAGTPGVAADVSHINSRSQVTGYAGEDELGKALEGADVVIIPAGVPRKPGMTRDD  118

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVKSL+ A
Sbjct  119  LFNINAGIVKSLATA  133



>gb|AAM64855.1| mitochondrial NAD-dependent malate dehydrogenase [Arabidopsis 
thaliana]
Length=341

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVA-RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L  S +   + A RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSMLVRSSASAKQAAIRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRSEVVG+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSEVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L  A
Sbjct  121  INAGIVKNLCTA  132



>ref|XP_011044945.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Populus 
euphratica]
Length=340

 Score =   206 bits (524),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            MLRS+   + S  S + RRG+AS +AP+RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+
Sbjct  1    MLRSIKSLTTSPSSHILRRGYASEAAPDRKVAVLGAAGGIGQPLALLMKLNPLVSSLALY  60

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DIA TPGVAADVSHINTRSEV G+SG+  LGKALEGADVVIIPAGVPRKPGMTRDDLFNI
Sbjct  61   DIANTPGVAADVSHINTRSEVSGYSGEAELGKALEGADVVIIPAGVPRKPGMTRDDLFNI  120

Query  455  NAGIVKSLSAA  487
            NAGIVK L  A
Sbjct  121  NAGIVKGLCQA  131



>gb|KFK35713.1| hypothetical protein AALP_AA4G027400 [Arabis alpina]
Length=341

 Score =   206 bits (523),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSR-VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L  S S   + + RR F+S S P+RKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSILVRSTSSAKQSLLRRNFSSESVPQRKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRSEVVG+ GDENL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSEVVGYMGDENLAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L AA
Sbjct  121  INAGIVKNLCAA  132



>ref|XP_010479877.1| PREDICTED: malate dehydrogenase 1, mitochondrial [Camelina sativa]
Length=341

 Score =   206 bits (523),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLL-KNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L ++S S    V RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSMLVRSSASAKQAVTRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRS+V G+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSDVAGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L  A
Sbjct  121  INAGIVKNLCTA  132



>ref|XP_009106989.1| PREDICTED: malate dehydrogenase 1, mitochondrial [Brassica rapa]
Length=341

 Score =   206 bits (523),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRS-LLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS L+++S S    + RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSALVRSSASAKQSLLRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRS+VVG+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSQVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L +A
Sbjct  121  INAGIVKNLCSA  132



>ref|XP_010277741.1| PREDICTED: malate dehydrogenase, mitochondrial [Nelumbo nucifera]
Length=350

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 121/140 (86%), Gaps = 5/140 (4%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSD-----GSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLN  247
            MR+S+LRS+ + ++ +      S + RR ++S SAPERKVAILGAAGGIGQPL+LLMKLN
Sbjct  1    MRTSVLRSVAEAALRNRSSSSSSHLLRRCYSSESAPERKVAILGAAGGIGQPLALLMKLN  60

Query  248  PLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPG  427
            PLVS LSL+DIAGTPGVAADVSHINTRSEV GF G++ LG+ALEG+D+VIIPAGVPRKPG
Sbjct  61   PLVSKLSLYDIAGTPGVAADVSHINTRSEVAGFMGEDQLGQALEGSDIVIIPAGVPRKPG  120

Query  428  MTRDDLFNINAGIVKSLSAA  487
            MTRDDLFNINAGIVKSL  A
Sbjct  121  MTRDDLFNINAGIVKSLCTA  140



>ref|XP_008226502.1| PREDICTED: malate dehydrogenase, mitochondrial [Prunus mume]
Length=339

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 118/135 (87%), Gaps = 6/135 (4%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MR SM  SL+++      RV RR ++S + PERKVA+LGAAGGIGQPLSLLMKLNPLVSH
Sbjct  1    MRPSM--SLVRSV----QRVTRRSYSSEAVPERKVAVLGAAGGIGQPLSLLMKLNPLVSH  54

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            LSL+DIAGTPGVAADVSHINTRSEV G++G++ L +ALEGADVVIIPAGVPRKPGMTRDD
Sbjct  55   LSLYDIAGTPGVAADVSHINTRSEVKGYAGEDQLAQALEGADVVIIPAGVPRKPGMTRDD  114

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVK L+AA
Sbjct  115  LFNINAGIVKGLTAA  129



>ref|XP_010462202.1| PREDICTED: malate dehydrogenase 1, mitochondrial-like [Camelina 
sativa]
Length=341

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLL-KNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L ++S S    V RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSMLVRSSASAKQAVNRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRS+V G+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSDVTGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L  A
Sbjct  121  INAGIVKNLCTA  132



>ref|XP_010500961.1| PREDICTED: malate dehydrogenase 1, mitochondrial-like [Camelina 
sativa]
Length=341

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLL-KNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L ++S S    V RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSMLVRSSASAKQAVNRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRS+V G+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSDVAGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L  A
Sbjct  121  INAGIVKNLCTA  132



>sp|P46487.1|MDHM_EUCGU RecName: Full=Malate dehydrogenase, mitochondrial; Flags: Precursor 
[Eucalyptus gunnii]
 emb|CAA55383.1| mitochondrial malate dehydrogenase [Eucalyptus gunnii]
Length=347

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 115/137 (84%), Gaps = 2/137 (1%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSR--VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLV  256
            MR+SMLR +   S S   R  + RR + S S PERKVA+LGAAGGIGQPL+LLMKLNPLV
Sbjct  1    MRASMLRLIRSRSSSAAPRPHLLRRAYGSESVPERKVAVLGAAGGIGQPLALLMKLNPLV  60

Query  257  SHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTR  436
            S L+L+DIAGTPGVAADV HINTRSEV G+ G+E LG+ALEG+DVVIIPAGVPRKPGMTR
Sbjct  61   SQLALYDIAGTPGVAADVGHINTRSEVAGYVGEEQLGQALEGSDVVIIPAGVPRKPGMTR  120

Query  437  DDLFNINAGIVKSLSAA  487
            DDLFNINAGIVKSL  A
Sbjct  121  DDLFNINAGIVKSLCTA  137



>ref|XP_006852481.1| hypothetical protein AMTR_s00021p00133930 [Amborella trichopoda]
 gb|ERN13948.1| hypothetical protein AMTR_s00021p00133930 [Amborella trichopoda]
Length=344

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 120/135 (89%), Gaps = 2/135 (1%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MR+S++RS+ K ++  GS + RR F+S + PERKVA+LGAAGGIGQPL+LLMKLNPLVS 
Sbjct  1    MRASIIRSMEK-ALRRGSSM-RRSFSSETKPERKVAVLGAAGGIGQPLALLMKLNPLVSS  58

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            LSL+DIAGTPGVAADVSHINTRS+V GF+G++ LG+ALEG D+VIIPAGVPRKPGMTRDD
Sbjct  59   LSLYDIAGTPGVAADVSHINTRSQVAGFTGEDQLGQALEGCDLVIIPAGVPRKPGMTRDD  118

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVKSL  A
Sbjct  119  LFNINAGIVKSLCTA  133



>sp|Q43744.1|MDHM_BRANA RecName: Full=Malate dehydrogenase, mitochondrial; Flags: Precursor 
[Brassica napus]
 emb|CAA61621.1| malate dehydrogenase [Brassica napus]
Length=341

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRS-LLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS L+++S S    + RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSALVRSSASAKQSLLRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRS+VVG+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSQVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L +A
Sbjct  121  INAGIVKNLWSA  132



>ref|XP_007213810.1| hypothetical protein PRUPE_ppa008270mg [Prunus persica]
 gb|EMJ15009.1| hypothetical protein PRUPE_ppa008270mg [Prunus persica]
Length=339

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  134  SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVS  313
             RV RR ++S + PERKVA+LGAAGGIGQPLSLLMKLNPLVSHLSL+DIAGTPGVAADVS
Sbjct  12   QRVTRRSYSSEAVPERKVAVLGAAGGIGQPLSLLMKLNPLVSHLSLYDIAGTPGVAADVS  71

Query  314  HINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            HINTRSEV G++G++ L +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L+AA
Sbjct  72   HINTRSEVKGYAGEDQLAQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLTAA  129



>gb|AHN85657.1| mitochondrial malate dehydrogenase [Prunus persica]
Length=339

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  134  SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVS  313
             RV RR ++S + PERKVA+LGAAGGIGQPLSLLMKLNPLVSHLSL+DIAGTPGVAADVS
Sbjct  12   QRVTRRSYSSEAVPERKVAVLGAAGGIGQPLSLLMKLNPLVSHLSLYDIAGTPGVAADVS  71

Query  314  HINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            HINTRSEV G++G++ L +ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK L+AA
Sbjct  72   HINTRSEVKGYAGEDQLAQALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKGLTAA  129



>ref|XP_002316794.1| Malate dehydrogenase family protein [Populus trichocarpa]
 gb|ABK94163.1| unknown [Populus trichocarpa]
 gb|EEE97406.1| Malate dehydrogenase family protein [Populus trichocarpa]
Length=341

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            MLRS+   + S  S + RRG+AS + P+RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+
Sbjct  2    MLRSIKSLATSPSSHILRRGYASEAVPDRKVAVLGAAGGIGQPLALLMKLNPLVSSLALY  61

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DIA TPGVAADVSHINTRSEV G+SG+  LGKALEGADVVIIPAGVPRKPGMTRDDLFNI
Sbjct  62   DIANTPGVAADVSHINTRSEVSGYSGEAELGKALEGADVVIIPAGVPRKPGMTRDDLFNI  121

Query  455  NAGIVKSLSAA  487
            NAGIVK L  A
Sbjct  122  NAGIVKGLCQA  132



>emb|CDY02518.1| BnaA08g01250D [Brassica napus]
Length=341

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLL-KNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L ++S S    + RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSMLVRSSASAKQSLLRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            FDIA TPGVAADV HINTRS+VVG+ GD+ L KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   FDIANTPGVAADVGHINTRSQVVGYMGDDELAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L +A
Sbjct  121  INAGIVKNLCSA  132



>emb|CDY25868.1| BnaA05g14590D [Brassica napus]
Length=341

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLL-KNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L ++S S    + RR  +SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSMLVRSSSSAKQSLIRRNLSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRSEVVG+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSEVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L +A
Sbjct  121  INAGIVKNLCSA  132



>emb|CDY59402.1| BnaC03g78200D [Brassica napus]
Length=341

 Score =   203 bits (516),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRS-LLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS L+++S S    + RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSALVRSSASAKQSLLRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRS+VVG+ GD+ L KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSQVVGYMGDDELAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L +A
Sbjct  121  INAGIVKNLCSA  132



>ref|XP_006392810.1| hypothetical protein EUTSA_v10011552mg [Eutrema salsugineum]
 gb|ESQ30096.1| hypothetical protein EUTSA_v10011552mg [Eutrema salsugineum]
Length=313

 Score =   202 bits (513),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLL-KNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L ++S S    + RR F+S S PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  57   MFRSMLVRSSASAKQSLLRRSFSSESVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  116

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRSEV G+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  117  YDIANTPGVAADVGHINTRSEVAGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  176

Query  452  INAGIVKSLSAA  487
            INAGIVK+L  A
Sbjct  177  INAGIVKNLCTA  188



>emb|CDY55845.1| BnaCnng29330D [Brassica napus]
Length=341

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLL-KNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M R +L ++S S    + RR  +SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRCMLVRSSSSAKQSLLRRNLSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRSEVVG+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSEVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+L +A
Sbjct  121  INAGIVKNLCSA  132



>ref|XP_011098245.1| PREDICTED: malate dehydrogenase, mitochondrial [Sesamum indicum]
Length=347

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 117/137 (85%), Gaps = 2/137 (1%)
 Frame = +2

Query  83   MRSSMLRSLLK--NSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLV  256
            M+++ L SLL+  N+ S      RR F+S +APERKVAILGAAGGIGQPLSLLMKLNPLV
Sbjct  1    MKAASLTSLLRRSNAASTSPCFLRRAFSSEAAPERKVAILGAAGGIGQPLSLLMKLNPLV  60

Query  257  SHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTR  436
            S L+L+DIAGTPGVAADVSHINTRSEV G++ +E LG+ALEG+DVVIIPAGVPRKPGMTR
Sbjct  61   SRLALYDIAGTPGVAADVSHINTRSEVKGYAAEEQLGEALEGSDVVIIPAGVPRKPGMTR  120

Query  437  DDLFNINAGIVKSLSAA  487
            DDLF INAGIVKSL  A
Sbjct  121  DDLFKINAGIVKSLCEA  137



>gb|KDP32500.1| hypothetical protein JCGZ_14703 [Jatropha curcas]
Length=345

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 118/137 (86%), Gaps = 3/137 (2%)
 Frame = +2

Query  83   MRSSMLRSL--LKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLV  256
            MRSS+ RS+  L NS S  S + RRG+ S + P+RKVA+LGAAGGIGQPL+LLMKLNPLV
Sbjct  1    MRSSLFRSVKTLTNSTSS-SHLLRRGYGSEAVPDRKVAVLGAAGGIGQPLALLMKLNPLV  59

Query  257  SHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTR  436
            S+L+L+DIA TPGVAADVSHINTRSEV G+ G++ LG+ALEG+DVVIIPAGVPRKPGMTR
Sbjct  60   SNLALYDIANTPGVAADVSHINTRSEVKGYVGEDQLGQALEGSDVVIIPAGVPRKPGMTR  119

Query  437  DDLFNINAGIVKSLSAA  487
            DDLFNINAGIVK L  A
Sbjct  120  DDLFNINAGIVKGLCQA  136



>ref|XP_002524262.1| malate dehydrogenase, putative [Ricinus communis]
 gb|EEF38101.1| malate dehydrogenase, putative [Ricinus communis]
Length=345

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = +2

Query  83   MRSSMLRSLLK-NSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            MRSS+ RS+    S S  S + RRG+AS + P+RKVA+LGAAGGIGQPL+LLMKLNPLVS
Sbjct  1    MRSSLFRSVKALGSTSSSSHLLRRGYASEAVPDRKVAVLGAAGGIGQPLALLMKLNPLVS  60

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
            +L+L+DIA TPGVAADVSHINTRS+V G+ G++ LGKALEG+DVVIIPAGVPRKPGMTRD
Sbjct  61   NLALYDIANTPGVAADVSHINTRSDVKGYVGEDQLGKALEGSDVVIIPAGVPRKPGMTRD  120

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVK L  A
Sbjct  121  DLFNINAGIVKGLCEA  136



>ref|XP_007021667.1| Lactate/malate dehydrogenase family protein [Theobroma cacao]
 gb|EOY13192.1| Lactate/malate dehydrogenase family protein [Theobroma cacao]
Length=339

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            M RS+ +++   G  + RRG+A+ S P+RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+
Sbjct  1    MFRSVARSAA--GKHLLRRGYATDSVPDRKVAVLGAAGGIGQPLALLMKLNPLVSQLALY  58

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DIA TPGVAADVSHINTRSEV G+ G+E LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNI
Sbjct  59   DIANTPGVAADVSHINTRSEVAGYVGEEQLGQALEGSDVVIIPAGVPRKPGMTRDDLFNI  118

Query  455  NAGIVKSLSAA  487
            NAGIVK L AA
Sbjct  119  NAGIVKGLCAA  129



>ref|XP_010912571.1| PREDICTED: malate dehydrogenase, mitochondrial [Elaeis guineensis]
Length=354

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 119/145 (82%), Gaps = 4/145 (3%)
 Frame = +2

Query  53   TPFLRSLEIEMRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSL  232
            T  LRS+E  +R    R    +  +  S + RR F++ SAPERKVA+LGAAGGIGQPL+L
Sbjct  3    TFLLRSVESVLR----RGGAPSCPAPSSHILRRSFSAESAPERKVAVLGAAGGIGQPLAL  58

Query  233  LMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGV  412
            LMKLNPLVSHL+L+DIAGTPGVAADVSHINTR+EV G+  +E LG+ALEG+DVVIIPAGV
Sbjct  59   LMKLNPLVSHLALYDIAGTPGVAADVSHINTRAEVKGYMAEEQLGQALEGSDVVIIPAGV  118

Query  413  PRKPGMTRDDLFNINAGIVKSLSAA  487
            PRKPGMTRDDLFNINAGIVKSL  A
Sbjct  119  PRKPGMTRDDLFNINAGIVKSLCTA  143



>ref|XP_006392811.1| hypothetical protein EUTSA_v10011552mg [Eutrema salsugineum]
 gb|ESQ30097.1| hypothetical protein EUTSA_v10011552mg [Eutrema salsugineum]
Length=365

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLL-KNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L ++S S    + RR F+S S PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  57   MFRSMLVRSSASAKQSLLRRSFSSESVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  116

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRSEV G+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  117  YDIANTPGVAADVGHINTRSEVAGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  176

Query  452  INAGIVKSLSAA  487
            INAGIVK+L  A
Sbjct  177  INAGIVKNLCTA  188



>gb|KFK38851.1| hypothetical protein AALP_AA3G168500 [Arabis alpina]
Length=341

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSR-VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L  S S   + + RRGFAS S P RKV ILGAAGGIGQPLSLLMKLNPLVS LSL
Sbjct  1    MFRSILVRSSSPVKQALLRRGFASQSVPNRKVVILGAAGGIGQPLSLLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRSEV GF GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSEVAGFMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+LS A
Sbjct  121  INAGIVKNLSIA  132



>ref|XP_006392812.1| hypothetical protein EUTSA_v10011552mg [Eutrema salsugineum]
 gb|ESQ30098.1| hypothetical protein EUTSA_v10011552mg [Eutrema salsugineum]
Length=397

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLL-KNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L ++S S    + RR F+S S PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  57   MFRSMLVRSSASAKQSLLRRSFSSESVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  116

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRSEV G+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  117  YDIANTPGVAADVGHINTRSEVAGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN  176

Query  452  INAGIVKSLSAA  487
            INAGIVK+L  A
Sbjct  177  INAGIVKNLCTA  188



>ref|XP_010915605.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Elaeis guineensis]
Length=348

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 116/143 (81%), Gaps = 9/143 (6%)
 Frame = +2

Query  59   FLRSLEIEMRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLM  238
            FLRS+E  +R     S         S + RR F+  S+PERKVA+LGAAGGIGQPL+LLM
Sbjct  4    FLRSVETALRRGGAAS---------SHLPRRFFSVESSPERKVAVLGAAGGIGQPLALLM  54

Query  239  KLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPR  418
            KLNPLVS L+L+DIAGTPGVAADVSHINTR++V GF G+E LGKALEG+DVVIIPAGVPR
Sbjct  55   KLNPLVSSLALYDIAGTPGVAADVSHINTRAQVAGFMGEEQLGKALEGSDVVIIPAGVPR  114

Query  419  KPGMTRDDLFNINAGIVKSLSAA  487
            KPGMTRDDLFNINAGIVKSL  A
Sbjct  115  KPGMTRDDLFNINAGIVKSLCTA  137



>ref|NP_001078156.1| malate dehydrogenase 2 [Arabidopsis thaliana]
 gb|AEE75605.1| malate dehydrogenase 2 [Arabidopsis thaliana]
Length=316

 Score =   199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSR-VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS++  S S   + + RRGFAS S P+RKV ILGAAGGIGQPLSLLMKLNPLVS LSL
Sbjct  1    MFRSMIVRSASPVKQGLLRRGFASESVPDRKVVILGAAGGIGQPLSLLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRS+V G+ GD++LGKALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSQVSGYMGDDDLGKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+LS A
Sbjct  121  INAGIVKNLSIA  132



>ref|NP_001268095.1| malate dehydrogenase [Vitis vinifera]
 gb|AAF69802.1|AF195869_1 malate dehydrogenase [Vitis vinifera]
Length=352

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 115/140 (82%), Gaps = 5/140 (4%)
 Frame = +2

