BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF020C10

Length=560
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006350379.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    242   8e-76   Solanum tuberosum [potatoes]
ref|XP_009623368.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    240   4e-75   Nicotiana tomentosiformis
ref|NP_001234574.1|  succinyl-CoA ligase [ADP-forming] subunit al...    238   4e-74   Solanum lycopersicum
gb|AIS71903.1|  mitochondrial succinyl-CoA ligase ADP-forming sub...    236   2e-73   Nicotiana tabacum [American tobacco]
ref|XP_009775900.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    233   2e-73   Nicotiana sylvestris
ref|XP_006348504.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    236   3e-73   Solanum tuberosum [potatoes]
ref|XP_009781531.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    233   3e-72   Nicotiana sylvestris
emb|CDP14400.1|  unnamed protein product                                232   6e-72   Coffea canephora [robusta coffee]
ref|XP_011091459.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    229   1e-70   Sesamum indicum [beniseed]
gb|KJB79847.1|  hypothetical protein B456_013G069200                    224   1e-69   Gossypium raimondii
ref|NP_001234277.1|  succinyl-CoA ligase [ADP-forming] subunit al...    226   2e-69   
gb|AFL48180.1|  succinyl-CoA synthetase                                 226   2e-69   Capsicum annuum
gb|KJB79846.1|  hypothetical protein B456_013G069200                    225   5e-69   Gossypium raimondii
gb|EYU19899.1|  hypothetical protein MIMGU_mgv1a009825mg                223   2e-68   Erythranthe guttata [common monkey flower]
gb|EPS68438.1|  hypothetical protein M569_06331                         223   2e-68   Genlisea aurea
ref|XP_010934473.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    221   1e-67   Elaeis guineensis
gb|KDO52721.1|  hypothetical protein CISIN_1g0195001mg                  218   1e-67   Citrus sinensis [apfelsine]
ref|XP_002271746.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    219   4e-67   Vitis vinifera
gb|KHG06820.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-2...    219   5e-67   Gossypium arboreum [tree cotton]
gb|KHG04322.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    219   7e-67   Gossypium arboreum [tree cotton]
ref|XP_006441424.1|  hypothetical protein CICLE_v10020931mg             216   2e-66   
ref|XP_009355925.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    218   2e-66   Pyrus x bretschneideri [bai li]
ref|XP_006493424.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    218   2e-66   Citrus sinensis [apfelsine]
ref|XP_006374278.1|  hypothetical protein POPTR_0015s056201g            213   3e-66   
ref|XP_007152547.1|  hypothetical protein PHAVU_004G139300g             217   4e-66   Phaseolus vulgaris [French bean]
ref|XP_006394592.1|  hypothetical protein EUTSA_v10004347mg             219   4e-66   
ref|XP_006441425.1|  hypothetical protein CICLE_v10020931mg             218   5e-66   Citrus clementina [clementine]
ref|XP_008375061.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    217   5e-66   Malus domestica [apple tree]
ref|XP_009136375.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    217   5e-66   Brassica rapa
ref|XP_008467310.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    217   6e-66   Cucumis melo [Oriental melon]
ref|XP_002514510.1|  Succinyl-CoA ligase [GDP-forming] subunit al...    216   7e-66   Ricinus communis
ref|XP_010423114.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    217   8e-66   Camelina sativa [gold-of-pleasure]
ref|XP_007043270.1|  Succinyl-CoA ligase, alpha subunit                 217   8e-66   
emb|CDY61908.1|  BnaC07g49680D                                          217   1e-65   Brassica napus [oilseed rape]
ref|XP_006437603.1|  hypothetical protein CICLE_v10032075mg             216   1e-65   Citrus clementina [clementine]
ref|XP_008240339.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    216   1e-65   Prunus mume [ume]
ref|NP_001241205.1|  uncharacterized protein LOC100782001               216   1e-65   Glycine max [soybeans]
ref|XP_007209332.1|  hypothetical protein PRUPE_ppa008341mg             216   2e-65   Prunus persica
ref|XP_010547709.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    216   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_010491456.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    216   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009413310.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    215   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010452813.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    215   4e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006288079.1|  hypothetical protein CARUB_v10001317mg             215   4e-65   Capsella rubella