Query  83   MRSSMLRSLLK-----NSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLN  247
            M++S+ RS        +S S  S + RR +   S PERKVA+LGAAGGIGQPL+LLMKLN
Sbjct  1    MKASLFRSAETALRRVSSPSASSHLLRRSYCVESKPERKVAVLGAAGGIGQPLALLMKLN  60

Query  248  PLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPG  427
            PLVS LSL+DIAGTPGVAADVSHINTRS+V G+ GD+ LG+ALEGAD+VIIPAGVPRKPG
Sbjct  61   PLVSSLSLYDIAGTPGVAADVSHINTRSQVAGYMGDDQLGQALEGADLVIIPAGVPRKPG  120

Query  428  MTRDDLFNINAGIVKSLSAA  487
            MTRDDLFNINAGIVKSL  A
Sbjct  121  MTRDDLFNINAGIVKSLCTA  140



>ref|XP_002882909.1| hypothetical protein ARALYDRAFT_478929 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59168.1| hypothetical protein ARALYDRAFT_478929 [Arabidopsis lyrata subsp. 
lyrata]
Length=337

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRGFAS S P+RKV ILGAAGGIGQPLSLLMKLNPLVS LSL+DIA TPGVAADV HINT
Sbjct  15   RRGFASESVPDRKVVILGAAGGIGQPLSLLMKLNPLVSSLSLYDIANTPGVAADVGHINT  74

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            RS+V G+ GD+NLGKALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+LS A
Sbjct  75   RSQVSGYMGDDNLGKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLSIA  128



>ref|NP_188120.1| malate dehydrogenase 2 [Arabidopsis thaliana]
 sp|Q9LKA3.1|MDHM2_ARATH RecName: Full=Malate dehydrogenase 2, mitochondrial; AltName: 
Full=mNAD-MDH 2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA97065.1| NAD-dependent malate dehydrogenase [Arabidopsis thaliana]
 gb|AAK73950.1| AT3g15020/K15M2_16 [Arabidopsis thaliana]
 gb|AAM10404.1| AT3g15020/K15M2_16 [Arabidopsis thaliana]
 gb|AEE75604.1| malate dehydrogenase 2 [Arabidopsis thaliana]
Length=341

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSR-VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS++  S S   + + RRGFAS S P+RKV ILGAAGGIGQPLSLLMKLNPLVS LSL
Sbjct  1    MFRSMIVRSASPVKQGLLRRGFASESVPDRKVVILGAAGGIGQPLSLLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIA TPGVAADV HINTRS+V G+ GD++LGKALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct  61   YDIANTPGVAADVGHINTRSQVSGYMGDDDLGKALEGADLVIIPAGVPRKPGMTRDDLFN  120

Query  452  INAGIVKSLSAA  487
            INAGIVK+LS A
Sbjct  121  INAGIVKNLSIA  132



>ref|XP_008225206.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Prunus mume]
Length=340

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 112/132 (85%), Gaps = 8/132 (6%)
 Frame = +2

Query  92   SMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            SMLRS          R A R ++S S P+RKV ILGAAGGIGQPLSLLMKLNPLVS LSL
Sbjct  6    SMLRS--------APRTAVRSYSSSSQPQRKVTILGAAGGIGQPLSLLMKLNPLVSSLSL  57

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIAGTPGVAADVSH+NT ++V GF+G+E LGKALEG+D+VIIPAGVPRKPGMTRDDLFN
Sbjct  58   YDIAGTPGVAADVSHVNTLAQVSGFAGEEQLGKALEGSDLVIIPAGVPRKPGMTRDDLFN  117

Query  452  INAGIVKSLSAA  487
            INAGIVKSLSAA
Sbjct  118  INAGIVKSLSAA  129



>ref|XP_009386638.1| PREDICTED: malate dehydrogenase, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=348

 Score =   198 bits (504),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVA-RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            MRS ++RS+       G+  + RR F+S SAPERKVAILGAAGGIGQPL+LLMKLNPLVS
Sbjct  1    MRSFVVRSIESALRRRGAASSNRRLFSSDSAPERKVAILGAAGGIGQPLALLMKLNPLVS  60

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
            +L+L+DIAGTPGVAADV HINTR++V G+ G+E LGKALEG+DVVIIPAGVPRKPGMTRD
Sbjct  61   NLALYDIAGTPGVAADVGHINTRAQVAGYVGEEQLGKALEGSDVVIIPAGVPRKPGMTRD  120

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVKSL  A
Sbjct  121  DLFNINAGIVKSLCTA  136



>ref|XP_010060663.1| PREDICTED: malate dehydrogenase, mitochondrial [Eucalyptus grandis]
 gb|KCW67466.1| hypothetical protein EUGRSUZ_F01209 [Eucalyptus grandis]
Length=348

 Score =   198 bits (503),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 115/138 (83%), Gaps = 3/138 (2%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGS---RVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPL  253
            MR+++LRSL   +         + RRGF+S S PERKV +LGAAGGIGQPL+LLMK+NPL
Sbjct  1    MRTAVLRSLRSAAARSAPSSSHLLRRGFSSESVPERKVVVLGAAGGIGQPLALLMKINPL  60

Query  254  VSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMT  433
            VS LSL+DIAGTPGVAADV HIN+RSEV G+ G++ LG+ALEGAD+VIIPAGVPRKPGMT
Sbjct  61   VSKLSLYDIAGTPGVAADVGHINSRSEVAGYVGEDQLGQALEGADLVIIPAGVPRKPGMT  120

Query  434  RDDLFNINAGIVKSLSAA  487
            RDDLFNINAGIVKSL  A
Sbjct  121  RDDLFNINAGIVKSLCTA  138



>ref|XP_004961146.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Setaria 
italica]
Length=341

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +2

Query  98   LRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFD  277
            +RS L  S S+  R +RRG+AS + PERKVA+LGAAGGIGQPLSLLMKLNPLVS LSL+D
Sbjct  1    MRSALLKSTSELLRRSRRGYASSANPERKVAVLGAAGGIGQPLSLLMKLNPLVSSLSLYD  60

Query  278  IAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNIN  457
            IAGTPGVAADVSHIN+ + V GF GD+ LG+ALEG+DVVIIPAGVPRKPGMTRDDLFNIN
Sbjct  61   IAGTPGVAADVSHINSPAFVKGFMGDDQLGEALEGSDVVIIPAGVPRKPGMTRDDLFNIN  120

Query  458  AGIVKSLSAA  487
            AGIVK+L  A
Sbjct  121  AGIVKALCTA  130



>ref|XP_008451713.1| PREDICTED: malate dehydrogenase, mitochondrial [Cucumis melo]
Length=347

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +2

Query  134  SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVS  313
            +R+  R FA+ S PERKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIAGTPGVAADV 
Sbjct  20   NRLLTRTFATESVPERKVAVLGAAGGIGQPLALLMKLNPLVSKLALYDIAGTPGVAADVG  79

Query  314  HINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            H+NTRSEV G+ G+E LGKALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  A
Sbjct  80   HVNTRSEVTGYVGEEQLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTA  137



>gb|KJB61647.1| hypothetical protein B456_009G372600 [Gossypium raimondii]
Length=313

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 3/131 (2%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            M RS+ +++   G  + RRG+A+ + PERKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+
Sbjct  1    MFRSVARSAA--GKNLLRRGYAT-AVPERKVAVLGAAGGIGQPLALLMKLNPLVSQLALY  57

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DIA TPGVAADVSHIN+RSEV G+ G+E LGKALEG DVVIIPAGVPRKPGMTRDDLFNI
Sbjct  58   DIANTPGVAADVSHINSRSEVAGYVGEEQLGKALEGCDVVIIPAGVPRKPGMTRDDLFNI  117

Query  455  NAGIVKSLSAA  487
            NAGIVK L +A
Sbjct  118  NAGIVKGLCSA  128



>ref|XP_008805887.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Phoenix 
dactylifera]
Length=354

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 116/143 (81%), Gaps = 8/143 (6%)
 Frame = +2

Query  83   MRSSMLRSLLK--------NSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLM  238
            MR+ +LRS+          +S +  S + RR F   S PERKVAILGAAGGIGQPLSLLM
Sbjct  1    MRTFLLRSMASALRRGGAPSSPAPSSHILRRSFGVESGPERKVAILGAAGGIGQPLSLLM  60

Query  239  KLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPR  418
            KLNPLVS L+L+DIAGTPGVAADVSHINTR+EV G++ +E LG+ALEG+D+VIIPAGVPR
Sbjct  61   KLNPLVSRLALYDIAGTPGVAADVSHINTRAEVKGYAAEEQLGQALEGSDLVIIPAGVPR  120

Query  419  KPGMTRDDLFNINAGIVKSLSAA  487
            KPGMTRDDLFNINAGIVKSL  A
Sbjct  121  KPGMTRDDLFNINAGIVKSLCTA  143



>gb|KJB13224.1| hypothetical protein B456_002G063300 [Gossypium raimondii]
Length=300

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            M RS+ +++   G  + RRG+A+ S P+RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+
Sbjct  1    MFRSVARSAA--GKHLLRRGYATESVPDRKVAVLGAAGGIGQPLALLMKLNPLVSRLALY  58

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DIA TPGVAADVSH+NTRSEV G+ G++ L +ALEG DVVIIPAGVPRKPGMTRDDLFNI
Sbjct  59   DIANTPGVAADVSHVNTRSEVAGYVGEDQLKQALEGCDVVIIPAGVPRKPGMTRDDLFNI  118

Query  455  NAGIVKSLSAA  487
            NAGIVK L AA
Sbjct  119  NAGIVKGLCAA  129



>gb|KDO48352.1| hypothetical protein CISIN_1g018314mg [Citrus sinensis]
Length=209

 Score =   192 bits (489),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 114/135 (84%), Gaps = 4/135 (3%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MRSS+LRS+   +   G+R    G++S S P+RKVA+LGAAGGIGQPL+LLMKLNPLVS 
Sbjct  1    MRSSVLRSVKTLAKPAGAR----GYSSESVPDRKVAVLGAAGGIGQPLALLMKLNPLVSR  56

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            L+L+DIA TPGVAADV HINTRSEV G+ G++ LG+ALE +DVVIIPAGVPRKPGMTRDD
Sbjct  57   LALYDIANTPGVAADVGHINTRSEVAGYMGNDQLGQALEDSDVVIIPAGVPRKPGMTRDD  116

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVK L +A
Sbjct  117  LFNINAGIVKDLCSA  131



>gb|KJB61646.1| hypothetical protein B456_009G372600 [Gossypium raimondii]
Length=338

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 3/131 (2%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            M RS+ +++   G  + RRG+A+ + PERKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+
Sbjct  1    MFRSVARSAA--GKNLLRRGYAT-AVPERKVAVLGAAGGIGQPLALLMKLNPLVSQLALY  57

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DIA TPGVAADVSHIN+RSEV G+ G+E LGKALEG DVVIIPAGVPRKPGMTRDDLFNI
Sbjct  58   DIANTPGVAADVSHINSRSEVAGYVGEEQLGKALEGCDVVIIPAGVPRKPGMTRDDLFNI  117

Query  455  NAGIVKSLSAA  487
            NAGIVK L +A
Sbjct  118  NAGIVKGLCSA  128



>ref|XP_002522546.1| malate dehydrogenase, putative [Ricinus communis]
 gb|EEF39846.1| malate dehydrogenase, putative [Ricinus communis]
Length=343

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 115/143 (80%), Gaps = 11/143 (8%)
 Frame = +2

Query  59   FLRSLEIEMRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLM  238
             LRS +  +RS   R           R++ R ++S S PERKVAILGAAGGIGQPL+LLM
Sbjct  1    MLRSAQATLRSCTSR-----------RLSARSYSSESQPERKVAILGAAGGIGQPLALLM  49

Query  239  KLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPR  418
            KLNPLVS LSL+DIA TPGVAADVSHIN+R++V G++G+E LG+ALEG+D+VIIPAGVPR
Sbjct  50   KLNPLVSSLSLYDIANTPGVAADVSHINSRAQVSGYAGEEQLGQALEGSDIVIIPAGVPR  109

Query  419  KPGMTRDDLFNINAGIVKSLSAA  487
            KPGMTRDDLFNINAGIVKSL  A
Sbjct  110  KPGMTRDDLFNINAGIVKSLCTA  132



>ref|XP_007212766.1| hypothetical protein PRUPE_ppa022676mg [Prunus persica]
 gb|EMJ13965.1| hypothetical protein PRUPE_ppa022676mg [Prunus persica]
Length=340

 Score =   196 bits (497),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 111/132 (84%), Gaps = 8/132 (6%)
 Frame = +2

Query  92   SMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            SMLRS          R A R ++S   P+RKV ILGAAGGIGQPLSLLMKLNPLVS LSL
Sbjct  6    SMLRS--------APRTAVRSYSSSFQPQRKVTILGAAGGIGQPLSLLMKLNPLVSSLSL  57

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN  451
            +DIAGTPGVAADVSH+NT ++V GF+G+E LGKALEG+D+VIIPAGVPRKPGMTRDDLFN
Sbjct  58   YDIAGTPGVAADVSHVNTLAQVSGFAGEEQLGKALEGSDLVIIPAGVPRKPGMTRDDLFN  117

Query  452  INAGIVKSLSAA  487
            INAGIVKSLSAA
Sbjct  118  INAGIVKSLSAA  129



>gb|KJB13223.1| hypothetical protein B456_002G063300 [Gossypium raimondii]
Length=339

 Score =   196 bits (497),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            M RS+ +++   G  + RRG+A+ S P+RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+
Sbjct  1    MFRSVARSAA--GKHLLRRGYATESVPDRKVAVLGAAGGIGQPLALLMKLNPLVSRLALY  58

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DIA TPGVAADVSH+NTRSEV G+ G++ L +ALEG DVVIIPAGVPRKPGMTRDDLFNI
Sbjct  59   DIANTPGVAADVSHVNTRSEVAGYVGEDQLKQALEGCDVVIIPAGVPRKPGMTRDDLFNI  118

Query  455  NAGIVKSLSAA  487
            NAGIVK L AA
Sbjct  119  NAGIVKGLCAA  129



>gb|KHG11830.1| Malate dehydrogenase-2C mitochondrial [Gossypium arboreum]
Length=339

 Score =   196 bits (497),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            M RS+ +++   G  + RRG+A+ S P+RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+
Sbjct  1    MFRSVARSAA--GKHLLRRGYATESVPDRKVAVLGAAGGIGQPLALLMKLNPLVSRLALY  58

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DIA TPGVAADVSH+NTRSEV G+ G++ L +ALEG DVVIIPAGVPRKPGMTRDDLFNI
Sbjct  59   DIANTPGVAADVSHVNTRSEVAGYVGEDQLKQALEGCDVVIIPAGVPRKPGMTRDDLFNI  118

Query  455  NAGIVKSLSAA  487
            NAGIVK L AA
Sbjct  119  NAGIVKGLCAA  129



>gb|KDO48351.1| hypothetical protein CISIN_1g018314mg [Citrus sinensis]
Length=256

 Score =   192 bits (489),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 114/135 (84%), Gaps = 4/135 (3%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MRSS+LRS+   +   G+R    G++S S P+RKVA+LGAAGGIGQPL+LLMKLNPLVS 
Sbjct  1    MRSSVLRSVKTLAKPAGAR----GYSSESVPDRKVAVLGAAGGIGQPLALLMKLNPLVSR  56

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            L+L+DIA TPGVAADV HINTRSEV G+ G++ LG+ALE +DVVIIPAGVPRKPGMTRDD
Sbjct  57   LALYDIANTPGVAADVGHINTRSEVAGYMGNDQLGQALEDSDVVIIPAGVPRKPGMTRDD  116

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVK L +A
Sbjct  117  LFNINAGIVKDLCSA  131



>gb|KDO48350.1| hypothetical protein CISIN_1g018314mg [Citrus sinensis]
Length=300

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 114/135 (84%), Gaps = 4/135 (3%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MRSS+LRS+   +   G+R    G++S S P+RKVA+LGAAGGIGQPL+LLMKLNPLVS 
Sbjct  1    MRSSVLRSVKTLAKPAGAR----GYSSESVPDRKVAVLGAAGGIGQPLALLMKLNPLVSR  56

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            L+L+DIA TPGVAADV HINTRSEV G+ G++ LG+ALE +DVVIIPAGVPRKPGMTRDD
Sbjct  57   LALYDIANTPGVAADVGHINTRSEVAGYMGNDQLGQALEDSDVVIIPAGVPRKPGMTRDD  116

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVK L +A
Sbjct  117  LFNINAGIVKDLCSA  131



>sp|P17783.1|MDHM_CITLA RecName: Full=Malate dehydrogenase, mitochondrial; Flags: Precursor 
[Citrullus lanatus]
 emb|CAA35239.1| unnamed protein product [Citrullus lanatus subsp. vulgaris]
Length=347

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  155  FASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSE  334
            FA+ S PERKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIAGTPGVAADV H+NTRSE
Sbjct  27   FATESVPERKVAVLGAAGGIGQPLALLMKLNPLVSKLALYDIAGTPGVAADVGHVNTRSE  86

Query  335  VVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            V G+ G+E LGKALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  A
Sbjct  87   VTGYVGEEQLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTA  137



>ref|XP_006485676.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Citrus sinensis]
 gb|KDO48349.1| hypothetical protein CISIN_1g018314mg [Citrus sinensis]
Length=340

 Score =   192 bits (488),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 114/135 (84%), Gaps = 4/135 (3%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MRSS+LRS+   +   G+R    G++S S P+RKVA+LGAAGGIGQPL+LLMKLNPLVS 
Sbjct  1    MRSSVLRSVKTLAKPAGAR----GYSSESVPDRKVAVLGAAGGIGQPLALLMKLNPLVSR  56

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            L+L+DIA TPGVAADV HINTRSEV G+ G++ LG+ALE +DVVIIPAGVPRKPGMTRDD
Sbjct  57   LALYDIANTPGVAADVGHINTRSEVAGYMGNDQLGQALEDSDVVIIPAGVPRKPGMTRDD  116

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVK L +A
Sbjct  117  LFNINAGIVKDLCSA  131



>gb|KDO48348.1| hypothetical protein CISIN_1g018314mg [Citrus sinensis]
Length=358

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 114/135 (84%), Gaps = 4/135 (3%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            MRSS+LRS+   +   G+R    G++S S P+RKVA+LGAAGGIGQPL+LLMKLNPLVS 
Sbjct  1    MRSSVLRSVKTLAKPAGAR----GYSSESVPDRKVAVLGAAGGIGQPLALLMKLNPLVSR  56

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            L+L+DIA TPGVAADV HINTRSEV G+ G++ LG+ALE +DVVIIPAGVPRKPGMTRDD
Sbjct  57   LALYDIANTPGVAADVGHINTRSEVAGYMGNDQLGQALEDSDVVIIPAGVPRKPGMTRDD  116

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVK L +A
Sbjct  117  LFNINAGIVKDLCSA  131



>ref|XP_004137217.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004156521.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Cucumis 
sativus]
 gb|KGN53596.1| Malate dehydrogenase, mitochondrial [Cucumis sativus]
Length=347

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  149  RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTR  328
            R FA+ S PERKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DI  TPGVAADV H+NTR
Sbjct  25   RTFATESVPERKVAVLGAAGGIGQPLALLMKLNPLVSKLALYDIGATPGVAADVGHVNTR  84

Query  329  SEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            SEV G+ G+E LGKALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  A
Sbjct  85   SEVTGYMGEEQLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTA  137



>emb|CBI20215.3| unnamed protein product [Vitis vinifera]
Length=347

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR + S S PERKV ILGAAGGIGQPL+LLMK+NPLVS+L+L+DIAGTPGVAADVSH+NT
Sbjct  23   RRCYCSESVPERKVTILGAAGGIGQPLALLMKINPLVSNLALYDIAGTPGVAADVSHVNT  82

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
             S+V GF G++ LGKALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  A
Sbjct  83   ISQVAGFMGEDQLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCIA  136



>ref|XP_002285356.1| PREDICTED: malate dehydrogenase, mitochondrial [Vitis vinifera]
 emb|CAN83064.1| hypothetical protein VITISV_004210 [Vitis vinifera]
Length=351

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR + S S PERKV ILGAAGGIGQPL+LLMK+NPLVS+L+L+DIAGTPGVAADVSH+NT
Sbjct  27   RRCYCSESVPERKVTILGAAGGIGQPLALLMKINPLVSNLALYDIAGTPGVAADVSHVNT  86

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
             S+V GF G++ LGKALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  A
Sbjct  87   ISQVAGFMGEDQLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCIA  140



>ref|NP_001141337.1| uncharacterized protein LOC100273428 [Zea mays]
 gb|ACF86114.1| unknown [Zea mays]
Length=340

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 114/138 (83%), Gaps = 12/138 (9%)
 Frame = +2

Query  83   MRSSMLRS---LLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPL  253
            MR S+L+S   LL+ S         RG+AS + PERKVAILGAAGGIGQPLSLLMKLNPL
Sbjct  1    MRPSLLKSTAELLRRS---------RGYASSANPERKVAILGAAGGIGQPLSLLMKLNPL  51

Query  254  VSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMT  433
            VS LSL+DIAGTPGVAADVSHIN+ + V GF GD+ LG+ALEG+D+VIIPAGVPRKPGMT
Sbjct  52   VSSLSLYDIAGTPGVAADVSHINSPALVKGFMGDDQLGEALEGSDIVIIPAGVPRKPGMT  111

Query  434  RDDLFNINAGIVKSLSAA  487
            RDDLFNINAGIVK+L  A
Sbjct  112  RDDLFNINAGIVKALCTA  129



>ref|XP_002441555.1| hypothetical protein SORBIDRAFT_09g029240 [Sorghum bicolor]
 gb|EES19985.1| hypothetical protein SORBIDRAFT_09g029240 [Sorghum bicolor]
Length=340

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 113/138 (82%), Gaps = 12/138 (9%)
 Frame = +2

Query  83   MRSSMLRS---LLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPL  253
            MR S+L+S   LL+ S         RG+AS + PERKVAILGAAGGIGQPLSLLMKLNPL
Sbjct  1    MRPSLLKSSAELLRRS---------RGYASAANPERKVAILGAAGGIGQPLSLLMKLNPL  51

Query  254  VSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMT  433
            VS LSL+DIAGTPGVAADVSHIN+ + V GF GD+ LG+ALEG+DVVIIPAGVPRKPGMT
Sbjct  52   VSSLSLYDIAGTPGVAADVSHINSPALVKGFMGDDQLGEALEGSDVVIIPAGVPRKPGMT  111

Query  434  RDDLFNINAGIVKSLSAA  487
            RDDLFNINAGIVK L  A
Sbjct  112  RDDLFNINAGIVKGLCTA  129



>ref|XP_002456051.1| hypothetical protein SORBIDRAFT_03g029570 [Sorghum bicolor]
 gb|EES01171.1| hypothetical protein SORBIDRAFT_03g029570 [Sorghum bicolor]
Length=340

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 113/136 (83%), Gaps = 8/136 (6%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSA-PERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            MR S+LRS           + RR ++S S  PERKVAILGAAGGIGQPLSLLMKLNPLVS
Sbjct  1    MRPSLLRS-------TSQLLRRRSYSSASGQPERKVAILGAAGGIGQPLSLLMKLNPLVS  53

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             LSL+DIAGTPGVAADVSHIN+ + V GF G+E LG+ALEG+DVVIIPAGVPRKPGMTRD
Sbjct  54   SLSLYDIAGTPGVAADVSHINSPALVKGFMGEEQLGEALEGSDVVIIPAGVPRKPGMTRD  113

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVK+LSAA
Sbjct  114  DLFNINAGIVKNLSAA  129



>ref|XP_009395766.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Musa acuminata 
subsp. malaccensis]
Length=347

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +2

Query  173  PERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSG  352
            PERKVAILGAAGGIGQPLSLLMKLNPLVS L+L+DIAGTPGVAADVSHINTR+EVVG++G
Sbjct  32   PERKVAILGAAGGIGQPLSLLMKLNPLVSSLALYDIAGTPGVAADVSHINTRAEVVGYAG  91

Query  353  DENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            DE LGKAL+ +DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  A
Sbjct  92   DEQLGKALDDSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCTA  136



>ref|XP_006451738.1| hypothetical protein CICLE_v10008562mg [Citrus clementina]
 gb|ESR64978.1| hypothetical protein CICLE_v10008562mg [Citrus clementina]
Length=392

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 115/136 (85%), Gaps = 4/136 (3%)
 Frame = +2

Query  80   EMRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            +MRSS+LRS+   +   G+R    G++S S P+RKVA+LGAAGGIGQPL+LLMKLNPLVS
Sbjct  52   KMRSSVLRSVKTLAKPAGAR----GYSSESVPDRKVAVLGAAGGIGQPLALLMKLNPLVS  107

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             L+L+DIA TPGVAADV HINTRSEV G+ G++ LG+ALE +DVVIIPAGVPRKPGMTRD
Sbjct  108  RLALYDIANTPGVAADVGHINTRSEVAGYMGNDQLGQALEDSDVVIIPAGVPRKPGMTRD  167

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVK L +A
Sbjct  168  DLFNINAGIVKDLCSA  183



>gb|ADP03323.1| malate dehydrogenase [Pinus pinaster]
Length=143

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 113/135 (84%), Gaps = 2/135 (1%)
 Frame = +2

Query  89   SSMLRSLLKNSVSDGSRVARRGFASG--SAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            +S +R  L +++   +   RR +++   ++P RKVA+LGAAGGIGQPL+LLMKLNPLVS 
Sbjct  2    ASAMRGALGSALRRANASQRRLYSTTGINSPPRKVAVLGAAGGIGQPLALLMKLNPLVSD  61

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            L+L+DIAGTPGVAADV H+NTR++V G+ GD+ LGKALEG+DVVIIPAGVPRKPGMTRDD
Sbjct  62   LALYDIAGTPGVAADVGHVNTRAQVAGYMGDDQLGKALEGSDVVIIPAGVPRKPGMTRDD  121

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVKSL  A
Sbjct  122  LFNINAGIVKSLCIA  136



>ref|NP_001043717.1| Os01g0649100 [Oryza sativa Japonica Group]
 gb|AAM00435.1|AF444195_1 malate dehydrogenase [Oryza sativa]
 dbj|BAB55686.1| putative malate dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAC00625.1| putative mitochondrial malate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAF05631.1| Os01g0649100 [Oryza sativa Japonica Group]
 gb|EAY75180.1| hypothetical protein OsI_03070 [Oryza sativa Indica Group]
 gb|EAZ12901.1| hypothetical protein OsJ_02822 [Oryza sativa Japonica Group]
 dbj|BAG96942.1| unnamed protein product [Oryza sativa Japonica Group]
Length=340

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 114/138 (83%), Gaps = 11/138 (8%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRV--ARRGFASGSA-PERKVAILGAAGGIGQPLSLLMKLNPL  253
            MR S++RS         S+V   RRG++S S  PERKVAILGAAGGIGQPLSLLMKLNPL
Sbjct  1    MRPSLMRS--------ASQVLRRRRGYSSASGQPERKVAILGAAGGIGQPLSLLMKLNPL  52

Query  254  VSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMT  433
            VS LSL+DIAGTPGVAADVSHIN  ++V GF GD+ LG+ALEG+D+VIIPAGVPRKPGMT
Sbjct  53   VSSLSLYDIAGTPGVAADVSHINAPAQVKGFMGDDQLGEALEGSDIVIIPAGVPRKPGMT  112

Query  434  RDDLFNINAGIVKSLSAA  487
            RDDLFNINAGIVK+L  A
Sbjct  113  RDDLFNINAGIVKNLCTA  130



>gb|ADP03262.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03263.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03264.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03265.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03266.1| malate dehydrogenase, partial [Pinus sylvestris]
Length=143

 Score =   184 bits (468),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 113/135 (84%), Gaps = 2/135 (1%)
 Frame = +2

Query  89   SSMLRSLLKNSVSDGSRVARRGFASG--SAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            +S +R  L +++   +   RR +++   ++P RKVA+LGAAGGIGQPL+LLMKLNPLVS 
Sbjct  2    ASAMRGALGSALRRANASRRRFYSTAGVNSPPRKVAVLGAAGGIGQPLALLMKLNPLVSD  61

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            L+L+DIAGTPGVAADV H+NTR++V G+ GD+ LGKALEG+DVVIIPAGVPRKPGMTRDD
Sbjct  62   LALYDIAGTPGVAADVGHVNTRAQVAGYMGDDQLGKALEGSDVVIIPAGVPRKPGMTRDD  121

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVKSL  A
Sbjct  122  LFNINAGIVKSLCIA  136



>gb|ADP03279.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03280.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03281.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03282.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03283.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03284.1| malate dehydrogenase, partial [Pinus sylvestris]
Length=143

 Score =   184 bits (468),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 113/135 (84%), Gaps = 2/135 (1%)
 Frame = +2

Query  89   SSMLRSLLKNSVSDGSRVARRGFASG--SAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            +S +R  L +++   +   RR +++   ++P RKVA+LGAAGGIGQPL+LLMKLNPLVS 
Sbjct  2    ASAMRGALGSALRRANASLRRLYSTAGVNSPPRKVAVLGAAGGIGQPLALLMKLNPLVSD  61

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            L+L+DIAGTPGVAADV H+NTR++V G+ GD+ LGKALEG+DVVIIPAGVPRKPGMTRDD
Sbjct  62   LALYDIAGTPGVAADVGHVNTRAQVAGYMGDDQLGKALEGSDVVIIPAGVPRKPGMTRDD  121

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVKSL  A
Sbjct  122  LFNINAGIVKSLCIA  136



>gb|ADP03255.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03256.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03257.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03258.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03259.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03260.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03261.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03267.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03268.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03269.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03270.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03271.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03272.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03273.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03274.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03275.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03276.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03285.1| malate dehydrogenase, partial [Pinus sylvestris]
Length=143

 Score =   184 bits (468),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 113/135 (84%), Gaps = 2/135 (1%)
 Frame = +2

Query  89   SSMLRSLLKNSVSDGSRVARRGFASG--SAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            +S +R  L +++   +   RR +++   ++P RKVA+LGAAGGIGQPL+LLMKLNPLVS 
Sbjct  2    ASAMRGALGSALRRANASRRRLYSTAGVNSPPRKVAVLGAAGGIGQPLALLMKLNPLVSD  61

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            L+L+DIAGTPGVAADV H+NTR++V G+ GD+ LGKALEG+DVVIIPAGVPRKPGMTRDD
Sbjct  62   LALYDIAGTPGVAADVGHVNTRAQVAGYMGDDQLGKALEGSDVVIIPAGVPRKPGMTRDD  121

Query  443  LFNINAGIVKSLSAA  487
            LFNINAGIVKSL  A
Sbjct  122  LFNINAGIVKSLCIA  136



>ref|NP_001140825.1| uncharacterized protein LOC100272900 [Zea mays]
 gb|ACF84734.1| unknown [Zea mays]
Length=340

 Score =   190 bits (483),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 112/136 (82%), Gaps = 8/136 (6%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSA-PERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            MR S++RS           + RR ++S S  PERKVAILGAAGGIGQPLSLLMKLNPLVS
Sbjct  1    MRPSLMRST-------SQLLRRRSYSSASGQPERKVAILGAAGGIGQPLSLLMKLNPLVS  53

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             LSL+DIAGTPGVAADVSHIN+ + V GF GDE LG+ALEG+DVVIIPAGVPRKPGMTRD
Sbjct  54   SLSLYDIAGTPGVAADVSHINSPALVKGFMGDEQLGEALEGSDVVIIPAGVPRKPGMTRD  113

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVK+LS A
Sbjct  114  DLFNINAGIVKNLSTA  129



>ref|XP_011082746.1| PREDICTED: malate dehydrogenase, mitochondrial [Sesamum indicum]
Length=346

 Score =   191 bits (484),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 116/136 (85%), Gaps = 1/136 (1%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGS-APERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            M+++MLRS+L+ S    +  + R   S + APERKVA+LGAAGGIGQPLSLLMKLNPLVS
Sbjct  1    MKAAMLRSVLRRSTGSAAASSSRRSFSSAPAPERKVAVLGAAGGIGQPLSLLMKLNPLVS  60

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             L+L+DIAGTPGVAADVSHINTRSEV G++ +E LG+ALEG+DVVIIPAGVPRKPGMTRD
Sbjct  61   SLALYDIAGTPGVAADVSHINTRSEVKGYAAEEQLGQALEGSDVVIIPAGVPRKPGMTRD  120

Query  440  DLFNINAGIVKSLSAA  487
            DLF INAGIVKSL  A
Sbjct  121  DLFKINAGIVKSLCEA  136



>ref|NP_001142100.1| malate dehydrogenase2 [Zea mays]
 gb|ACF87641.1| unknown [Zea mays]
 gb|AFW79275.1| malate dehydrogenase2 [Zea mays]
Length=340

 Score =   190 bits (482),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 113/138 (82%), Gaps = 12/138 (9%)
 Frame = +2

Query  83   MRSSMLRS---LLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPL  253
            MR ++L+S   LL+ S         RG+AS + PERKVAILGAAGGIGQPLSLLMKLNPL
Sbjct  1    MRPALLKSTAELLRRS---------RGYASSANPERKVAILGAAGGIGQPLSLLMKLNPL  51

Query  254  VSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMT  433
            VS LSL+DIAGTPGVAADVSHIN+ + V GF GD+ LG+ALEG+DVVIIPAGVPRKPGMT
Sbjct  52   VSSLSLYDIAGTPGVAADVSHINSPALVKGFMGDDQLGEALEGSDVVIIPAGVPRKPGMT  111

Query  434  RDDLFNINAGIVKSLSAA  487
            RDDLFNINAGIVK L  A
Sbjct  112  RDDLFNINAGIVKGLCTA  129



>gb|ACG36184.1| malate dehydrogenase [Zea mays]
Length=340

 Score =   190 bits (482),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 114/138 (83%), Gaps = 12/138 (9%)
 Frame = +2

Query  83   MRSSMLRS---LLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPL  253
            MR S+L+S   LL+ S         RG+AS + PERKVAILGAAGGIGQPLSLLMKLNPL
Sbjct  1    MRPSLLKSTAELLRRS---------RGYASTANPERKVAILGAAGGIGQPLSLLMKLNPL  51

Query  254  VSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMT  433
            VS LSL+DIAGTPGVAADVSHIN+ + + GF GD+ LG+ALEG+D+VIIPAGVPRKPGMT
Sbjct  52   VSSLSLYDIAGTPGVAADVSHINSPALMKGFMGDDQLGEALEGSDIVIIPAGVPRKPGMT  111

Query  434  RDDLFNINAGIVKSLSAA  487
            RDDLFNINAGIVK+L  A
Sbjct  112  RDDLFNINAGIVKALCTA  129



>gb|ADP03277.1| malate dehydrogenase, partial [Pinus sylvestris]
 gb|ADP03278.1| malate dehydrogenase, partial [Pinus sylvestris]
Length=142

 Score =   183 bits (464),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 106/120 (88%), Gaps = 2/120 (2%)
 Frame = +2

Query  134  SRVARRGFASG--SAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAAD  307
            +  +RR +++   ++P RKVA+LGAAGGIGQPL+LLMKLNPLVS L+L+DIAGTPGVAAD
Sbjct  16   ANASRRLYSTAGVNSPPRKVAVLGAAGGIGQPLALLMKLNPLVSDLALYDIAGTPGVAAD  75

Query  308  VSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            V H+NTR++V G+ GD+ LGKALEG+DVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  A
Sbjct  76   VGHVNTRAQVAGYMGDDQLGKALEGSDVVIIPAGVPRKPGMTRDDLFNINAGIVKSLCIA  135



>tpg|DAA58328.1| TPA: malate dehydrogenase [Zea mays]
Length=410

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 112/136 (82%), Gaps = 8/136 (6%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSA-PERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            MR S++RS           + RR ++S S  PERKVAILGAAGGIGQPLSLLMKLNPLVS
Sbjct  71   MRPSLMRST-------SQLLRRRSYSSASGQPERKVAILGAAGGIGQPLSLLMKLNPLVS  123

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             LSL+DIAGTPGVAADVSHIN+ + V GF GDE LG+ALEG+DVVIIPAGVPRKPGMTRD
Sbjct  124  SLSLYDIAGTPGVAADVSHINSPALVKGFMGDEQLGEALEGSDVVIIPAGVPRKPGMTRD  183

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVK+LS A
Sbjct  184  DLFNINAGIVKNLSTA  199



>ref|XP_004969321.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Setaria 
italica]
Length=340

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 115/137 (84%), Gaps = 10/137 (7%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSA--PERKVAILGAAGGIGQPLSLLMKLNPLV  256
            MR SM+RS         +++ARR   S ++  PERKVAILGAAGGIGQPL+LLMKLNPLV
Sbjct  1    MRPSMMRS--------AAQLARRRSYSAASGQPERKVAILGAAGGIGQPLALLMKLNPLV  52

Query  257  SHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTR  436
            S LSL+DIAGTPGVAADVSHINT + V GF G++ LG+ALEG+DVVIIPAGVPRKPGMTR
Sbjct  53   SSLSLYDIAGTPGVAADVSHINTPALVKGFMGEDKLGEALEGSDVVIIPAGVPRKPGMTR  112

Query  437  DDLFNINAGIVKSLSAA  487
            DDLFNINAGIVK+LSAA
Sbjct  113  DDLFNINAGIVKNLSAA  129



>ref|XP_010675402.1| PREDICTED: malate dehydrogenase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=350

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 114/140 (81%), Gaps = 5/140 (4%)
 Frame = +2

Query  83   MRSSMLRSL---LKNSVSDGSRVARRGF--ASGSAPERKVAILGAAGGIGQPLSLLMKLN  247
            MR+ MLRS+   ++         A R F  +SG  PERKV +LGAAGGIGQPLS+LMKLN
Sbjct  1    MRTQMLRSMQSAVRRCNYAAPASAPRTFTSSSGPNPERKVTVLGAAGGIGQPLSMLMKLN  60

Query  248  PLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPG  427
            PLVS LSL+D+AGTPGVAAD SH+NTR++V G++GD ++G+ALEG+DVVIIPAGVPRKPG
Sbjct  61   PLVSTLSLYDLAGTPGVAADCSHVNTRAQVFGYAGDNDMGEALEGSDVVIIPAGVPRKPG  120

Query  428  MTRDDLFNINAGIVKSLSAA  487
            MTRDDLFNINAGIVK+L  A
Sbjct  121  MTRDDLFNINAGIVKNLCNA  140



>ref|XP_003567846.1| PREDICTED: malate dehydrogenase 1, mitochondrial-like [Brachypodium 
distachyon]
Length=341

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 112/137 (82%), Gaps = 9/137 (7%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFAS--GSAPERKVAILGAAGGIGQPLSLLMKLNPLV  256
            MRSS+LRS  ++       + RRG+AS  G  PERKVAILGAAGGIGQPL+LLMKLNPLV
Sbjct  1    MRSSLLRSASQH-------LRRRGYASAAGGQPERKVAILGAAGGIGQPLALLMKLNPLV  53

Query  257  SHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTR  436
            S LSL+DIA TPGVAADVSHIN+ + V GF GD+ LG+ALEGAD+VIIPAGVPRKPGMTR
Sbjct  54   SSLSLYDIAATPGVAADVSHINSPALVKGFVGDDQLGEALEGADLVIIPAGVPRKPGMTR  113