ref|XP_002514509.1|  Succinyl-CoA ligase [GDP-forming] subunit al...    214   4e-65   Ricinus communis
ref|XP_004137529.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    214   5e-65   Cucumis sativus [cucumbers]
emb|CDX81092.1|  BnaC03g03460D                                          215   5e-65   
ref|XP_008393504.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    214   6e-65   Malus domestica [apple tree]
ref|NP_196447.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha-1     214   6e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871316.1|  hypothetical protein ARALYDRAFT_487662             214   7e-65   
emb|CDY02216.1|  BnaA03g39510D                                          214   8e-65   
ref|XP_003548295.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    214   8e-65   Glycine max [soybeans]
ref|XP_006484523.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    214   8e-65   Citrus sinensis [apfelsine]
ref|XP_002460917.1|  hypothetical protein SORBIDRAFT_02g037420          214   8e-65   Sorghum bicolor [broomcorn]
gb|KJB31856.1|  hypothetical protein B456_005G211200                    213   8e-65   Gossypium raimondii
gb|AFK38534.1|  unknown                                                 210   9e-65   Medicago truncatula
gb|KJB31854.1|  hypothetical protein B456_005G211200                    211   9e-65   Gossypium raimondii
ref|XP_003620150.1|  Succinyl-CoA ligase                                213   1e-64   Medicago truncatula
gb|KJB31855.1|  hypothetical protein B456_005G211200                    211   2e-64   Gossypium raimondii
ref|XP_006288023.1|  hypothetical protein CARUB_v10001256mg             213   2e-64   
ref|XP_003562832.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    212   3e-64   Brachypodium distachyon [annual false brome]
gb|KJB31853.1|  hypothetical protein B456_005G211200                    213   3e-64   Gossypium raimondii
emb|CDX69957.1|  BnaA10g23060D                                          213   4e-64   
ref|XP_006399319.1|  hypothetical protein EUTSA_v10013993mg             213   4e-64   Eutrema salsugineum [saltwater cress]
ref|XP_011047755.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    213   4e-64   Populus euphratica
ref|XP_009125723.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    212   4e-64   Brassica rapa
ref|XP_002268479.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    212   4e-64   Vitis vinifera
ref|XP_010421123.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    212   5e-64   Camelina sativa [gold-of-pleasure]
emb|CBI35274.3|  unnamed protein product                                212   5e-64   Vitis vinifera
emb|CDX78333.1|  BnaA03g02450D                                          212   6e-64   
ref|XP_004958125.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    211   7e-64   Setaria italica
ref|NP_001136494.1|  succinyl-CoA ligase alpha-chain 2                  211   7e-64   Zea mays [maize]
ref|XP_008788992.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    212   7e-64   Phoenix dactylifera
ref|XP_010493442.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    212   8e-64   Camelina sativa [gold-of-pleasure]
emb|CDY21531.1|  BnaC09g47610D                                          211   9e-64   Brassica napus [oilseed rape]
sp|Q6ZL94.1|SUCA_ORYSJ  RecName: Full=Probable succinyl-CoA ligas...    211   9e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011022031.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    211   1e-63   Populus euphratica
gb|KDP45810.1|  hypothetical protein JCGZ_17417                         211   1e-63   Jatropha curcas
ref|XP_011003681.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    212   1e-63   Populus euphratica
ref|XP_002307162.2|  hypothetical protein POPTR_0005s09370g             211   1e-63   
gb|ABK95068.1|  unknown                                                 211   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010087141.1|  Succinyl-CoA ligase [ADP-forming] subunit al...    209   2e-63   
ref|XP_009131054.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    211   2e-63   Brassica rapa
ref|XP_010454606.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    211   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002872045.1|  hypothetical protein ARALYDRAFT_489184             210   2e-63   
gb|KFK27646.1|  hypothetical protein AALP_AA8G410300                    211   2e-63   Arabis alpina [alpine rockcress]
ref|NP_001119263.1|  Succinyl-CoA ligase [GDP-forming] subunit al...    209   2e-63   Arabidopsis thaliana [mouse-ear cress]
gb|KCW57893.1|  hypothetical protein EUGRSUZ_H00643                     207   4e-63   Eucalyptus grandis [rose gum]
gb|AAM65450.1|  succinyl-CoA synthetase, alpha subunit                  210   4e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197716.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha-2     209   4e-63   Arabidopsis thaliana [mouse-ear cress]
gb|KDP45811.1|  hypothetical protein JCGZ_17418                         209   4e-63   Jatropha curcas
ref|XP_004515280.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    209   6e-63   Cicer arietinum [garbanzo]
ref|XP_009122444.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    209   6e-63   Brassica rapa
ref|XP_010069514.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    209   7e-63   Eucalyptus grandis [rose gum]
ref|XP_009389047.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    209   7e-63   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ94034.1|  predicted protein                                      208   9e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010688675.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    209   1e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT17065.1|  Putative succinyl-CoA ligase (GDP-forming) subuni...    209   1e-62   
gb|ACG31861.1|  succinyl-CoA ligase alpha-chain 2                       208   1e-62   Zea mays [maize]
dbj|BAK03449.1|  predicted protein                                      208   1e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008796686.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    208   1e-62   Phoenix dactylifera
ref|NP_001149702.1|  succinyl-CoA ligase alpha-chain 2                  208   1e-62   Zea mays [maize]
gb|AGT16123.1|  succinyl-CoA ligase                                     211   3e-62   Saccharum hybrid cultivar R570
ref|XP_010546242.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    207   3e-62   Tarenaya hassleriana [spider flower]
ref|XP_004299462.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    207   4e-62   Fragaria vesca subsp. vesca
ref|XP_006394390.1|  hypothetical protein EUTSA_v10003962mg             211   7e-62   Eutrema salsugineum [saltwater cress]
ref|XP_010241497.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    206   1e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010031908.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    206   1e-61   Eucalyptus grandis [rose gum]
emb|CAA48891.1|  succinate--CoA ligase (GDP-forming)                    205   2e-61   Arabidopsis thaliana [mouse-ear cress]
gb|ABK94372.1|  unknown                                                 204   4e-61   Populus trichocarpa [western balsam poplar]
ref|XP_006658733.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    203   4e-61   Oryza brachyantha
gb|KHN23614.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    203   1e-60   Glycine soja [wild soybean]
ref|XP_001765853.1|  predicted protein                                  201   9e-60   
gb|KDO46157.1|  hypothetical protein CISIN_1g030169mg                   195   2e-59   Citrus sinensis [apfelsine]
ref|XP_004172973.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    193   4e-59   
ref|XP_002964011.1|  hypothetical protein SELMODRAFT_405593             192   9e-59   
ref|XP_001762925.1|  predicted protein                                  198   1e-58   
ref|XP_002967911.1|  hypothetical protein SELMODRAFT_408824             191   2e-58   
gb|KDO46156.1|  hypothetical protein CISIN_1g030169mg                   191   1e-57   Citrus sinensis [apfelsine]
ref|XP_010923343.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    195   1e-57   Elaeis guineensis
ref|XP_006376608.1|  hypothetical protein POPTR_0012s00920g             192   6e-57   
tpg|DAA41209.1|  TPA: hypothetical protein ZEAMMB73_389921              186   2e-56   
ref|XP_001693108.1|  succinyl-coa ligase alpha chain                    192   3e-56   Chlamydomonas reinhardtii
ref|XP_002507022.1|  succinate-coa ligase                               191   3e-56   Micromonas commoda
ref|XP_002957241.1|  succinate-coa ligase alpha chain, succinyl-C...    190   1e-55   Volvox carteri f. nagariensis
emb|CAN73796.1|  hypothetical protein VITISV_018824                     193   2e-55   Vitis vinifera
gb|KDD74604.1|  hypothetical protein H632_c1190p0                       189   2e-55   Helicosporidium sp. ATCC 50920
emb|CDY44764.1|  BnaC02g01230D                                          190   2e-55   Brassica napus [oilseed rape]
ref|XP_003078495.1|  putative succinyl-CoA ligase alpha subunit (...    189   2e-55   Ostreococcus tauri