Query  437  DDLFNINAGIVKSLSAA  487
            DDLF INAGIVK L  A
Sbjct  114  DDLFKINAGIVKGLCTA  130



>emb|CDY24107.1| BnaA06g01050D [Brassica napus]
Length=340

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
             R F+S S PERKVAILGAAGGIGQPL+LLMKLNPLVS LSLFDIA TPGVAADV HINT
Sbjct  19   HRSFSS-SVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSLFDIANTPGVAADVGHINT  77

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            RSEVVG+ GD+ L KAL GAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L +A
Sbjct  78   RSEVVGYMGDDELAKALAGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCSA  131



>emb|CDY26002.1| BnaC06g06220D [Brassica napus]
Length=343

 Score =   187 bits (476),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +2

Query  173  PERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSG  352
            PERKVAILGAAGGIGQPL+LLMKLNPLVS LSLFDIA TPGVAADV HINTRSEVVG+ G
Sbjct  30   PERKVAILGAAGGIGQPLALLMKLNPLVSSLSLFDIANTPGVAADVGHINTRSEVVGYMG  89

Query  353  DENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            D+ L KALEGAD+VIIPAGVPRKPGMTRDDLFNINAGIVK+L +A
Sbjct  90   DDELAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCSA  134



>ref|XP_006654824.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Oryza brachyantha]
Length=344

 Score =   187 bits (475),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 113/140 (81%), Gaps = 12/140 (9%)
 Frame = +2

Query  83   MRSSMLRS---LLKNSVSDGSRVARRGF--ASGSAPERKVAILGAAGGIGQPLSLLMKLN  247
            MR S+LRS   LL+       R  RR +  A+G  PERKVAILGAAGGIGQPL+LLMKLN
Sbjct  1    MRPSLLRSASQLLR-------RNRRRDYSAAAGGQPERKVAILGAAGGIGQPLALLMKLN  53

Query  248  PLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPG  427
            PLVS LSL+DIAGTPGVAADVSHIN+ + V GF G+E LG+ALEG+DVVIIPAGVPRKPG
Sbjct  54   PLVSSLSLYDIAGTPGVAADVSHINSPALVKGFVGEEQLGEALEGSDVVIIPAGVPRKPG  113

Query  428  MTRDDLFNINAGIVKSLSAA  487
            MTRDDLFNINAGIVK L  A
Sbjct  114  MTRDDLFNINAGIVKGLCTA  133



>ref|XP_007025436.1| Malate dehydrogenase [Theobroma cacao]
 gb|EOY28058.1| Malate dehydrogenase [Theobroma cacao]
Length=355

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +2

Query  140  VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHI  319
            ++R  +++GS PERKVAILGAAGGIGQPL+LLMKLNP VS LSL+DIA TPGVAADVSHI
Sbjct  30   LSRSYYSAGSYPERKVAILGAAGGIGQPLALLMKLNPFVSSLSLYDIANTPGVAADVSHI  89

Query  320  NTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            N  ++V G+ G+E LGKALEG+D+VIIPAGVPRKPGMTRDDLFNINAGIVKSL  A
Sbjct  90   NYPAQVAGYVGEEELGKALEGSDLVIIPAGVPRKPGMTRDDLFNINAGIVKSLCVA  145



>emb|CBL95261.1| malate dehydrogenase [Pinus pinaster]
Length=354

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 115/142 (81%), Gaps = 7/142 (5%)
 Frame = +2

Query  83   MRSSMLR---SLLKNSVSDGSR---VARRGFASG-SAPERKVAILGAAGGIGQPLSLLMK  241
            M S+M R   S LKN+ S   +   + RR ++SG S P RKV +LGAAGGIGQPL+LLMK
Sbjct  1    MSSAMRRLVGSALKNASSSSFKTNVMPRRFYSSGGSPPPRKVVVLGAAGGIGQPLALLMK  60

Query  242  LNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRK  421
            LNPLVS L+L+DIAGTPGVAADV HIN+R+EV G+ G+E LG ALE A+VVIIPAGVPRK
Sbjct  61   LNPLVSKLALYDIAGTPGVAADVGHINSRAEVAGYMGEEQLGTALENANVVIIPAGVPRK  120

Query  422  PGMTRDDLFNINAGIVKSLSAA  487
            PGMTRDDLFNINAGIVKSL +A
Sbjct  121  PGMTRDDLFNINAGIVKSLCSA  142



>gb|EPS74425.1| malate dehydrogenase, mitochondrial [Genlisea aurea]
Length=356

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 113/142 (80%), Gaps = 12/142 (8%)
 Frame = +2

Query  89   SSMLRSLLKNSVSD---GSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            ++++RS+L+ S  +    SR   RGF++ +APERKV ILGAAGGIGQPLSLLMKLNPLVS
Sbjct  2    AAVVRSVLRRSAKEKAASSRWWIRGFSAEAAPERKVTILGAAGGIGQPLSLLMKLNPLVS  61

Query  260  HLSLFDIAGTPGVAADVSHINTRSE---------VVGFSGDENLGKALEGADVVIIPAGV  412
             LSL+DIA TPGVAADV HINTRSE         V G+ G+E + +ALEG+DVVIIPAGV
Sbjct  62   SLSLYDIAATPGVAADVGHINTRSENFLSADDFGVKGYVGEEQIKEALEGSDVVIIPAGV  121

Query  413  PRKPGMTRDDLFNINAGIVKSL  478
            PRKPGMTRDDLF INAGIVKSL
Sbjct  122  PRKPGMTRDDLFTINAGIVKSL  143



>ref|XP_009147616.1| PREDICTED: malate dehydrogenase 1, mitochondrial-like [Brassica 
rapa]
Length=340

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +2

Query  173  PERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSG  352
            PERKVAILGAAGGIGQPL+LLMKLNPLVS LSLFDIA TPGVAADV HINTRSEVVG+ G
Sbjct  27   PERKVAILGAAGGIGQPLALLMKLNPLVSSLSLFDIANTPGVAADVGHINTRSEVVGYMG  86

Query  353  DENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            D+ L KALEGAD+VII AGVPRKPGMTRDDL+NINAGIVK+L +A
Sbjct  87   DDELAKALEGADLVIIHAGVPRKPGMTRDDLYNINAGIVKNLCSA  131



>ref|XP_006644438.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Oryza brachyantha]
Length=341

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +2

Query  173  PERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSG  352
            PERKVAILGAAGGIGQPLSLLMKLNPLVS LSL+DIAGTPGVAADVSHIN+ ++V GF G
Sbjct  26   PERKVAILGAAGGIGQPLSLLMKLNPLVSSLSLYDIAGTPGVAADVSHINSPAQVKGFMG  85

Query  353  DENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            D+ LG+ALEG+D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  A
Sbjct  86   DDQLGEALEGSDIVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTA  130



>ref|XP_002305754.2| hypothetical protein POPTR_0004s05340g [Populus trichocarpa]
 gb|EEE86265.2| hypothetical protein POPTR_0004s05340g [Populus trichocarpa]
Length=348

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 111/142 (78%), Gaps = 10/142 (7%)
 Frame = +2

Query  62   LRSLEIEMRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMK  241
            LRS    +R    R L+  S S          ++ S+PE KVAILGAAGGIGQPL+LLMK
Sbjct  6    LRSSRAALRPCTCRHLVGRSYS----------STESSPESKVAILGAAGGIGQPLALLMK  55

Query  242  LNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRK  421
            LNPL+S LSL+DIA TPGVAADVSHIN+R++V G++G+E LG+AL+G+D+VIIPAGVPRK
Sbjct  56   LNPLISSLSLYDIANTPGVAADVSHINSRAQVAGYAGEEQLGEALDGSDIVIIPAGVPRK  115

Query  422  PGMTRDDLFNINAGIVKSLSAA  487
            PGMTRDDLF INAGIVKSL  A
Sbjct  116  PGMTRDDLFKINAGIVKSLCTA  137



>ref|XP_003569456.1| PREDICTED: malate dehydrogenase 1, mitochondrial-like [Brachypodium 
distachyon]
Length=340

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 110/136 (81%), Gaps = 8/136 (6%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSA-PERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            MR S++RS  +        + RR ++S S  PERKVAILGAAGGIGQPL+LLMKLNPLVS
Sbjct  1    MRPSVMRSAAQ-------LLRRRSYSSASGQPERKVAILGAAGGIGQPLALLMKLNPLVS  53

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             LSL+DIA TPGVAAD+SHIN+ + V GF GDE L +ALEGAD+VIIPAGVPRKPGMTRD
Sbjct  54   SLSLYDIAATPGVAADISHINSPALVKGFMGDEQLAEALEGADLVIIPAGVPRKPGMTRD  113

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVK+L  A
Sbjct  114  DLFNINAGIVKNLCTA  129



>dbj|BAJ85181.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=345

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 110/139 (79%), Gaps = 9/139 (6%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSA----PERKVAILGAAGGIGQPLSLLMKLNP  250
            MR S+LRS      S   R  R  ++S S+    PERKVAILGAAGGIGQPL+LLMKLNP
Sbjct  1    MRMSLLRS-----ASQHLRRHRCDYSSSSSATASPERKVAILGAAGGIGQPLALLMKLNP  55

Query  251  LVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGM  430
            LVS LSL+DIA TPGVAADVSHINTR+ V GF GD+ LG+ALEGAD+VIIPAGVPRKPGM
Sbjct  56   LVSSLSLYDIAATPGVAADVSHINTRALVKGFVGDDQLGEALEGADLVIIPAGVPRKPGM  115

Query  431  TRDDLFNINAGIVKSLSAA  487
            TRDDLF INAGIVK L  A
Sbjct  116  TRDDLFKINAGIVKGLCTA  134



>ref|XP_011397587.1| Malate dehydrogenase, mitochondrial [Auxenochlorella protothecoides]
 gb|KFM24699.1| Malate dehydrogenase, mitochondrial [Auxenochlorella protothecoides]
Length=313

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 7/126 (6%)
 Frame = +2

Query  101  RSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDI  280
            R LL+ S       A RG+AS S P+RKVA+LGAAGGIGQPLSLL+KLNP V+ L+L+DI
Sbjct  9    RDLLRAS-------ATRGYASASFPDRKVAVLGAAGGIGQPLSLLLKLNPYVTELALYDI  61

Query  281  AGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINA  460
            AGTPGVAAD+SHIN++  V G++G++ LG+AL+GADV++IPAGVPRKPGMTRDDLF INA
Sbjct  62   AGTPGVAADISHINSKGRVKGYAGEDQLGEALKGADVIVIPAGVPRKPGMTRDDLFKINA  121

Query  461  GIVKSL  478
            GIV++L
Sbjct  122  GIVRAL  127



>ref|XP_002990694.1| hypothetical protein SELMODRAFT_131967 [Selaginella moellendorffii]
 gb|EFJ08326.1| hypothetical protein SELMODRAFT_131967 [Selaginella moellendorffii]
Length=358

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 109/129 (84%), Gaps = 2/129 (2%)
 Frame = +2

Query  107  LLKNSVSDGSR-VARRGFA-SGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDI  280
            +L+ +  + SR V RR FA S S+ +RKV ILGA GGIGQPLSLLMKL+PLVS L L+DI
Sbjct  8    ILRATAMEASRLVLRRAFARSASSAKRKVVILGANGGIGQPLSLLMKLSPLVSDLGLYDI  67

Query  281  AGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINA  460
             GTPGVAADVSH+N+R++V GF+G+ENLGK L+ AD+VIIPAGVPRKPGM RDDLFNINA
Sbjct  68   VGTPGVAADVSHVNSRAQVAGFAGEENLGKCLKDADLVIIPAGVPRKPGMDRDDLFNINA  127

Query  461  GIVKSLSAA  487
            GIV++L AA
Sbjct  128  GIVQTLCAA  136



>ref|NP_001056389.1| Os05g0574400 [Oryza sativa Japonica Group]
 gb|AAT69584.1| putative malate dehydrogenase [Oryza sativa Japonica Group]
 gb|AAU44114.1| putative malate dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF18303.1| Os05g0574400 [Oryza sativa Japonica Group]
 gb|EAY99124.1| hypothetical protein OsI_21084 [Oryza sativa Indica Group]
 gb|EEE64778.1| hypothetical protein OsJ_19634 [Oryza sativa Japonica Group]
 gb|AGT38446.1| malate dehydrogenase [Oryza sativa Japonica Group]
Length=340

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 110/136 (81%), Gaps = 8/136 (6%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAP-ERKVAILGAAGGIGQPLSLLMKLNPLVS  259
            MR S+LR   +        + RR ++S +A  ERKVAILGAAGGIGQPL+LLMKLNPLVS
Sbjct  1    MRPSLLRYAAQ-------ALRRRDYSSAAAAAERKVAILGAAGGIGQPLALLMKLNPLVS  53

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             LSL+DIAGTPGVAADVSHIN+ + V GF G+E LG+ALEG+DVVIIPAGVPRKPGMTRD
Sbjct  54   SLSLYDIAGTPGVAADVSHINSPALVKGFVGEEQLGEALEGSDVVIIPAGVPRKPGMTRD  113

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVK L  A
Sbjct  114  DLFNINAGIVKGLCTA  129



>ref|XP_001767253.1| predicted protein [Physcomitrella patens]
 gb|EDQ67934.1| predicted protein [Physcomitrella patens]
Length=322

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  161  SGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVV  340
            S + P+RKVA+LGAAGGIGQPL LLMKLNPLV+ LSL+DIAGTPGVA D+SHINT + V 
Sbjct  2    SSATPKRKVAVLGAAGGIGQPLGLLMKLNPLVTDLSLYDIAGTPGVACDISHINTGANVK  61

Query  341  GFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            GF+G+E+L KAL+G D+VIIPAGVPRKPGMTRDDLFNINAGIV+SL++A
Sbjct  62   GFAGEEDLAKALKGCDLVIIPAGVPRKPGMTRDDLFNINAGIVRSLASA  110



>ref|XP_005649665.1| malate dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE25121.1| malate dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=340

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 107/130 (82%), Gaps = 1/130 (1%)
 Frame = +2

Query  98   LRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFD  277
            +RSLL+ +  +  R + R + + + P+RKVAILGAAGGIGQPLSLLMK+NP VS L+L+D
Sbjct  1    MRSLLRVT-QNVLRASERAYTNAANPDRKVAILGAAGGIGQPLSLLMKMNPYVSDLALYD  59

Query  278  IAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNIN  457
            I GTPGVAAD+SHIN++++  G++G E LG+AL+GADVVIIPAGVPRKPGMTRDDLF  N
Sbjct  60   IQGTPGVAADISHINSKAKTKGYAGAEQLGEALKGADVVIIPAGVPRKPGMTRDDLFKTN  119

Query  458  AGIVKSLSAA  487
            AGIVK L  A
Sbjct  120  AGIVKDLITA  129



>emb|CDM83547.1| unnamed protein product [Triticum aestivum]
Length=340

 Score =   176 bits (445),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 108/136 (79%), Gaps = 8/136 (6%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPE-RKVAILGAAGGIGQPLSLLMKLNPLVS  259
            MR S++RS  +        + RR ++S S  + RKVAILGAAGGIGQPLSLLMKLNPLVS
Sbjct  1    MRPSVMRSAAQ-------LLRRRNYSSASGQQARKVAILGAAGGIGQPLSLLMKLNPLVS  53

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             LSL+DIA TPGVAADVSHIN+ + V GF  D+ L +AL+GAD+VIIPAGVPRKPGMTRD
Sbjct  54   SLSLYDIAATPGVAADVSHINSPALVKGFMADDQLAEALDGADLVIIPAGVPRKPGMTRD  113

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVK+L  A
Sbjct  114  DLFNINAGIVKNLCTA  129



>ref|XP_001776138.1| predicted protein [Physcomitrella patens]
 gb|EDQ59049.1| predicted protein [Physcomitrella patens]
Length=322

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  161  SGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVV  340
            S   P+RKVA+LGAAGGIGQPL LLMKLNPLV+ LSL+DIAGTPGVA+D+SHINT + V 
Sbjct  2    SSQTPKRKVAVLGAAGGIGQPLGLLMKLNPLVTDLSLYDIAGTPGVASDLSHINTGANVE  61

Query  341  GFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            GF+G++ L KAL+G D+VIIPAGVPRKPGMTRDDLFNINAGIVKSL++A
Sbjct  62   GFAGEQELAKALKGCDLVIIPAGVPRKPGMTRDDLFNINAGIVKSLASA  110



>ref|XP_002969028.1| hypothetical protein SELMODRAFT_90290 [Selaginella moellendorffii]
 gb|EFJ30144.1| hypothetical protein SELMODRAFT_90290 [Selaginella moellendorffii]
Length=358

 Score =   175 bits (444),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +2

Query  140  VARRGFA-SGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSH  316
            V RR FA S S+ +R+V ILGA GGIGQPLSLLMKL+PLVS L L+DI GTPGVAADVSH
Sbjct  20   VLRRAFARSASSAKRRVVILGANGGIGQPLSLLMKLSPLVSDLGLYDIVGTPGVAADVSH  79

Query  317  INTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            +N+R++V GF+G+ENLGK L+ AD+VIIPAGVPRKPGM RDDLFN+NAGIV++L  A
Sbjct  80   VNSRAQVAGFAGEENLGKCLKDADLVIIPAGVPRKPGMDRDDLFNVNAGIVQTLCTA  136



>emb|CCD74506.1| mitochondrial malate dehydrogenase [Arabidopsis halleri subsp. 
halleri]
Length=181

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSR-VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL  271
            M RS+L  S S   + V RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct  1    MFRSMLVRSSSSAKQAVIRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL  60

Query  272  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKP  424
            + IA TPGVAADV HINTRSEVVG+ GD+NL KALEGAD+VIIP GVPRKP
Sbjct  61   YSIANTPGVAADVGHINTRSEVVGYMGDDNLAKALEGADLVIIPVGVPRKP  111



>gb|EMS58229.1| Malate dehydrogenase 1, mitochondrial [Triticum urartu]
Length=405

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 108/136 (79%), Gaps = 8/136 (6%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPE-RKVAILGAAGGIGQPLSLLMKLNPLVS  259
            MR S++RS  +        + RR ++S S  + RKVAILGAAGGIGQPLSLLMKLNPLVS
Sbjct  1    MRPSVMRSAAQ-------LLRRRNYSSASGQQARKVAILGAAGGIGQPLSLLMKLNPLVS  53

Query  260  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD  439
             LSL+DIA TPGVAADVSHIN+ + V GF  D+ L +AL+GAD+VIIPAGVPRKPGMTRD
Sbjct  54   SLSLYDIAATPGVAADVSHINSPALVKGFMADDQLAEALDGADLVIIPAGVPRKPGMTRD  113

Query  440  DLFNINAGIVKSLSAA  487
            DLFNINAGIVK+L  A
Sbjct  114  DLFNINAGIVKNLCTA  129



>ref|XP_010062799.1| PREDICTED: malate dehydrogenase, mitochondrial [Eucalyptus grandis]
 gb|KCW69927.1| hypothetical protein EUGRSUZ_F03251 [Eucalyptus grandis]
Length=344

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 109/142 (77%), Gaps = 14/142 (10%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSR--VARRGFASGSAPERKVAILGAAGGIGQPLSLL-----MK  241
            MR+SMLR +   S S   R  + RR + S S       +LGAAGGIGQPL+LL     MK
Sbjct  1    MRASMLRLIRSRSSSAAPRPHLLRRAYGSES-------VLGAAGGIGQPLALLPLALLMK  53