gb|KHN24503.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    188   2e-54   Glycine soja [wild soybean]
gb|KIY97057.1|  succinyl-CoA synthetase alpha subunit                   182   3e-54   Monoraphidium neglectum
ref|XP_003054766.1|  predicted protein                                  181   2e-52   Micromonas pusilla CCMP1545
ref|XP_001416813.1|  predicted protein                                  182   2e-52   Ostreococcus lucimarinus CCE9901
ref|XP_005643816.1|  succinyl-CoA ligase alpha chain                    175   3e-50   Coccomyxa subellipsoidea C-169
ref|XP_007512066.1|  predicted protein                                  177   4e-50   Bathycoccus prasinos
dbj|GAM28077.1|  hypothetical protein SAMD00019534_112530               173   4e-49   Acytostelium subglobosum LB1
ref|XP_001780609.1|  predicted protein                                  172   5e-49   
ref|XP_004920729.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    167   2e-48   
ref|XP_009524111.1|  hypothetical protein PHYSODRAFT_557468             169   9e-48   Phytophthora sojae
gb|EDK99001.1|  succinate-CoA ligase, GDP-forming, alpha subunit,...    164   1e-47   Mus musculus [mouse]
ref|XP_008905429.1|  succinyl-CoA ligase [GDP-forming] subunit al...    168   2e-47   Phytophthora parasitica INRA-310
ref|XP_002908607.1|  succinyl-CoA ligase subunit alpha, mitochond...    168   4e-47   Phytophthora infestans T30-4
gb|ACO52022.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    167   4e-47   Rana catesbeiana [bullfrog]
ref|XP_004351803.1|  succinate-CoA ligase                               167   4e-47   Cavenderia fasciculata
ref|XP_004415607.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    167   8e-47   Odobenus rosmarus divergens
gb|ETP44985.1|  succinyl-CoA ligase [GDP-forming] subunit alpha, ...    167   8e-47   Phytophthora parasitica P10297
ref|NP_001025589.1|  succinyl-CoA ligase [ADP/GDP-forming] subuni...    167   8e-47   Xenopus tropicalis [western clawed frog]
ref|XP_009182789.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    167   8e-47   Papio anubis [baboon]
dbj|BAB22331.1|  unnamed protein product                                167   9e-47   Mus musculus [mouse]
dbj|BAB23804.1|  unnamed protein product                                167   1e-46   Mus musculus [mouse]
gb|AAD33927.2|AF144101_1  succinyl-CoA synthetase                       167   1e-46   Mus musculus [mouse]
ref|NP_001270301.1|  uncharacterized protein LOC101867049               167   1e-46   Macaca fascicularis [crab eating macaque]
dbj|BAC40634.1|  unnamed protein product                                167   1e-46   Mus musculus [mouse]
gb|EGV93208.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    167   1e-46   Cricetulus griseus [Chinese hamsters]
gb|KDO21510.1|  succinyl-CoA ligase subunit alpha                       166   1e-46   Saprolegnia parasitica CBS 223.65
ref|XP_003282290.2|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    163   1e-46   Nomascus leucogenys [White-cheeked Gibbon]
ref|NP_063932.2|  succinyl-CoA ligase [ADP/GDP-forming] subunit a...    167   1e-46   Mus musculus [mouse]
ref|XP_007625515.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    167   2e-46   
ref|XP_003505683.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    167   2e-46   Cricetulus griseus [Chinese hamsters]
dbj|BAH12424.1|  unnamed protein product                                164   2e-46   Homo sapiens [man]
ref|WP_035251770.1|  succinate--CoA ligase                              165   3e-46   Actibacterium atlanticum
ref|XP_005837665.1|  hypothetical protein GUITHDRAFT_157241             165   3e-46   Guillardia theta CCMP2712
ref|WP_038463120.1|  succinate--CoA ligase                              165   3e-46   Candidatus Paracaedibacter acanthamoebae
gb|KFP25909.1|  hypothetical protein N325_08777                         160   4e-46   Colius striatus
ref|XP_005843440.1|  hypothetical protein CHLNCDRAFT_141133             165   5e-46   Chlorella variabilis
ref|XP_007536491.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    164   5e-46   Erinaceus europaeus [common hedgehog]
ref|XP_003294260.1|  succinyl coenzyme A synthetase alpha subunit       165   5e-46   Dictyostelium purpureum
ref|XP_010201069.1|  PREDICTED: LOW QUALITY PROTEIN: succinyl-CoA...    160   5e-46   Colius striatus
ref|WP_009540580.1|  Succinyl-CoA ligase [ADP-forming] alpha chain      164   6e-46   Caenispirillum salinarum
ref|XP_004742358.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    165   6e-46   Mustela putorius furo [black ferret]
gb|ERE66319.1|  succinyl-CoA ligase [GDP-forming] subunit alpha         165   6e-46   Cricetulus griseus [Chinese hamsters]
ref|XP_010077723.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    162   6e-46   Pterocles gutturalis
ref|XP_011227722.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    167   6e-46   
ref|XP_010366218.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    165   6e-46   Rhinopithecus roxellana
ref|WP_043744920.1|  succinate--CoA ligase                              164   7e-46   Pseudooceanicola atlanticus
emb|CCA20859.1|  unnamed protein product                                164   7e-46   Albugo laibachii Nc14
emb|CCI47060.1|  unnamed protein product                                164   1e-45   Albugo candida
ref|XP_003420463.2|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    164   1e-45   
ref|XP_002289446.1|  precursor of synthetase                            164   1e-45   Thalassiosira pseudonana CCMP1335
ref|WP_026988416.1|  succinate--CoA ligase                              163   1e-45   Fodinicurvata fenggangensis
ref|XP_008608930.1|  succinyl-CoA ligase [GDP-forming] subunit al...    164   1e-45   Saprolegnia diclina VS20
ref|XP_004660591.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    165   1e-45   Jaculus jaculus
ref|XP_007968242.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    166   1e-45   Chlorocebus sabaeus
ref|XP_001082705.2|  PREDICTED: succinyl-CoA ligase [GDP-forming]...    165   1e-45   
ref|WP_010137369.1|  succinyl-CoA synthetase subsunit alpha             163   1e-45   Oceanicola sp. S124
ref|WP_028287755.1|  succinate--CoA ligase                              163   1e-45   Pseudooceanicola nanhaiensis
ref|XP_004469843.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    164   1e-45   Dasypus novemcinctus
emb|CCI47059.1|  unnamed protein product                                164   1e-45   Albugo candida
ref|XP_006376690.1|  hypothetical protein POPTR_0012s033102g            158   2e-45   
ref|XP_004742357.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    164   2e-45   
ref|WP_022728556.1|  succinyl-CoA synthetase subsunit alpha             163   2e-45   Fodinicurvata sediminis
ref|XP_007470656.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    164   2e-45   Lipotes vexillifer [baiji]
gb|AAH00504.1|  SUCLG1 protein                                          164   2e-45   Homo sapiens [man]
dbj|BAF83771.1|  unnamed protein product                                164   2e-45   Homo sapiens [man]
ref|XP_003816644.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    164   2e-45   Pan paniscus [bonobo]
ref|XP_001164971.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    164   2e-45   
ref|XP_007666525.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    163   2e-45   
ref|XP_002757610.3|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    164   2e-45   Callithrix jacchus [common marmoset]
dbj|BAG36098.1|  unnamed protein product                                164   2e-45   Homo sapiens [man]
ref|XP_007118275.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    164   2e-45   Physeter catodon
ref|NP_003840.2|  succinyl-CoA ligase [ADP/GDP-forming] subunit a...    164   2e-45   Homo sapiens [man]
ref|NP_001126825.1|  succinyl-CoA ligase [ADP/GDP-forming] subuni...    164   2e-45   Pongo abelii [orang utan]
gb|KFP67749.1|  hypothetical protein N322_02167                         159   2e-45   Cariama cristata
ref|XP_008698280.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    164   2e-45   Ursus maritimus [white bear]
gb|EFB17847.1|  hypothetical protein PANDA_011931                       163   2e-45   Ailuropoda melanoleuca
ref|XP_008167941.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    163   3e-45   Chrysemys picta bellii
gb|AAA85724.1|  succinyl coenzyme A synthetase alpha subunit            162   3e-45   Dictyostelium discoideum AX2
ref|WP_022731741.1|  succinyl-CoA synthetase subsunit alpha             162   3e-45   Thalassospira
gb|ABW76150.1|  succinyl-CoA synthetase alpha subunit                   163   3e-45   Blastocystis sp. ATCC 50177/Nand II
ref|XP_005292517.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    163   3e-45   Chrysemys picta bellii
ref|WP_015466944.1|  Succinyl-CoA ligase [ADP-forming] alpha chain      162   4e-45   Micavibrio aeruginosavorus
ref|WP_002721254.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    162   4e-45   Rhodobacter
ref|WP_036634769.1|  succinate--CoA ligase                              162   4e-45   Paenirhodobacter enshiensis
ref|XP_005292518.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    162   4e-45   Chrysemys picta bellii
ref|XP_010400527.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    163   4e-45   
ref|WP_023386589.1|  succinyl-CoA synthetase subsunit alpha             162   4e-45   Anaplasma marginale