Query  242  LNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRK  421
            LNPLVS L+L+DIAGTPGVAADV HINTRSEV G+ G+E LG+ALEG+DVVIIPAGVPRK
Sbjct  54   LNPLVSQLALYDIAGTPGVAADVGHINTRSEVAGYVGEEQLGQALEGSDVVIIPAGVPRK  113

Query  422  PGMTRDDLFNINAGIVKSLSAA  487
            PGMTRDDLFNINAGIVKSL  A
Sbjct  114  PGMTRDDLFNINAGIVKSLCTA  135



>gb|KDD74483.1| lactate/malate dehydrogenase [Helicosporidium sp. ATCC 50920]
Length=389

 Score =   171 bits (432),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  149  RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTR  328
            RGFAS S P+RKV ILGAAGGIGQPLSLLMKL+P V+ L+L+D+ GT GVAAD SHIN+ 
Sbjct  64   RGFASASFPKRKVTILGAAGGIGQPLSLLMKLSPYVTELALYDLTGTLGVAADTSHINSS  123

Query  329  SEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  478
             +V G+ GD+ LG+ALEGADVVIIPAGVPRKPGMTRDDLF INAGIV  L
Sbjct  124  GKVSGYEGDDQLGQALEGADVVIIPAGVPRKPGMTRDDLFRINAGIVYKL  173



>ref|XP_005843566.1| hypothetical protein CHLNCDRAFT_59812 [Chlorella variabilis]
 gb|EFN51464.1| hypothetical protein CHLNCDRAFT_59812 [Chlorella variabilis]
Length=337

 Score =   169 bits (429),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  149  RGFASGSAP-ERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            R F+S  A  +RKVA+LGAAGGIGQPLSLLMKL+P VS L+L+DIAGTPGVAADVSHIN+
Sbjct  12   RAFSSVPAHFDRKVAVLGAAGGIGQPLSLLMKLSPYVSELALYDIAGTPGVAADVSHINS  71

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            ++ V G++G++ LG+AL+GADVVIIPAGVPRKPGMTRDDLF INAGIV++L  A
Sbjct  72   KATVKGYAGEDQLGEALKGADVVIIPAGVPRKPGMTRDDLFKINAGIVRALVEA  125



>ref|XP_002968321.1| hypothetical protein SELMODRAFT_89860 [Selaginella moellendorffii]
 gb|EFJ30575.1| hypothetical protein SELMODRAFT_89860 [Selaginella moellendorffii]
Length=341

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  173  PERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSG  352
            P R+V +LGAAGGIGQPLS+L+KLNPLVS LSL+DIAGTPGVA D+SHINTR+EV GF+G
Sbjct  17   PYRRVTVLGAAGGIGQPLSMLLKLNPLVSKLSLYDIAGTPGVATDLSHINTRTEVHGFAG  76

Query  353  DENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            D+ L  AL+ AD+VIIPAGVPRKPGMTRD+LF+INAGIVK L  A
Sbjct  77   DDQLKDALKDADLVIIPAGVPRKPGMTRDELFDINAGIVKKLVQA  121



>ref|XP_002976052.1| hypothetical protein SELMODRAFT_232627 [Selaginella moellendorffii]
 gb|EFJ22957.1| hypothetical protein SELMODRAFT_232627 [Selaginella moellendorffii]
Length=341

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  173  PERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSG  352
            P R+V +LGAAGGIGQPLS+L+KLNPLVS LSL+DIAGTPGVA D+SHINTR+EV GF+G
Sbjct  17   PYRRVTVLGAAGGIGQPLSMLLKLNPLVSKLSLYDIAGTPGVATDLSHINTRTEVHGFAG  76

Query  353  DENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            D+ L  AL+ AD+VIIPAGVPRKPGMTRD+LF+INAGIVK L  A
Sbjct  77   DDQLKDALKDADLVIIPAGVPRKPGMTRDELFDINAGIVKKLVQA  121



>ref|XP_003228877.1| PREDICTED: malate dehydrogenase, mitochondrial [Anolis carolinensis]
Length=339

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRGF S S    KVA+LGA+GGIGQPLSLL+K +PLVSHLSL+DIA TPGVAAD+SHI T
Sbjct  15   RRGFTSSSQSNAKVAVLGASGGIGQPLSLLLKNSPLVSHLSLYDIAHTPGVAADLSHIET  74

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+EV GF G E L ++L+G +VV+IPAGVPRKPGMTRDDLFN NA IV +L+ A
Sbjct  75   RAEVKGFLGPEQLPESLKGCEVVVIPAGVPRKPGMTRDDLFNTNATIVANLATA  128



>emb|CEF98358.1| Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 
[Ostreococcus tauri]
Length=336

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 101/133 (76%), Gaps = 10/133 (8%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVAR--RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLS  268
            ML S+L+ S    + +AR  RG+        KVA+LGAAGGIGQP  LLMK+NPLV+ LS
Sbjct  1    MLGSVLRKSARASAGIARGSRGY--------KVAVLGAAGGIGQPCGLLMKMNPLVTELS  52

Query  269  LFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLF  448
            L+DIAGTPGVAADVSH+NT ++V G++G+  LG AL+  DVVIIPAGVPRKPGMTRDDLF
Sbjct  53   LYDIAGTPGVAADVSHVNTAAQVKGYAGEAELGAALKDCDVVIIPAGVPRKPGMTRDDLF  112

Query  449  NINAGIVKSLSAA  487
             IN GIVK L  A
Sbjct  113  AINGGIVKGLVEA  125



>gb|AHB50501.1| malate dehydrogenase 2 [Mayetiola destructor]
Length=337

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +2

Query  137  RVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSH  316
            + A + F++ S    KVA+ GA+GGIGQPLSLL+K +PLVSHLSL+DI  TPGVAAD+SH
Sbjct  11   KQAGKQFSTTSQNNTKVAVCGASGGIGQPLSLLLKQSPLVSHLSLYDIVHTPGVAADLSH  70

Query  317  INTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            I+T ++V GF+G ENL KAL+GADVVIIPAGVPRKPGMTRDDLFN NAG+V+ L+ A
Sbjct  71   IDTPAKVEGFNGAENLEKALKGADVVIIPAGVPRKPGMTRDDLFNTNAGVVRDLAVA  127



>ref|XP_002507824.1| nad-dependent malate dehydrogenase [Micromonas sp. RCC299]
 gb|ACO69082.1| nad-dependent malate dehydrogenase [Micromonas sp. RCC299]
Length=335

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +2

Query  182  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  361
            KVA+LGAAGGIGQP  LLMK+NPLV+ LSL+DIAGTPGVAADVSH+NT ++V G++GD  
Sbjct  24   KVAVLGAAGGIGQPCGLLMKMNPLVTELSLYDIAGTPGVAADVSHVNTGAQVKGYAGDAE  83

Query  362  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            LG AL+ ADVVIIPAGVPRKPGMTRDDLF INAGIV  L+ A
Sbjct  84   LGAALKDADVVIIPAGVPRKPGMTRDDLFKINAGIVAGLTEA  125



>gb|ACP18839.1| malate dehydrogenase [Chrysomela tremula]
Length=174

 Score =   159 bits (402),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  140  VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHI  319
            +A R F++      KVA+ GA+GGIGQPLSLL+K++PLVS LSL+D+  TPGVAAD+SHI
Sbjct  11   IASRNFSTSKQNNYKVAVCGASGGIGQPLSLLLKISPLVSELSLYDVVHTPGVAADLSHI  70

Query  320  NTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLS  481
             T ++V G++G E L  AL+GADV+IIPAGVPRKPGMTRDDLFN NAGIVK+L+
Sbjct  71   ETAAKVAGYNGPECLADALKGADVIIIPAGVPRKPGMTRDDLFNTNAGIVKTLA  124



>ref|XP_008904152.1| malate dehydrogenase, NAD-dependent [Phytophthora parasitica 
INRA-310]
 gb|ETI48434.1| malate dehydrogenase, NAD-dependent [Phytophthora parasitica 
P1569]
 gb|ETK88374.1| malate dehydrogenase, NAD-dependent [Phytophthora parasitica]
 gb|ETL41790.1| malate dehydrogenase, NAD-dependent [Phytophthora parasitica]
 gb|ETL94929.1| malate dehydrogenase, NAD-dependent [Phytophthora parasitica]
 gb|ETM48184.1| malate dehydrogenase, NAD-dependent [Phytophthora parasitica]
 gb|ETN10391.1| malate dehydrogenase, NAD-dependent [Phytophthora parasitica 
INRA-310]
 gb|ETO77230.1| malate dehydrogenase, NAD-dependent [Phytophthora parasitica 
P1976]
 gb|ETP18226.1| malate dehydrogenase, NAD-dependent [Phytophthora parasitica 
CJ01A1]
 gb|ETP46170.1| malate dehydrogenase, NAD-dependent [Phytophthora parasitica 
P10297]
Length=335

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +2

Query  146  RRGFASGSAP-ERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHIN  322
            RR ++S  AP ++KVA+LGAAGGIGQP+SLL+K    + HLSLFD+  TPGVAAD+ HIN
Sbjct  14   RRAYSS--APGQQKVAVLGAAGGIGQPMSLLLKDCDHIKHLSLFDVVNTPGVAADIGHIN  71

Query  323  TRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            TR+EV G  G E  G+ALEGADVV+IPAGVPRKPGMTRDDLFN NAGIV+SL+AA
Sbjct  72   TRAEVTGHVGMEQAGEALEGADVVVIPAGVPRKPGMTRDDLFNTNAGIVQSLAAA  126



>ref|XP_009048353.1| hypothetical protein LOTGIDRAFT_225558 [Lottia gigantea]
 gb|ESP00992.1| hypothetical protein LOTGIDRAFT_225558 [Lottia gigantea]
Length=339

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  140  VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHI  319
            VARR F++ +  + KV +LGA+GGIGQPLSLL+K +PL+S LSL+DIA TPGVAAD+SHI
Sbjct  12   VARRSFSTHAKEDAKVCVLGASGGIGQPLSLLLKNSPLISRLSLYDIAHTPGVAADLSHI  71

Query  320  NTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
             TR++V GF G + L K L+G+DVV+IPAGVPRKPGMTRDDLFN NAGIV+ L+ A
Sbjct  72   ETRAKVEGFMGPDQLEKCLQGSDVVLIPAGVPRKPGMTRDDLFNTNAGIVRDLADA  127



>ref|XP_005743241.1| PREDICTED: malate dehydrogenase, mitochondrial-like isoform X2 
[Pundamilia nyererei]
 ref|XP_005944616.1| PREDICTED: malate dehydrogenase, mitochondrial-like isoform X2 
[Haplochromis burtoni]
Length=295

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  149  RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTR  328
            RG A+ S    KVA+LGA+GGIGQPLSLL+K +PLVSHLSL+DIA TPGVAAD+SHI TR
Sbjct  14   RGLATSSQNNAKVAVLGASGGIGQPLSLLLKNSPLVSHLSLYDIAHTPGVAADLSHIETR  73

Query  329  SEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            ++V G  G + LG AL+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+ A
Sbjct  74   AKVTGHIGPDQLGAALQGCDVVVIPAGVPRKPGMTRDDLFNTNASIVATLTDA  126



>ref|XP_002732229.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Saccoglossus 
kowalevskii]
Length=341

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  140  VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHI  319
            +  R F+S +   RKVA+LGA+GGIGQP+SLL+K +PL+SHLSLFDI  TPGVAAD+SHI
Sbjct  16   IVARNFSSTARANRKVAVLGASGGIGQPMSLLLKQSPLISHLSLFDIVHTPGVAADLSHI  75

Query  320  NTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLS  481
             TR++V G +G++ LG AL+G +VV+IPAGVPRKPGMTRDDLFN NA IV++L+
Sbjct  76   ETRAKVTGHTGNDELGAALDGCEVVVIPAGVPRKPGMTRDDLFNTNASIVQTLA  129



>ref|XP_003062229.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53941.1| predicted protein [Micromonas pusilla CCMP1545]
Length=319

 Score =   162 bits (409),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +2

Query  182  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN  361
            KVA+LGAAGGIGQP  LLMK+NPLV+ LSL+DIAGTPGVAADVSHINT ++V G++GD  
Sbjct  8    KVAVLGAAGGIGQPCGLLMKMNPLVTELSLYDIAGTPGVAADVSHINTAAQVKGYAGDAE  67

Query  362  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            LG AL+ AD+VIIPAGVPRKPGMTR+DLF INAGIV  L+ A
Sbjct  68   LGAALKDADLVIIPAGVPRKPGMTREDLFKINAGIVAGLTEA  109



>ref|XP_010617282.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X1 [Fukomys 
damarensis]
 gb|KFO35480.1| Malate dehydrogenase, mitochondrial [Fukomys damarensis]
Length=338

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRGF++ +    KVA+LGA+GGIGQPLSLL+K +PLVSHL+L+DIA TPGVAAD+SHI T
Sbjct  14   RRGFSTSTQNNAKVAVLGASGGIGQPLSLLLKNSPLVSHLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>ref|XP_007904356.1| PREDICTED: malate dehydrogenase, mitochondrial [Callorhinchus 
milii]
Length=367

 Score =   162 bits (410),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 107/153 (70%), Gaps = 11/153 (7%)
 Frame = +2

Query  50   FTPFLRSLEIEMRSSMLRSLLKNSVSDGSRVAR-------RGFASGSAPERKVAILGAAG  208
            F    RSLE    SS      ++ V+  SRVAR       R F++ S    KVA+LGAAG
Sbjct  8    FKSCWRSLE----SSRCEEGTESRVNMFSRVARPALASLNRSFSASSQNNSKVAVLGAAG  63

Query  209  GIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGAD  388
            GIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI TR++V G+ G E LG+ L+G +
Sbjct  64   GIGQPLSLLLKNSPLVSQLSLYDIAHTPGVAADLSHIETRAKVTGYLGPEQLGECLKGCE  123

Query  389  VVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            VV+IPAGVPRKPGMTRDDLF  NA IV  LS A
Sbjct  124  VVVIPAGVPRKPGMTRDDLFTTNATIVAVLSEA  156



>ref|XP_008638592.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X2 [Corvus 
brachyrhynchos]
Length=294

 Score =   160 bits (405),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRG A+ +    KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI T
Sbjct  12   RRGIATSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSKLSLYDIAHTPGVAADLSHIET  71

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V GF G E L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV SL++A
Sbjct  72   RASVKGFMGPEQLPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVASLTSA  125



>ref|XP_004568150.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Maylandia 
zebra]
 ref|XP_005743240.1| PREDICTED: malate dehydrogenase, mitochondrial-like isoform X1 
[Pundamilia nyererei]
 ref|XP_005944615.1| PREDICTED: malate dehydrogenase, mitochondrial-like isoform X1 
[Haplochromis burtoni]
Length=337

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  149  RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTR  328
            RG A+ S    KVA+LGA+GGIGQPLSLL+K +PLVSHLSL+DIA TPGVAAD+SHI TR
Sbjct  14   RGLATSSQNNAKVAVLGASGGIGQPLSLLLKNSPLVSHLSLYDIAHTPGVAADLSHIETR  73

Query  329  SEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            ++V G  G + LG AL+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+ A
Sbjct  74   AKVTGHIGPDQLGAALQGCDVVVIPAGVPRKPGMTRDDLFNTNASIVATLTDA  126



>ref|XP_005096166.1| PREDICTED: malate dehydrogenase, mitochondrial-like isoform X2 
[Aplysia californica]
Length=342

 Score =   161 bits (408),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  140  VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHI  319
            VAR+ F++ S  + KVA+LGAAGGIGQPLSLL+K +PL+SHLSL+DIA TPGVAAD+SHI
Sbjct  14   VARKHFSTSSKNDSKVAVLGAAGGIGQPLSLLLKQSPLISHLSLYDIAHTPGVAADLSHI  73

Query  320  NTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  478
             TR +V G  GDE L   ++ AD+V+IPAGVPRKPGMTRDDLFN NA IV +L
Sbjct  74   ETRPKVTGHMGDEQLADCVKDADLVLIPAGVPRKPGMTRDDLFNTNASIVANL  126



>emb|CDR41585.1| CYFA0S07e03818g1_1 [Cyberlindnera fabianii]
Length=335

 Score =   161 bits (407),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = +2

Query  134  SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVS  313
            SR+A+R F+S +A   KVA+LGAAGGIGQPLSLL+KLN  V+ LSL+DI G  GVAAD+S
Sbjct  3    SRIAKRSFSSSAAANYKVAVLGAAGGIGQPLSLLLKLNHRVTDLSLYDIKGAKGVAADIS  62

Query  314  HINTRSEVVGFSGDEN--LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            HI T S+V GFS +E   L KAL GADVV+IPAGVPRKPGMTRDDLFNINA IV+ L++A
Sbjct  63   HIPTNSKVEGFSPEEQEGLSKALSGADVVLIPAGVPRKPGMTRDDLFNINASIVRDLASA  122



>ref|XP_002323942.2| hypothetical protein POPTR_0017s00790g [Populus trichocarpa]
 gb|EEF04075.2| hypothetical protein POPTR_0017s00790g [Populus trichocarpa]
Length=262

 Score =   159 bits (402),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 110/142 (77%), Gaps = 10/142 (7%)
 Frame = +2

Query  62   LRSLEIEMRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMK  241
            LRS    +R    R L+  S S          ++ S PERKVAILGAAGGIGQPL+LL+K
Sbjct  6    LRSSRAALRPCTSRHLVGRSYS----------STESRPERKVAILGAAGGIGQPLALLLK  55

Query  242  LNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRK  421
            LNPL+S LSL+DIA TPGVAADVSHIN+R++V G++G+E L +AL+G+DVVIIPAGVPRK
Sbjct  56   LNPLISSLSLYDIANTPGVAADVSHINSRAQVAGYAGEEQLVEALDGSDVVIIPAGVPRK  115

Query  422  PGMTRDDLFNINAGIVKSLSAA  487
            PGMTRDDLF INAGIVKSL  A
Sbjct  116  PGMTRDDLFKINAGIVKSLCTA  137



>ref|NP_179863.1| peroxisomal NAD-malate dehydrogenase [Arabidopsis thaliana]
 sp|O82399.1|MDHG2_ARATH RecName: Full=Probable malate dehydrogenase, glyoxysomal; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL16276.1|AF428346_1 At2g22780/T30L20.4 [Arabidopsis thaliana]
 gb|AAC63589.1| putative glyoxysomal malate dehydrogenase precursor [Arabidopsis 
thaliana]
 gb|AAO23574.1| At2g22780/T30L20.4 [Arabidopsis thaliana]
 dbj|BAE99124.1| putative glyoxysomal malate dehydrogenase precursor [Arabidopsis 
thaliana]
 gb|AEC07353.1| malate dehydrogenase [Arabidopsis thaliana]
Length=354

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 5/129 (4%)
 Frame = +2

Query  110  LKNSVSDGS---RVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDI  280
            L N ++DGS   RVA R  A G +P  KVAILGAAGGIGQPL++LMK+NPLVS L L+D+
Sbjct  19   LHNQIADGSGLNRVACR--AKGGSPGFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDV  76

Query  281  AGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINA  460
            A  PGV AD+SH++T + V GF G   L +AL G D+VIIPAGVPRKPGMTRDDLFNINA
Sbjct  77   ANAPGVTADISHMDTSAVVRGFLGQPQLEEALTGMDLVIIPAGVPRKPGMTRDDLFNINA  136

Query  461  GIVKSLSAA  487
            GIV++LS A
Sbjct  137  GIVRTLSEA  145



>ref|XP_001418230.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96523.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=335

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 96/126 (76%), Gaps = 8/126 (6%)
 Frame = +2

Query  101  RSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDI  280
            R+L + S    +R   RG+        KVA+LGAAGGIGQP  LLMK+NPLV+ L+L+DI
Sbjct  4    RALRRASNDAIARTRARGY--------KVAVLGAAGGIGQPCGLLMKMNPLVTELALYDI  55

Query  281  AGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINA  460
            AGTPGVAADVSH+NT ++  G++GD  LG AL+ ADVVIIPAGVPRKPGMTRDDLF IN 
Sbjct  56   AGTPGVAADVSHVNTAAQTKGYAGDGELGAALKDADVVIIPAGVPRKPGMTRDDLFAING  115

Query  461  GIVKSL  478
            GIVK L
Sbjct  116  GIVKGL  121



>ref|XP_008638591.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X1 [Corvus 
brachyrhynchos]
 ref|XP_008638593.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X1 [Corvus 
brachyrhynchos]
Length=336

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRG A+ +    KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI T
Sbjct  12   RRGIATSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSKLSLYDIAHTPGVAADLSHIET  71

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V GF G E L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV SL++A
Sbjct  72   RASVKGFMGPEQLPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVASLTSA  125



>ref|XP_005525897.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X1 [Pseudopodoces 
humilis]
 ref|XP_005525898.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X2 [Pseudopodoces 
humilis]
Length=336

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRG A+ +    KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI T
Sbjct  12   RRGIATSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSKLSLYDIAHTPGVAADLSHIET  71

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V GF G E L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV SL++A
Sbjct  72   RASVKGFMGPEQLPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVASLTSA  125



>ref|XP_002500632.1| malate dehydrogenase [Micromonas sp. RCC299]
 gb|ACO61890.1| malate dehydrogenase [Micromonas sp. RCC299]
Length=319

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  ERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGD  355
            E KVA+LGAAGGIGQ LSLL+K+NPL+S L+L+DIA TPGVAAD+SH NT   V G++G+
Sbjct  6    EYKVAVLGAAGGIGQSLSLLLKMNPLISDLALYDIANTPGVAADLSHTNTTCSVKGYAGE  65

Query  356  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            E L  AL+G D+VIIPAGVPRKPGMTRDDLF+INAGIVK+L  A
Sbjct  66   EQLADALKGCDLVIIPAGVPRKPGMTRDDLFSINAGIVKNLCEA  109



>ref|XP_009529225.1| hypothetical protein PHYSODRAFT_286325 [Phytophthora sojae]
 gb|EGZ15476.1| hypothetical protein PHYSODRAFT_286325 [Phytophthora sojae]
Length=335

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +  ++KVA+LGAAGGIGQP+SLL+K    + HLSLFD+  TPGVAAD+ HINT
Sbjct  14   RRAFSTATG-QQKVAVLGAAGGIGQPMSLLLKDCDHIGHLSLFDVVNTPGVAADIGHINT  72

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
             ++V G  G E  G+ALEGADVV+IPAGVPRKPGMTRDDLFN NAGIV+SL+AA
Sbjct  73   HAKVTGHVGMEQAGEALEGADVVVIPAGVPRKPGMTRDDLFNTNAGIVQSLAAA  126



>ref|XP_007433827.1| PREDICTED: malate dehydrogenase, mitochondrial [Python bivittatus]
Length=338

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRGF + S    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRGFGTTSQNNAKVAVLGASGGIGQPLSLLLKNSPLVSQLNLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+EV GF G E L + L+G++VV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RAEVKGFLGPEQLPECLKGSEVVVIPAGVPRKPGMTRDDLFNTNATIVANLAAA  127



>gb|ACH45805.1| putative malate dehydrogenase mitochondrial variant 1 [Taeniopygia 
guttata]
Length=338

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRG A+ +    KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI T
Sbjct  14   RRGIATSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSKLSLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V GF G E L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV SL+ A
Sbjct  74   RANVKGFMGPEQLPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVASLTTA  127



>gb|KFB40725.1| AGAP001903-PA-like protein [Anopheles sinensis]
Length=337

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 101/130 (78%), Gaps = 4/130 (3%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            M    +K + S G++     F++ S    KVA+ GA+GGIGQPLSLL+K +PLV+ LSL+
Sbjct  1    MFARAVKAAASQGAK----NFSTSSQNNVKVAVCGASGGIGQPLSLLLKNSPLVTELSLY  56

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DI  TPGVAAD+SHI T+S+V G++G ENL KAL+GAD+VIIPAGVPRKPGMTRDDLFN 
Sbjct  57   DIVHTPGVAADLSHIETQSKVTGYNGPENLEKALKGADIVIIPAGVPRKPGMTRDDLFNT  116

Query  455  NAGIVKSLSA  484
            NA IV+ L+A
Sbjct  117  NASIVRDLAA  126



>gb|ACH45802.1| putative malate dehydrogenase mitochondrial variant 2 [Taeniopygia 
guttata]
 gb|ACH45807.1| putative malate dehydrogenase mitochondrial variant 1 [Taeniopygia 
guttata]
Length=338

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRG A+ +    KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI T
Sbjct  14   RRGIATSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSKLSLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V GF G E L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV SL+ A
Sbjct  74   RANVKGFMGPEQLPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVASLTTA  127



>gb|AAF27650.1|AF218064_1 malate dehydrogenase precursor [Nucella lapillus]
Length=341

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 99/132 (75%), Gaps = 9/132 (7%)
 Frame = +2

Query  86   RSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHL  265
            R S    L ++  S  S+V +         + KVA+LGAAGGIGQPLSLL+K  PL+SHL
Sbjct  7    RPSQTLCLFRHHFSTSSKVGK---------DVKVAVLGAAGGIGQPLSLLLKEIPLISHL  57

Query  266  SLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDL  445
            +L+DIA TPGVAAD+SHI TR++V GF G E L K LEGA++V+IPAGVPRKPGMTRDDL
Sbjct  58   NLYDIAHTPGVAADLSHIETRAKVAGFLGPEELDKCLEGANIVLIPAGVPRKPGMTRDDL  117

Query  446  FNINAGIVKSLS  481
            FN NAGIV+ L+
Sbjct  118  FNTNAGIVRDLT  129



>gb|ETN58378.1| mitochondrial malate dehydrogenase 2 [Anopheles darlingi]
Length=337

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  119  SVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGV  298
            +V   +  + + F++ S    KVA+ GA+GGIGQPLSLL+K +PLV+ LSL+DI  TPGV
Sbjct  5    AVKTAATQSAKNFSTSSQNNVKVAVCGASGGIGQPLSLLLKNSPLVTELSLYDIVHTPGV  64

Query  299  AADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL  478
            AAD+SHI T+S+V G++G ENL KAL+GAD+VIIPAGVPRKPGMTRDDLFN NA IV+ L
Sbjct  65   AADLSHIETQSKVTGYNGPENLEKALKGADIVIIPAGVPRKPGMTRDDLFNTNASIVRDL  124

Query  479  SA  484
            +A
Sbjct  125  AA  126



>ref|XP_001979676.1| GG22759 [Drosophila erecta]
 gb|EDV48634.1| GG22759 [Drosophila erecta]
Length=336

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 97/129 (75%), Gaps = 4/129 (3%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            ML+ + K     G R     F+ G     KV + GAAGGIGQPLSLL+K NPLVS L+L+
Sbjct  1    MLKQVTKQLALQGVRT----FSVGQQNNYKVTVCGAAGGIGQPLSLLLKQNPLVSDLALY  56

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DI  TPGVAAD+SHI+T+S+  GF G + LG +L+G+DVV+IPAGVPRKPGMTRDDLFN+
Sbjct  57   DIVHTPGVAADLSHIDTKSKTAGFIGADQLGDSLKGSDVVVIPAGVPRKPGMTRDDLFNV  116

Query  455  NAGIVKSLS  481
            NAGI+K +S
Sbjct  117  NAGIIKDIS  125



>ref|XP_002899810.1| malate dehydrogenase, mitochondrial precursor [Phytophthora infestans 
T30-4]
 gb|EEY60864.1| malate dehydrogenase, mitochondrial precursor [Phytophthora infestans 
T30-4]
Length=335

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +2

Query  146  RRGFASGSAP-ERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHIN  322
            RR ++S  AP ++KVA+LGAAGGIGQP+SLL+K    ++HLSLFD+  TPGVAAD+ HIN
Sbjct  14   RRAYSS--APGQQKVAVLGAAGGIGQPMSLLLKDCDHINHLSLFDVVNTPGVAADIGHIN  71

Query  323  TRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            T ++V G  G E  G+ALEGADVV+IPAGVPRKPGMTRDDLFN NAGIV+SL+AA
Sbjct  72   THAKVTGHVGMEQAGEALEGADVVVIPAGVPRKPGMTRDDLFNTNAGIVQSLAAA  126



>ref|XP_003443722.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Oreochromis 
niloticus]
Length=337

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  149  RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTR  328
            RG A+ S  + KVA+LGA+GGIGQPLSLL+K +PLVSHLSL+DIA TPGVAAD+SHI TR
Sbjct  14   RGLATSSQNKAKVAVLGASGGIGQPLSLLLKNSPLVSHLSLYDIAHTPGVAADLSHIETR  73

Query  329  SEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            ++V G  G + L  AL+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+ A
Sbjct  74   AKVTGHIGPDQLDAALQGCDVVVIPAGVPRKPGMTRDDLFNTNASIVATLTDA  126



>ref|XP_321163.4| AGAP001903-PA [Anopheles gambiae str. PEST]
 gb|EAA01572.4| AGAP001903-PA [Anopheles gambiae str. PEST]
Length=337

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            M    +K +   G++     F++ S    KVA+ GA+GGIGQPLSLL+K +PLV+ LSL+
Sbjct  1    MFARAVKTAACQGAK----NFSTTSQNNVKVAVCGASGGIGQPLSLLLKNSPLVTELSLY  56

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DI  TPGVAAD+SHI T+S+V G++G ENL KAL+GAD+VIIPAGVPRKPGMTRDDLFN 
Sbjct  57   DIVHTPGVAADLSHIETQSKVTGYNGPENLEKALKGADIVIIPAGVPRKPGMTRDDLFNT  116

Query  455  NAGIVKSLSA  484
            NA IV+ L+A
Sbjct  117  NASIVRDLAA  126



>ref|NP_001232112.1| putative malate dehydrogenase mitochondrial variant 1 [Taeniopygia 
guttata]
 gb|ACH45803.1| putative malate dehydrogenase mitochondrial variant 1 [Taeniopygia 
guttata]
Length=338

 Score =   159 bits (402),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRG A+ +    KVA+LGA+GGIGQPLSLL+K +PLV+ LSL+DIA TPGVAAD+SHI T
Sbjct  14   RRGIATSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVTKLSLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V GF G E L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV SL+ A
Sbjct  74   RANVKGFMGPEQLPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVASLTTA  127



>gb|ETE65153.1| Malate dehydrogenase, mitochondrial, partial [Ophiophagus hannah]
Length=372

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRGF + S    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  48   RRGFGTTSQNHAKVAVLGASGGIGQPLSLLLKNSPLVSQLNLYDIAHTPGVAADLSHIET  107

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+EV GF G E L   L+G++VV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  108  RAEVKGFLGPEQLPDCLKGSEVVVIPAGVPRKPGMTRDDLFNTNATIVATLAAA  161



>ref|XP_002096156.1| GE25523 [Drosophila yakuba]
 gb|EDW95868.1| GE25523 [Drosophila yakuba]
Length=336

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 97/129 (75%), Gaps = 4/129 (3%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            ML+ + K     G R     F+ G     KV + GAAGGIGQPLSLL+K NPLV+ L+L+
Sbjct  1    MLKQVTKQLALQGVRT----FSVGQQNNYKVTVCGAAGGIGQPLSLLLKQNPLVTDLALY  56

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DI  TPGVAAD+SHI+T+S+  GF G + LG +L+G+DVV+IPAGVPRKPGMTRDDLFN+
Sbjct  57   DIVHTPGVAADLSHIDTKSKTAGFIGADQLGDSLKGSDVVVIPAGVPRKPGMTRDDLFNV  116

Query  455  NAGIVKSLS  481
            NAGI+K +S
Sbjct  117  NAGIIKDIS  125



>ref|XP_002880457.1| peroxisomal NAD-malate dehydrogenase 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56716.1| peroxisomal NAD-malate dehydrogenase 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=354

 Score =   159 bits (402),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 100/129 (78%), Gaps = 5/129 (4%)
 Frame = +2

Query  110  LKNSVSDGS---RVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDI  280
            L N + DGS   RVA R  A G +P  KVAILGAAGGIGQPL++LMK+NPLVS L L+D+
Sbjct  19   LDNQMVDGSGLNRVACR--AKGGSPGFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDV  76

Query  281  AGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINA  460
            A  PGV AD+SH++T + V GF G   L +AL G D+VIIPAGVPRKPGMTRDDLFNINA
Sbjct  77   ANAPGVTADISHMDTSAVVRGFLGQPQLEEALTGMDLVIIPAGVPRKPGMTRDDLFNINA  136

Query  461  GIVKSLSAA  487
            GIV++LS A
Sbjct  137  GIVRTLSEA  145



>ref|NP_650696.1| malate dehydrogenase 2 [Drosophila melanogaster]
 ref|XP_002040995.1| GM15290 [Drosophila sechellia]
 gb|AAF55516.1| malate dehydrogenase 2 [Drosophila melanogaster]
 gb|AAM51012.1| RE60471p [Drosophila melanogaster]
 gb|ABK30911.1| IP09655p [Drosophila melanogaster]
 gb|EDW44643.1| GM15290 [Drosophila sechellia]
 gb|ACL92766.1| CG7998-PA [synthetic construct]
Length=336

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 97/129 (75%), Gaps = 4/129 (3%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            ML+ + K     G R     F+ G     KV + GAAGGIGQPLSLL+K NPLV+ L+L+
Sbjct  1    MLKQVTKQLALQGVRT----FSVGQQNNYKVTVCGAAGGIGQPLSLLLKQNPLVTDLALY  56

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DI  TPGVAAD+SHI+T+S+  GF G + LG +L+G+DVV+IPAGVPRKPGMTRDDLFN+
Sbjct  57   DIVHTPGVAADLSHIDTKSKTAGFIGADQLGDSLKGSDVVVIPAGVPRKPGMTRDDLFNV  116

Query  455  NAGIVKSLS  481
            NAGI+K +S
Sbjct  117  NAGIIKDIS  125



>ref|XP_001849862.1| mitochondrial malate dehydrogenase 2 [Culex quinquefasciatus]
 gb|EDS30985.1| mitochondrial malate dehydrogenase 2 [Culex quinquefasciatus]
Length=337

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 99/130 (76%), Gaps = 4/130 (3%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            M    LK+  + G++     F++      KVA+ GA+GGIGQPLSLL+K +PLV+ LSL+
Sbjct  1    MFARTLKSVAAQGAK----NFSTSGQNNVKVAVCGASGGIGQPLSLLLKNSPLVTELSLY  56

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DI  TPGVAAD+SHI TRS+V G++G ENL KAL GAD+VIIPAGVPRKPGMTRDDLFN 
Sbjct  57   DIVHTPGVAADLSHIETRSKVTGYNGPENLEKALAGADIVIIPAGVPRKPGMTRDDLFNT  116

Query  455  NAGIVKSLSA  484
            NA IV+ L+A
Sbjct  117  NASIVRDLAA  126



>ref|XP_002054903.1| GJ22544 [Drosophila virilis]
 gb|EDW68423.1| GJ22544 [Drosophila virilis]
Length=336

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 98/131 (75%), Gaps = 4/131 (3%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            ML+ + K     G R     F+       KV + GA+GGIGQPLSLL+K NPLV+ LSL+
Sbjct  1    MLKQVTKQLALQGVR----NFSVSQQNNYKVTVCGASGGIGQPLSLLLKQNPLVTDLSLY  56

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DI  TPGVAAD+SHI+T+S+ VGF G + LG +L+G+DVV+IPAGVPRKPGMTRDDLFN+
Sbjct  57   DIVHTPGVAADLSHIDTKSKTVGFMGADQLGASLKGSDVVVIPAGVPRKPGMTRDDLFNV  116

Query  455  NAGIVKSLSAA  487
            NAGI+K +S A
Sbjct  117  NAGIIKDISNA  127



>ref|XP_004448330.1| PREDICTED: malate dehydrogenase, mitochondrial [Dasypus novemcinctus]
Length=338

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRGF++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRGFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RATVKGYLGPEQLPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>gb|KHN10168.1| Malate dehydrogenase 1, mitochondrial [Glycine soja]
Length=293

 Score =   157 bits (398),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +2

Query  236  MKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVP  415
            MKLNPLVS LSL+DIAGTPGVAAD+SHINTRSEVVG+ GDE LGKALEGADVVIIPAGVP
Sbjct  1    MKLNPLVSSLSLYDIAGTPGVAADISHINTRSEVVGYQGDEELGKALEGADVVIIPAGVP  60

Query  416  RKPGMTRDDLFNINAGIVKSLSAA  487
            RKPGMTRDDLFNINAGIVK+L  A
Sbjct  61   RKPGMTRDDLFNINAGIVKTLCTA  84



>ref|XP_005648549.1| malate dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE24005.1| malate dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=329

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +2

Query  179  RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  358
            RKVA+LGAAGGIGQPL+LL+K+ PL++ LSL+DIA T GVAAD+SH NT  +V G +G E
Sbjct  18   RKVALLGAAGGIGQPLALLLKMQPLIAELSLYDIANTVGVAADLSHCNTTVKVTGHTGQE  77

Query  359  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            +L  ALEGAD+V+IPAGVPRKPGMTRDDLFNINAGIVK+L+ A
Sbjct  78   SLAAALEGADLVVIPAGVPRKPGMTRDDLFNINAGIVKTLAEA  120



>ref|XP_008928643.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X2 [Manacus 
vitellinus]
Length=296

 Score =   157 bits (398),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRG A+ +    KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI T
Sbjct  14   RRGIATSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSKLSLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLS  481
            +++V GF G E L + L+G D+V+IPAGVPRKPGMTRDDLFN NA IV SL+
Sbjct  74   KAKVKGFMGPEQLPECLKGCDIVVIPAGVPRKPGMTRDDLFNTNASIVASLT  125



>ref|XP_010417035.1| PREDICTED: probable malate dehydrogenase, glyoxysomal isoform 
X1 [Camelina sativa]
Length=354

 Score =   159 bits (402),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = +2

Query  110  LKNSVSDGSRVARRGF-ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAG  286
            L + + DGS V R G  A G +P  KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A 
Sbjct  19   LDDQMVDGSGVNRVGCRAKGGSPGFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVAN  78

Query  287  TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGI  466
             PGV AD+SH++T + V GF G   L +AL G D+V+IPAGVPRKPGMTRDDLFNINAGI
Sbjct  79   APGVTADISHMDTSAIVRGFLGQSQLEEALTGMDLVVIPAGVPRKPGMTRDDLFNINAGI  138

Query  467  VKSLSAA  487
            V++LS A
Sbjct  139  VRTLSEA  145



>ref|XP_008035924.1| malate dehydrogenase [Trametes versicolor FP-101664 SS1]
 gb|EIW62297.1| malate dehydrogenase [Trametes versicolor FP-101664 SS1]
Length=339

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = +2

Query  149  RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTR  328
            R F+S  A + KV +LGA GGIGQPLSLL+KLNP V+ LSL+DI G PGVAADVSHI+T 
Sbjct  15   RQFSSSVARQSKVTVLGAGGGIGQPLSLLLKLNPHVTELSLYDIRGAPGVAADVSHIDTH  74

Query  329  SEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            SEV G+  D+ L +ALEG DVV+IPAGVPRKPGMTRDDLFN NA IV+ L+AA
Sbjct  75   SEVTGYPADQ-LDQALEGTDVVVIPAGVPRKPGMTRDDLFNTNASIVRDLAAA  126



>ref|XP_005187487.1| PREDICTED: malate dehydrogenase, mitochondrial [Musca domestica]
Length=336