ref|WP_011907146.1|  succinyl-CoA synthetase subsunit alpha             162   5e-45   Rhodobacter
ref|XP_009580012.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   5e-45   Fulmarus glacialis
gb|KFV94110.1|  hypothetical protein N327_08715                         159   5e-45   Fulmarus glacialis
ref|XP_011398589.1|  Succinyl-CoA ligase [ADP-forming] subunit al...    162   5e-45   Auxenochlorella protothecoides
ref|XP_636263.1|  succinate-CoA ligase                                  162   5e-45   Dictyostelium discoideum AX4
ref|XP_002180696.1|  ligase succinate-coa ligase                        162   6e-45   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_009703991.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    158   6e-45   Cariama cristata
ref|XP_005292516.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    162   6e-45   
emb|CBJ28950.1|  Succinate--CoA ligase (GDP-forming), alpha subunit     162   7e-45   Ectocarpus siliculosus
ref|XP_008978670.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    163   7e-45   Callithrix jacchus [common marmoset]
ref|WP_038066282.1|  succinate--CoA ligase                              161   8e-45   Thioclava dalianensis
emb|CBK25395.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               162   8e-45   Blastocystis hominis
ref|XP_009441016.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    162   8e-45   
ref|WP_010263012.1|  succinyl-CoA ligase chain A (sucD)                 161   9e-45   Anaplasma marginale
emb|CBK19683.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               161   9e-45   Blastocystis hominis
gb|KFQ29616.1|  hypothetical protein N332_09956                         161   1e-44   Mesitornis unicolor
gb|AAD17940.2|  succinyl-CoA synthetase alpha subunit                   162   1e-44   Homo sapiens [man]
ref|XP_009867186.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    163   1e-44   Apaloderma vittatum
gb|KFV41379.1|  hypothetical protein N341_08030                         161   1e-44   Tyto alba [Schleiereule]
gb|EAQ24007.1|  succinyl-CoA synthase, alpha subunit                    156   2e-44   Roseovarius sp. 217
gb|KFV11936.1|  hypothetical protein N339_07129                         157   2e-44   Pterocles gutturalis
ref|XP_008698282.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    160   2e-44   Ursus maritimus [white bear]
ref|WP_014102208.1|  succinyl-CoA synthetase subsunit alpha             160   2e-44   Micavibrio aeruginosavorus
ref|WP_014241630.1|  succinyl-CoA synthetase subsunit alpha             160   2e-44   Azospirillum brasilense
emb|CBK23557.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               160   2e-44   Blastocystis hominis
ref|WP_038528120.1|  succinate--CoA ligase                              160   2e-44   Azospirillum brasilense
ref|XP_009973222.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    161   2e-44   Tyto alba [Schleiereule]
ref|XP_008643339.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    160   2e-44   
gb|KFV12475.1|  hypothetical protein N340_07169                         160   2e-44   Tauraco erythrolophus
gb|KFQ48697.1|  hypothetical protein N333_04199                         160   2e-44   Nestor notabilis
ref|XP_005089236.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    161   2e-44   
ref|XP_005089238.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    160   2e-44   Aplysia californica
ref|WP_038144207.1|  succinate--CoA ligase                              160   2e-44   Thioclava atlantica
gb|KFP54334.1|  hypothetical protein N323_03013                         160   2e-44   Cathartes aura
ref|WP_011386313.1|  succinyl-CoA synthetase subsunit alpha             159   3e-44   Magnetospirillum
ref|WP_041873600.1|  succinate--CoA ligase                              159   3e-44   
gb|KGL77224.1|  hypothetical protein N309_04286                         158   3e-44   Tinamus guttatus
ref|XP_002610474.1|  hypothetical protein BRAFLDRAFT_124275             160   3e-44   Branchiostoma floridae
ref|XP_004995026.1|  succinyl-CoA ligase subunit alpha                  160   3e-44   Salpingoeca rosetta
gb|EJY75338.1|  Succinyl-CoA ligase                                     160   3e-44   Oxytricha trifallax
ref|WP_021693117.1|  succinyl-CoA ligase [ADP-forming] alpha chain      159   3e-44   Limimaricola cinnabarinus
gb|KFO72513.1|  hypothetical protein N303_09556                         160   3e-44   Cuculus canorus
ref|WP_008621975.1|  succinyl-CoA synthetase subunit alpha              159   3e-44   Magnetospirillum caucaseum
ref|WP_009868831.1|  COG0074: Succinyl-CoA synthetase, alpha subunit    159   3e-44   Magnetospirillum magnetotacticum