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  107  LLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAG  286
            +LK +    +  + R F++      KV + GA+GGIGQPLSLL+K NPLV+ LSL+DI  
Sbjct  1    MLKQATKQLAIQSMRSFSTSRQNNYKVTVCGASGGIGQPLSLLLKQNPLVTSLSLYDIVH  60

Query  287  TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGI  466
            TPGVAAD+SHI+T+S   G+ G + LG AL+GADVV+IPAGVPRKPGMTRDDLFN+NAGI
Sbjct  61   TPGVAADLSHIDTKSSTHGYIGADQLGDALKGADVVVIPAGVPRKPGMTRDDLFNVNAGI  120

Query  467  VKSLSA  484
            +K ++A
Sbjct  121  IKDIAA  126



>ref|XP_006294611.1| hypothetical protein CARUB_v10023648mg [Capsella rubella]
 gb|EOA27509.1| hypothetical protein CARUB_v10023648mg [Capsella rubella]
Length=321

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = +2

Query  110  LKNSVSDGSRVARRGF-ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAG  286
            L + + DGS + R G  A G +P  KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A 
Sbjct  19   LDDQMVDGSGLNRVGCRAKGGSPGFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVAN  78

Query  287  TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGI  466
             PGV AD+SH++T + V GF G   L +AL G D+VIIPAGVPRKPGMTRDDLFNINAGI
Sbjct  79   APGVTADISHMDTSAIVRGFLGQPQLEEALTGMDLVIIPAGVPRKPGMTRDDLFNINAGI  138

Query  467  VKSLSAA  487
            V++LS A
Sbjct  139  VRTLSEA  145



>emb|CAG12894.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=337

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 96/124 (77%), Gaps = 6/124 (5%)
 Frame = +2

Query  134  SRVAR------RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPG  295
            SRV R      R  ++ +    KVA+LGA+GGIGQPLSLL+K +PLVSHLSL+DIA TPG
Sbjct  3    SRVVRPSARLARNLSTSTQNNAKVAVLGASGGIGQPLSLLLKNSPLVSHLSLYDIAHTPG  62

Query  296  VAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKS  475
            VAAD+SHI T+++V G  G E LG AL+G DVV+IPAGVPRKPGMTRDDLFN NA IV +
Sbjct  63   VAADLSHIETKAQVTGHMGPEQLGDALKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVAT  122

Query  476  LSAA  487
            L+ A
Sbjct  123  LADA  126



>gb|ACI66609.1| Malate dehydrogenase, mitochondrial precursor [Salmo salar]
Length=193

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +2

Query  140  VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHI  319
            +A R  ++ S    KVA+LGA+GGIGQPLSLL+K +PLV  LSLFDIA TPGVAAD+SHI
Sbjct  12   IATRSLSTSSQNNAKVAVLGASGGIGQPLSLLLKNSPLVGELSLFDIAHTPGVAADLSHI  71

Query  320  NTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
             TR+ V G+ G + L  AL+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+ A
Sbjct  72   ETRAHVTGYMGPDQLDAALKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLADA  127



>ref|XP_007002564.1| hypothetical protein TREMEDRAFT_42859 [Tremella mesenterica DSM 
1558]
 gb|EIW71478.1| hypothetical protein TREMEDRAFT_42859 [Tremella mesenterica DSM 
1558]
Length=339

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +2

Query  149  RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTR  328
            RGFAS +  ERKVA+LGA GGIGQP+SLL+K +PLV+ L+L+D+ G PGVAAD+SH+NT+
Sbjct  15   RGFASSARAERKVAVLGAGGGIGQPMSLLLKQDPLVTSLALYDVRGAPGVAADISHVNTK  74

Query  329  SEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            SEV G+  D ++  AL+GA++VIIPAGVPRKPGMTRDDLFN NA IV++L+ A
Sbjct  75   SEVKGYGAD-DIASALKGAELVIIPAGVPRKPGMTRDDLFNTNASIVRTLAEA  126



>ref|XP_007513166.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16724.1| predicted protein [Bathycoccus prasinos]
Length=347

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 98/133 (74%), Gaps = 5/133 (4%)
 Frame = +2

Query  101  RSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDI  280
            R LLK S+S  +R+             KVA+LGAAGGIGQP  LLMK+NPLV+ L L+DI
Sbjct  5    RQLLK-SISSSARLFSNHRTQNQTRGYKVAVLGAAGGIGQPCGLLMKMNPLVTELRLYDI  63

Query  281  AGTPGVAADVSHINTRSEVVGFS----GDENLGKALEGADVVIIPAGVPRKPGMTRDDLF  448
            AGTPGVAADVSHINT+++V G+S    G++ L  AL+  D+VIIPAGVPRKPGMTRDDLF
Sbjct  64   AGTPGVAADVSHINTKAQVKGYSQADDGEDGLKNALKDCDLVIIPAGVPRKPGMTRDDLF  123

Query  449  NINAGIVKSLSAA  487
             INAGIVK L  A
Sbjct  124  KINAGIVKGLVEA  136



>gb|KFW86389.1| hypothetical protein N305_15033 [Manacus vitellinus]
Length=337

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRG A+ +    KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI T
Sbjct  14   RRGIATSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSKLSLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLS  481
            +++V GF G E L + L+G D+V+IPAGVPRKPGMTRDDLFN NA IV SL+
Sbjct  74   KAKVKGFMGPEQLPECLKGCDIVVIPAGVPRKPGMTRDDLFNTNASIVASLT  125



>ref|XP_006640874.1| PREDICTED: malate dehydrogenase, mitochondrial-like isoform X2 
[Lepisosteus oculatus]
Length=295

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 6/124 (5%)
 Frame = +2

Query  134  SRVAR------RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPG  295
            SRVAR      RG ++ S    KV++LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPG
Sbjct  3    SRVARPALNIARGLSTSSQNNAKVSVLGASGGIGQPLSLLLKNSPLVSQLSLYDIAHTPG  62

Query  296  VAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKS  475
            VAAD+SHI TR+ V G  G E LG+AL+G++VV+IPAGVPRKPGMTRDDLFN NA IV  
Sbjct  63   VAADLSHIETRAHVTGHMGPEQLGEALKGSEVVVIPAGVPRKPGMTRDDLFNTNATIVAV  122

Query  476  LSAA  487
            L+ A
Sbjct  123  LADA  126



>ref|XP_004343487.1| malate dehydrogenase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE97158.1| malate dehydrogenase [Capsaspora owczarzaki ATCC 30864]
Length=330

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  140  VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHI  319
            V+ R F++ S    KVA+LGAAGGIGQPLSLL+K + LVS L+L+DIA TPGVAAD+SHI
Sbjct  4    VSARAFSTSSINNAKVAVLGAAGGIGQPLSLLLKESTLVSDLALYDIANTPGVAADLSHI  63

Query  320  NTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            NT+S V G++G + LG AL+GA VV+IPAGVPRKPGMTRDDLFN NA IV +L+ A
Sbjct  64   NTKSTVKGYTGADQLGAALKGASVVVIPAGVPRKPGMTRDDLFNTNASIVMNLAKA  119



>ref|XP_008928641.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X1 [Manacus 
vitellinus]
Length=338

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRG A+ +    KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI T
Sbjct  14   RRGIATSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSKLSLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLS  481
            +++V GF G E L + L+G D+V+IPAGVPRKPGMTRDDLFN NA IV SL+
Sbjct  74   KAKVKGFMGPEQLPECLKGCDIVVIPAGVPRKPGMTRDDLFNTNASIVASLT  125



>ref|XP_003848892.1| malate dehydrogenase [Zymoseptoria tritici IPO323]
 gb|EGP83868.1| malate dehydrogenase [Zymoseptoria tritici IPO323]
Length=343

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 95/120 (79%), Gaps = 1/120 (1%)
 Frame = +2

Query  131  GSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADV  310
            G+ V RR F++ ++   KV +LGA GGIGQPLSLL+KLNP V+ L+L+DI G PGVAADV
Sbjct  12   GAAVQRRAFSASASNLSKVVVLGAGGGIGQPLSLLLKLNPRVTELALYDIKGAPGVAADV  71

Query  311  SHINTRSEVVGFSGD-ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
             HINT+S V G+S D E LG  L+GA++V+IPAGVPRKPGMTRDDLFN NA IV+ L+ A
Sbjct  72   GHINTKSTVTGYSPDGEGLGACLKGAEIVVIPAGVPRKPGMTRDDLFNTNASIVRDLAKA  131



>ref|XP_001759853.1| predicted protein [Physcomitrella patens]
 gb|EDQ75357.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  89   SSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLS  268
            +S + +  +N ++   R A R  A G+AP  KVAILGAAGGIGQPLSLLMK++PLVS L 
Sbjct  16   ASHMEAPERNIMTGVEREATR--ARGAAPGFKVAILGAAGGIGQPLSLLMKMSPLVSTLH  73

Query  269  LFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLF  448
            L+D+  TPGV AD+SH NT + V GF G++ LG AL+G D+VIIPAGVPRKPGMTRDDLF
Sbjct  74   LYDVFNTPGVVADLSHTNTSAVVRGFLGNDQLGPALDGMDLVIIPAGVPRKPGMTRDDLF  133

Query  449  NINAGIVKSL  478
            NINAGIV++L
Sbjct  134  NINAGIVRTL  143



>gb|KFK33003.1| hypothetical protein AALP_AA6G317500 [Arabis alpina]
Length=353

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = +2

Query  119  SVSDGSRVARRGF-ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPG  295
             + DGS + R G  A G +P  KVAILGAAGGIGQPL++LMK NPLVS L L+D+A  PG
Sbjct  21   QMCDGSGLKRVGCRAKGGSPGFKVAILGAAGGIGQPLAMLMKTNPLVSLLHLYDVANAPG  80

Query  296  VAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKS  475
            V AD+SH++T + V GF G + L +AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++
Sbjct  81   VTADISHMDTSAIVRGFLGQQQLEEALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRT  140

Query  476  LSAA  487
            LS A
Sbjct  141  LSEA  144



>ref|XP_003055830.1| malate dehydrogenase [Micromonas pusilla CCMP1545]
 gb|EEH59206.1| malate dehydrogenase [Micromonas pusilla CCMP1545]
Length=362

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  ERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGD  355
            E KVA+LGAAGGIGQ LSLL+K+NP+++ L+L+DI GTPGVAAD+SH NT+++V G++G 
Sbjct  50   EYKVAVLGAAGGIGQSLSLLLKMNPMIAQLNLYDIQGTPGVAADLSHTNTQTKVTGYAGA  109

Query  356  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            ++L  AL+G D+VIIPAGVPRKPGMTRDDLF INAGIVK+L  A
Sbjct  110  DSLADALKGCDLVIIPAGVPRKPGMTRDDLFEINAGIVKTLCEA  153



>ref|XP_008056240.1| PREDICTED: malate dehydrogenase, mitochondrial [Tarsius syrichta]
Length=338

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRGF + +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRGFGTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLAAA  127



>emb|CEI99232.1| Putative Malate dehydrogenase [Rhizopus microsporus]
Length=338

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 94/116 (81%), Gaps = 1/116 (1%)
 Frame = +2

Query  143  ARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHIN  322
            A+R F++ SA   KVA+LGAAGGIGQPLSLL+K NP V+HLSL+DI   PGVAAD+SHIN
Sbjct  13   AKRSFSTSSANLTKVAVLGAAGGIGQPLSLLLKENPHVTHLSLYDIVNAPGVAADLSHIN  72

Query  323  TRSEVVGFSGD-ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            T S+V G S + + L  ALEGA VV+IPAGVPRKPGMTRDDLFN NAGIV+ L+ A
Sbjct  73   TNSKVTGHSPEGDGLKAALEGAHVVVIPAGVPRKPGMTRDDLFNTNAGIVRDLAEA  128



>ref|XP_001359972.1| GA20754 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002019816.1| GL12005 [Drosophila persimilis]
 gb|EAL29124.1| GA20754 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW38450.1| GL12005 [Drosophila persimilis]
Length=336

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  149  RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTR  328
            R F+       KV + GA+GGIGQPLSLL+K NPLV+ LSL+DI  TPGVAAD+SHI+T+
Sbjct  15   RNFSVSQQNNFKVTVCGASGGIGQPLSLLLKQNPLVTDLSLYDIVHTPGVAADLSHIDTK  74

Query  329  SEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            S+ VGF G + LG++L+G+DVV+IPAGVPRKPGMTRDDLFN+NAGI+K ++++
Sbjct  75   SKTVGFMGADQLGESLKGSDVVVIPAGVPRKPGMTRDDLFNVNAGIIKDIASS  127



>gb|KGB76526.1| malate dehydrogenase [Cryptococcus gattii R265]
Length=296

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 98/129 (76%), Gaps = 6/129 (5%)
 Frame = +2

Query  101  RSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDI  280
            R + KNS S       RGFAS +   RKVA+LGAAGGIGQP+SLL+K NP V+ LSL+DI
Sbjct  4    RQVAKNSSS-----LARGFASSARSNRKVAVLGAAGGIGQPMSLLLKQNPGVTALSLYDI  58

Query  281  AGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINA  460
             G PGVAAD+SH+NT S V GF  D ++ +AL GA++VIIPAGVPRKPGMTRDDLFN NA
Sbjct  59   RGAPGVAADISHVNTHSTVKGFEKD-DIKEALTGAEIVIIPAGVPRKPGMTRDDLFNTNA  117

Query  461  GIVKSLSAA  487
             IV+ L+ A
Sbjct  118  SIVRDLAEA  126



>ref|XP_009955651.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X2 [Leptosomus 
discolor]
Length=296

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            R+ F +G     KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI T
Sbjct  14   RQTFPTGERCNAKVAVLGASGGIGQPLSLLLKNSPLVSRLSLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V GF G E L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L++A
Sbjct  74   RANVKGFLGPEQLPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVATLTSA  127



>ref|XP_005154369.1| PREDICTED: malate dehydrogenase, mitochondrial [Melopsittacus 
undulatus]
Length=346

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = +2

Query  83   MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH  262
            M S + R +       G+ V RRG A+ +    KVA+LGA+GGIGQPLSLL+K +PLVS 
Sbjct  1    MLSRIARPVAAAGAGTGTGVLRRGLATSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSK  60

Query  263  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD  442
            LSL+DIA TPGVAAD+SHI T++ V GF G E L + L+G +VV+IPAGVPRKPGMTRDD
Sbjct  61   LSLYDIAHTPGVAADLSHIETKANVKGFMGPEQLPECLKGCNVVVIPAGVPRKPGMTRDD  120

Query  443  LFNINAGIVKSLSAA  487
            LFN NA IV +L++A
Sbjct  121  LFNTNASIVATLTSA  135



>emb|CDS03373.1| Putative Malate dehydrogenase [Absidia idahoensis var. thermophila]
Length=338

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +2

Query  134  SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVS  313
            S  A+R F++ +A   KVA+LGA+GGIGQPLSLL+K NP V+ LSL+DI  TPGVAAD+S
Sbjct  10   SVAAKRAFSTSAANLSKVAVLGASGGIGQPLSLLLKENPHVTELSLYDIVNTPGVAADLS  69

Query  314  HINTRSEVVGFSGDEN-LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            HINT S V G++G+++ L KALEGA VV+IPAGVPRKPGMTRDDLFN NA IV+ L+ A
Sbjct  70   HINTNSVVKGYTGEKDGLKKALEGAHVVVIPAGVPRKPGMTRDDLFNTNASIVRDLAEA  128



>gb|EIE83614.1| malate dehydrogenase, NAD-dependent [Rhizopus delemar RA 99-880]
Length=337

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 1/119 (1%)
 Frame = +2

Query  134  SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVS  313
            S  A+R F++ +A   KVA+LGAAGGIGQPLSLL+K NP V+HLSL+DI  TPGVAAD+S
Sbjct  9    SIAAKRSFSTSAANLSKVAVLGAAGGIGQPLSLLLKENPHVTHLSLYDIVNTPGVAADLS  68

Query  314  HINTRSEVVGFS-GDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            HINT S+V G +  +E L  ALEGA VV+IPAGVPRKPGMTRDDLFN NA IV+ L+ A
Sbjct  69   HINTNSKVTGHTPENEGLKTALEGAHVVVIPAGVPRKPGMTRDDLFNTNASIVRDLAEA  127



>ref|XP_005892889.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X2 [Bos 
mutus]
Length=296

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>dbj|GAA96214.1| hypothetical protein E5Q_02878 [Mixia osmundae IAM 14324]
 gb|KEI42206.1| hypothetical protein L969DRAFT_69061 [Mixia osmundae IAM 14324]
Length=346

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 1/119 (1%)
 Frame = +2

Query  134  SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVS  313
            S VA+RGF++ SA   KVA+LGAAGGIGQPLSLL+K NP VS L+L+DI G PGVAAD+S
Sbjct  12   SAVAQRGFSTSSASLTKVAVLGAAGGIGQPLSLLLKQNPKVSDLALYDIRGAPGVAADIS  71

Query  314  HINTRSEVVGFSGDEN-LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            HINT S   G+  D + L KAL+G+++V+IPAGVPRKPGM+RDDLFN NA IV+ L+ A
Sbjct  72   HINTASSTTGYLADNDGLAKALKGSEIVVIPAGVPRKPGMSRDDLFNTNASIVRDLAKA  130



>ref|XP_007468863.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X2 [Lipotes 
vexillifer]
Length=296

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>ref|XP_010429212.1| PREDICTED: probable malate dehydrogenase, glyoxysomal [Camelina 
sativa]
Length=354

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = +2

Query  110  LKNSVSDGSRVARRGF-ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAG  286
            L + + DGS + R G  A G +P  KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A 
Sbjct  19   LDDQMVDGSGLNRVGCRAKGGSPGFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVAN  78

Query  287  TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGI  466
             PGV AD+SH++T + V GF G   L +AL G D+V+IPAGVPRKPGMTRDDLFNINAGI
Sbjct  79   APGVTADISHMDTSAIVRGFLGQPQLEEALTGMDLVVIPAGVPRKPGMTRDDLFNINAGI  138

Query  467  VKSLSAA  487
            V++LS A
Sbjct  139  VRTLSEA  145



>ref|XP_006180996.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X2 [Camelus 
ferus]
 ref|XP_006201455.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X2 [Vicugna 
pacos]
Length=296

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>ref|XP_005662012.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X1 [Sus 
scrofa]
Length=296

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>ref|XP_004630505.1| PREDICTED: malate dehydrogenase, mitochondrial [Octodon degus]
Length=338

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F+S +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSSSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>ref|XP_007186626.1| PREDICTED: malate dehydrogenase, mitochondrial [Balaenoptera 
acutorostrata scammoni]
Length=338

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V GF G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RATVKGFLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>ref|XP_006733971.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X2 [Leptonychotes 
weddellii]
Length=296

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPL+LL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQNNAKVAVLGASGGIGQPLALLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +LSAA
Sbjct  74   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVATLSAA  127



>gb|KFM73959.1| Malate dehydrogenase, mitochondrial, partial [Stegodyphus mimosarum]
Length=330

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 97/131 (74%), Gaps = 3/131 (2%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            M  +L K  VS    +  R F+S +    KVA+LGA+GGIGQP+SLL+K +PLVSHLSL+
Sbjct  1    MFSTLSKTVVSS---IFCRNFSSSAKRSAKVAVLGASGGIGQPMSLLIKQSPLVSHLSLY  57

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DIA TPGVAAD+SHINT ++V G  G E L   LE  D+V+IPAGVPRKPGMTRDDLFN 
Sbjct  58   DIAHTPGVAADLSHINTAAKVTGHLGPEQLDACLEKCDIVVIPAGVPRKPGMTRDDLFNT  117

Query  455  NAGIVKSLSAA  487
            NA IV+ L+ A
Sbjct  118  NASIVRDLADA  128



>ref|XP_006640873.1| PREDICTED: malate dehydrogenase, mitochondrial-like isoform X1 
[Lepisosteus oculatus]
Length=337

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 6/124 (5%)
 Frame = +2

Query  134  SRVAR------RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPG  295
            SRVAR      RG ++ S    KV++LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPG
Sbjct  3    SRVARPALNIARGLSTSSQNNAKVSVLGASGGIGQPLSLLLKNSPLVSQLSLYDIAHTPG  62

Query  296  VAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKS  475
            VAAD+SHI TR+ V G  G E LG+AL+G++VV+IPAGVPRKPGMTRDDLFN NA IV  
Sbjct  63   VAADLSHIETRAHVTGHMGPEQLGEALKGSEVVVIPAGVPRKPGMTRDDLFNTNATIVAV  122

Query  476  LSAA  487
            L+ A
Sbjct  123  LADA  126



>ref|XP_010363204.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Rhinopithecus 
roxellana]
Length=226

 Score =   153 bits (387),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            ++ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   KAVVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLAAA  127



>ref|XP_006794972.1| PREDICTED: malate dehydrogenase, mitochondrial-like [Neolamprologus 
brichardi]
Length=337

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  149  RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTR  328
            RG A+ S    KVA+LGA+GGIGQPLSLL+K +PLVSHLSL+DIA TPGVAAD+SHI TR
Sbjct  14   RGLATSSQNNAKVAVLGASGGIGQPLSLLLKNSPLVSHLSLYDIAHTPGVAADLSHIETR  73

Query  329  SEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            ++V G  G + L  AL+G +VV+IPAGVPRKPGMTRDDLFN NA IV +L+ A
Sbjct  74   AKVTGHIGPDQLDAALQGCEVVVIPAGVPRKPGMTRDDLFNTNATIVATLADA  126



>ref|XP_010472275.1| PREDICTED: probable malate dehydrogenase, glyoxysomal [Camelina 
sativa]
Length=354

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = +2

Query  110  LKNSVSDGSRVARRGF-ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAG  286
            L + + DGS + R G  A G +P  KVAILGAAGGIGQPL++LMK+NPLVS L L+D+A 
Sbjct  19   LDDQMVDGSGLNRVGCRAKGGSPGFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVAN  78

Query  287  TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGI  466
             PGV AD+SH++T + V GF G   L +AL G D+V+IPAGVPRKPGMTRDDLFNINAGI
Sbjct  79   APGVTADISHMDTSAIVRGFLGQPQLEEALTGMDLVVIPAGVPRKPGMTRDDLFNINAGI  138

Query  467  VKSLSAA  487
            V++LS A
Sbjct  139  VRTLSEA  145



>ref|XP_002596683.1| hypothetical protein BRAFLDRAFT_114460 [Branchiostoma floridae]
 gb|EEN52695.1| hypothetical protein BRAFLDRAFT_114460 [Branchiostoma floridae]
Length=340

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +2

Query  143  ARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHIN  322
            A R F+S +A   KVA+LGA+GGIGQPLSLL+K NP+++ L+L+DIA TPGVA D+SHI 
Sbjct  17   ALRNFSSTTACNNKVAVLGASGGIGQPLSLLLKNNPVITQLALYDIAHTPGVACDLSHIE  76

Query  323  TRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            T SEV GF GD  LG  L+G ++V+IPAGVPRKPGMTRDDLFN NA IV+ L  A
Sbjct  77   TGSEVKGFLGDAELGACLDGCEIVVIPAGVPRKPGMTRDDLFNTNASIVRDLVKA  131



>ref|XP_003416634.1| PREDICTED: malate dehydrogenase, mitochondrial [Loxodonta africana]
Length=338

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SH+ T
Sbjct  14   RRSFSTSAQSNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHVET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R++V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RADVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>ref|XP_010695343.1| PREDICTED: malate dehydrogenase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010695344.1| PREDICTED: malate dehydrogenase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010695345.1| PREDICTED: malate dehydrogenase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010695346.1| PREDICTED: malate dehydrogenase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010695347.1| PREDICTED: malate dehydrogenase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=415

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 104/137 (76%), Gaps = 5/137 (4%)
 Frame = +2

Query  77   IEMRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLV  256
            I +R+S  R  +K ++   + +  +  AS      KVA+LGAAGGIGQPL+LL+K++PLV
Sbjct  68   IALRNSYERRAVKQNIQSVASLQPKVEAS-----FKVAVLGAAGGIGQPLALLVKMSPLV  122

Query  257  SHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTR  436
            S+L L+DIA   GVAAD+SH NT SEV+ F+G E LG AL+G DVV+IPAGVPRKPGMTR
Sbjct  123  SNLHLYDIANVKGVAADLSHCNTPSEVLPFTGPEQLGDALKGVDVVVIPAGVPRKPGMTR  182

Query  437  DDLFNINAGIVKSLSAA  487
            DDLFNINAGIVK+L  A
Sbjct  183  DDLFNINAGIVKTLVEA  199



>ref|XP_006859745.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X2 [Chrysochloris 
asiatica]
Length=296

 Score =   155 bits (392),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRGF++      KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRGFSTSVQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G + L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RANVKGYLGPDQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLAAA  127



>ref|XP_001999857.1| GI24757 [Drosophila mojavensis]
 gb|EDW15318.1| GI24757 [Drosophila mojavensis]
Length=336

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 96/129 (74%), Gaps = 4/129 (3%)
 Frame = +2

Query  95   MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF  274
            ML+ + K     G R     F+       KV + GA+GGIGQPLSLL+K NPLV+ LSL+
Sbjct  1    MLKQVTKQLALQGVR----NFSVSQQNNYKVTVCGASGGIGQPLSLLLKQNPLVTDLSLY  56

Query  275  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI  454
            DI  TPGVAAD+SHI+T+S+  GF G + LG +L+G+DVV+IPAGVPRKPGMTRDDLFN+
Sbjct  57   DIVHTPGVAADLSHIDTKSKTTGFMGADQLGDSLKGSDVVVIPAGVPRKPGMTRDDLFNV  116

Query  455  NAGIVKSLS  481
            NAGI+K +S
Sbjct  117  NAGIIKDIS  125



>gb|AAA39509.1| malate dehydrogenase [Mus musculus]
Length=338

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R++V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RAKVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>ref|XP_004840144.1| PREDICTED: malate dehydrogenase, mitochondrial [Heterocephalus 
glaber]
Length=338

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSTQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>emb|CEG68956.1| Putative Malate dehydrogenase [Rhizopus microsporus]
 emb|CEJ02645.1| Putative Malate dehydrogenase [Rhizopus microsporus]
Length=338

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 1/116 (1%)
 Frame = +2

Query  143  ARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHIN  322
            A+R F++ SA   KVA+LGAAGGIGQPLSLL+K NP V+HLSL+DI   PGVAAD+SHIN
Sbjct  13   AKRSFSTSSANLTKVAVLGAAGGIGQPLSLLLKENPHVTHLSLYDIVNAPGVAADLSHIN  72

Query  323  TRSEVVGFSGD-ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            T S+V G S + E L  ALE A VV+IPAGVPRKPGMTRDDLFN NAGIV+ L+ A
Sbjct  73   TNSKVTGHSPEGEGLKAALEDAHVVVIPAGVPRKPGMTRDDLFNTNAGIVRDLAEA  128



>ref|XP_004399137.1| PREDICTED: malate dehydrogenase, mitochondrial [Odobenus rosmarus 
divergens]
Length=338

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  140  VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHI  319
            V RR F++ +    KVA+LGA+GGIGQPL+LL+K +PLVS L+L+DIA TPGVAAD+SHI
Sbjct  12   VLRRSFSTSAQNNAKVAVLGASGGIGQPLALLLKNSPLVSRLTLYDIAHTPGVAADLSHI  71

Query  320  NTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
             TR+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +LSAA
Sbjct  72   ETRATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVATLSAA  127



>ref|XP_001703167.1| malate dehydrogenase [Chlamydomonas reinhardtii]
 sp|Q42686.1|MDHM_CHLRE RecName: Full=Malate dehydrogenase, mitochondrial; Flags: Precursor 
[Chlamydomonas reinhardtii]
 gb|AAA84971.1| malate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDO96543.1| malate dehydrogenase [Chlamydomonas reinhardtii]
Length=373

 Score =   157 bits (397),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 88/103 (85%), Gaps = 1/103 (1%)
 Frame = +2

Query  179  RKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDE  358
            RKVA+LGAAGGIGQPLS+LMK+N  VS LSL+DIAGTPGVAADVSHINT+++V GF  D 
Sbjct  63   RKVAVLGAAGGIGQPLSMLMKMNSQVSSLSLYDIAGTPGVAADVSHINTKAQVKGFDKD-  121

Query  359  NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
             L +AL G D+VIIPAGVPRKPGMTRDDLF INAGIV+ L  A
Sbjct  122  GLAEALRGCDLVIIPAGVPRKPGMTRDDLFKINAGIVRDLVTA  164



>ref|XP_005284503.1| PREDICTED: malate dehydrogenase, mitochondrial [Chrysemys picta 
bellii]
Length=338

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            R+G A+ +    +VA+LGA+GGIGQPLSLL+K +PLVSHL+L+DIA TPGVAAD+SHI T
Sbjct  14   RKGIATSAQSNARVAVLGASGGIGQPLSLLLKNSPLVSHLNLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V GF G E L   L+G +VV+IPAGVPRKPGMTRDDLFN NA IV +L++A
Sbjct  74   RANVKGFIGSEQLPDCLKGCEVVVIPAGVPRKPGMTRDDLFNTNATIVANLTSA  127



>ref|XP_003770242.1| PREDICTED: malate dehydrogenase, mitochondrial [Sarcophilus harrisii]
Length=338

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RRG ++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRGLSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RANVKGYMGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLAAA  127



>gb|ACY66481.1| malate dehydrogenase [Scylla paramamosain]
Length=158

 Score =   151 bits (381),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  149  RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTR  328
            + F++ +A +RKVA++GA+GGIGQPLS+L+K +PLV+ LSL+DI  TPGVAAD+SHI + 
Sbjct  18   KNFSTTNAAQRKVAVMGASGGIGQPLSMLLKNSPLVTQLSLYDIVHTPGVAADLSHIESP  77

Query  329  SEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            ++V G+ G E L  +L+G +VV+IPAGVPRKPGMTRDDLFN NA IV +L+ A
Sbjct  78   AKVTGYVGPEQLADSLKGCEVVVIPAGVPRKPGMTRDDLFNTNASIVANLAKA  130



>ref|XP_009955650.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X1 [Leptosomus 
discolor]
Length=338

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            R+ F +G     KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPGVAAD+SHI T
Sbjct  14   RQTFPTGERCNAKVAVLGASGGIGQPLSLLLKNSPLVSRLSLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V GF G E L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L++A
Sbjct  74   RANVKGFLGPEQLPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVATLTSA  127



>ref|XP_006971340.1| PREDICTED: malate dehydrogenase, mitochondrial [Peromyscus maniculatus 
bairdii]
Length=338

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSTQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>ref|XP_003195123.1| malate dehydrogenase [Cryptococcus gattii WM276]
 gb|ADV23336.1| Malate dehydrogenase, putative [Cryptococcus gattii WM276]
 gb|KIR49147.1| malate dehydrogenase, NAD-dependent [Cryptococcus gattii CA1280]
 gb|KIR52000.1| malate dehydrogenase, NAD-dependent [Cryptococcus gattii Ru294]
 gb|KIR68208.1| malate dehydrogenase, NAD-dependent [Cryptococcus gattii CA1873]
 gb|KIR77926.1| malate dehydrogenase, NAD-dependent [Cryptococcus gattii EJB2]
 gb|KIR88649.1| malate dehydrogenase, NAD-dependent [Cryptococcus gattii IND107]
 gb|KIY32009.1| malate dehydrogenase, NAD-dependent [Cryptococcus gattii E566]
 gb|KJE03275.1| malate dehydrogenase, NAD-dependent [Cryptococcus gattii NT-10]
Length=338

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 98/129 (76%), Gaps = 6/129 (5%)
 Frame = +2

Query  101  RSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDI  280
            R + KNS S       RGFAS +   RKVA+LGAAGGIGQP+SLL+K NP V+ LSL+DI
Sbjct  4    RQVAKNSSS-----LARGFASSARSNRKVAVLGAAGGIGQPMSLLLKQNPGVTALSLYDI  58

Query  281  AGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINA  460
             G PGVAAD+SH+NT S V GF  D ++ +AL GA++VIIPAGVPRKPGMTRDDLFN NA
Sbjct  59   RGAPGVAADISHVNTHSTVKGFEKD-DIKEALTGAEIVIIPAGVPRKPGMTRDDLFNTNA  117

Query  461  GIVKSLSAA  487
             IV+ L+ A
Sbjct  118  SIVRDLAEA  126



>gb|KIR27685.1| malate dehydrogenase, NAD-dependent [Cryptococcus gattii LA55]
 gb|KIR31701.1| malate dehydrogenase, NAD-dependent [Cryptococcus gattii MMRL2647]
 gb|KIR42027.1| malate dehydrogenase, NAD-dependent [Cryptococcus gattii Ram5]
 gb|KIR73149.1| malate dehydrogenase, NAD-dependent [Cryptococcus gattii CA1014]
 gb|KIR90074.1| malate dehydrogenase, NAD-dependent [Cryptococcus gattii CBS 
10090]
 gb|KIR98904.1| malate dehydrogenase, NAD-dependent [Cryptococcus gattii 2001/935-1]
 gb|KIY55922.1| malate dehydrogenase, NAD-dependent [Cryptococcus gattii 99/473]
Length=338

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 98/129 (76%), Gaps = 6/129 (5%)
 Frame = +2

Query  101  RSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDI  280
            R + KNS S       RGFAS +   RKVA+LGAAGGIGQP+SLL+K NP V+ LSL+DI
Sbjct  4    RQVAKNSSS-----LARGFASSARSNRKVAVLGAAGGIGQPMSLLLKQNPGVTALSLYDI  58

Query  281  AGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINA  460
             G PGVAAD+SH+NT S V GF  D ++ +AL GA++VIIPAGVPRKPGMTRDDLFN NA
Sbjct  59   RGAPGVAADISHVNTHSTVKGFEKD-DIKEALTGAEIVIIPAGVPRKPGMTRDDLFNTNA  117

Query  461  GIVKSLSAA  487
             IV+ L+ A
Sbjct  118  SIVRDLAEA  126



>ref|XP_005080427.1| PREDICTED: malate dehydrogenase, mitochondrial [Mesocricetus 
auratus]
Length=338

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RANVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>ref|XP_007518009.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X2 [Erinaceus 
europaeus]
Length=296

 Score =   155 bits (391),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRTFSTSTQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV++PAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RANVKGYLGPEQLPDCLKGCDVVVVPAGVPRKPGMTRDDLFNTNATIVATLAAA  127



>emb|CAA27812.1| unnamed protein product [Rattus norvegicus]
Length=338

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RANVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>gb|AFA55184.1| mitochondrial malate dehydrogenase 2 [Ochotona curzoniae]
Length=338

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQTHAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLAAA  127



>ref|XP_792004.2| PREDICTED: malate dehydrogenase, mitochondrial-like [Strongylocentrotus 
purpuratus]
Length=337

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  149  RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTR  328
            + F++      KVA+LGA+GGIGQPLSLL+K +P++S LSL+DIA TPGVAAD+SHI TR
Sbjct  17   KSFSTSCEANSKVAVLGASGGIGQPLSLLLKESPMISQLSLYDIAHTPGVAADLSHIETR  76

Query  329  SEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            + V G  G + LG+AL+G DVV+IPAGVPRKPGMTRDDLFN NA IV+ L  A
Sbjct  77   ANVTGHMGPDQLGEALQGCDVVLIPAGVPRKPGMTRDDLFNTNASIVRDLCKA  129



>ref|XP_008592813.1| PREDICTED: malate dehydrogenase, mitochondrial [Galeopterus variegatus]
Length=348

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F+S +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  24   RRSFSSSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  83

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  84   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLAAA  137



>ref|XP_004666330.1| PREDICTED: malate dehydrogenase, mitochondrial [Jaculus jaculus]
Length=338

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RANVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLAAA  127



>ref|XP_011197045.1| PREDICTED: malate dehydrogenase, mitochondrial [Bactrocera cucurbitae]
Length=336

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  149  RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTR  328
            RGFA+      KV + GA+GGIGQPLSLL+K NPLVS+L+L+DI  TPGVAAD+SHI+T+
Sbjct  15   RGFATTKQNNFKVTVCGASGGIGQPLSLLLKNNPLVSNLALYDIVHTPGVAADLSHIDTQ  74

Query  329  SEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLS  481
            S   G  G E LGKAL+ ADVV+IPAGVPRKPGMTRDDLFN+NAGI++ ++
Sbjct  75   STTEGHMGPEQLGKALKNADVVVIPAGVPRKPGMTRDDLFNVNAGIIRDIA  125



>emb|CDH57483.1| malate dehydrogenase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=338

 Score =   156 bits (394),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 1/119 (1%)
 Frame = +2

Query  134  SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVS  313
            S  A+R F++ +A   KVA+LGA+GGIGQPLSLLMK NP V+ LSL+DI  TPGVAAD+S
Sbjct  10   SVAAKRAFSTSAANLSKVAVLGASGGIGQPLSLLMKENPHVTELSLYDIVNTPGVAADLS  69

Query  314  HINTRSEVVGFSGDEN-LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            HINT S V G++ + + L KALEGA VV+IPAGVPRKPGMTRDDLFN NA IV+ L+ A
Sbjct  70   HINTNSVVKGYTAENDGLKKALEGAHVVVIPAGVPRKPGMTRDDLFNTNASIVRDLAEA  128



>ref|XP_006155702.1| PREDICTED: malate dehydrogenase, mitochondrial [Tupaia chinensis]
Length=338

 Score =   156 bits (394),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQSNAKVAMLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RANVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLAAA  127



>ref|XP_007104038.1| PREDICTED: malate dehydrogenase, mitochondrial [Physeter catodon]
Length=338

 Score =   156 bits (394),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



>ref|XP_415765.1| PREDICTED: malate dehydrogenase, mitochondrial [Gallus gallus]
Length=351

 Score =   156 bits (394),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 96/124 (77%), Gaps = 6/124 (5%)
 Frame = +2

Query  134  SRVAR------RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPG  295
            SR+AR      RG A+ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPG
Sbjct  17   SRLARPAAVLCRGLATSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPG  76

Query  296  VAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKS  475
            VAAD+SHI TR+ V GF G E L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +
Sbjct  77   VAADLSHIETRANVKGFLGPEQLPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVAT  136

Query  476  LSAA  487
            L+ A
Sbjct  137  LTTA  140



>ref|XP_003211747.1| PREDICTED: malate dehydrogenase, mitochondrial [Meleagris gallopavo]
Length=351

 Score =   156 bits (394),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 95/124 (77%), Gaps = 6/124 (5%)
 Frame = +2

Query  134  SRVAR------RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPG  295
            SR AR      RG A+ +    KVA+LGA+GGIGQPLSLL+K +PLVS LSL+DIA TPG
Sbjct  17   SRFARPAAVLCRGLATSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLSLYDIAHTPG  76

Query  296  VAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKS  475
            VAAD+SHI TR+ V GF G E L + L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +
Sbjct  77   VAADLSHIETRANVKGFLGPEQLPECLKGCDVVVIPAGVPRKPGMTRDDLFNTNASIVAT  136

Query  476  LSAA  487
            L+ A
Sbjct  137  LTTA  140



>ref|XP_005892888.1| PREDICTED: malate dehydrogenase, mitochondrial isoform X1 [Bos 
mutus]
Length=338

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  146  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT  325
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct  14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET  73

Query  326  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA  487
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA
Sbjct  74   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAA  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559954506960