ref|WP_027256408.1|  succinate--CoA ligase                              159   3e-44   Leisingera aquimarina
ref|WP_010267151.1|  succinyl-CoA synthetase subsunit alpha             159   3e-44   Anaplasma
ref|XP_002188424.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    160   4e-44   
ref|XP_010193104.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    160   4e-44   Mesitornis unicolor
dbj|GAA49470.1|  succinyl-CoA synthetase alpha subunit                  160   4e-44   Clonorchis sinensis [oriental liver fluke]
ref|WP_012880976.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    159   4e-44   Anaplasma
ref|XP_010011949.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    160   4e-44   Nestor notabilis
ref|XP_009979329.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    160   4e-44   Tauraco erythrolophus
ref|XP_009469990.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    161   4e-44   Nipponia nippon
ref|WP_017929237.1|  succinyl-CoA synthetase subsunit alpha             159   4e-44   Limimaricola hongkongensis
gb|AAR10196.1|  similar to Drosophila melanogaster Scsalpha             156   4e-44   Drosophila yakuba
ref|XP_004691641.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    160   4e-44   Condylura cristata
emb|CEP12540.1|  hypothetical protein                                   160   4e-44   Parasitella parasitica
ref|XP_003942174.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    161   4e-44   Saimiri boliviensis boliviensis
gb|KIX19593.1|  succinate--CoA ligase                                   159   5e-44   Paracoccus sp. 228
gb|KFQ16420.1|  hypothetical protein N330_09883                         159   5e-44   Leptosomus discolor
ref|WP_042245435.1|  succinate--CoA ligase                              159   5e-44   Paracoccus sp. PAMC 22219
gb|EOA98554.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    159   5e-44   Anas platyrhynchos [duck]
ref|WP_014415904.1|  succinyl-CoA synthetase subsunit alpha             159   5e-44   Pararhodospirillum photometricum
gb|KFH68483.1|  succinyl-CoA synthetase alpha subunit                   160   5e-44   Mortierella verticillata NRRL 6337
ref|WP_012567360.1|  succinyl-CoA synthetase subsunit alpha             159   5e-44   
ref|WP_028879580.1|  succinate--CoA ligase                              159   6e-44   
gb|KFZ46882.1|  hypothetical protein N321_00974                         159   6e-44   
ref|WP_028718094.1|  succinate--CoA ligase                              159   6e-44   
ref|XP_010328278.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    161   6e-44   
gb|KFP86029.1|  hypothetical protein N310_03661                         159   6e-44   
gb|KFO55306.1|  hypothetical protein N302_15164                         159   6e-44   
gb|KFV45961.1|  hypothetical protein N328_11490                         159   7e-44   
gb|KGL91244.1|  hypothetical protein N301_05054                         159   7e-44   
ref|WP_024088967.1|  succinyl-CoA synthetase subsunit alpha             159   7e-44   
ref|WP_020038867.1|  succinyl-CoA synthetase subsunit alpha             159   7e-44   
gb|KFM01765.1|  hypothetical protein AS27_01907                         159   7e-44   
ref|XP_005023343.1|  PREDICTED: LOW QUALITY PROTEIN: succinyl-CoA...    159   7e-44   
emb|CCQ75435.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha        158   7e-44   
gb|KFR04514.1|  hypothetical protein Y956_09972                         159   7e-44   
ref|XP_010156265.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   8e-44   
ref|XP_010164933.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   8e-44   
gb|KFP16611.1|  hypothetical protein Z169_00989                         159   8e-44   
gb|KFQ59202.1|  hypothetical protein N334_08347                         159   8e-44   
ref|XP_009817926.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   9e-44   
ref|WP_028093273.1|  succinate--CoA ligase                              158   9e-44   
ref|WP_015092761.1|  succinyl-CoA synthetase subunit alpha              158   9e-44   
gb|KFO09272.1|  hypothetical protein N312_04840                         159   9e-44   
ref|XP_009880854.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   9e-44   
ref|WP_043870886.1|  succinate--CoA ligase                              158   1e-43   
gb|KFW72632.1|  hypothetical protein AS28_04873                         159   1e-43   
ref|WP_008031582.1|  succinyl-CoA synthetase subsunit alpha             158   1e-43   
ref|WP_044152630.1|  succinate--CoA ligase                              158   1e-43   
ref|WP_007668230.1|  succinyl-CoA synthetase subsunit alpha             158   1e-43   
gb|KFQ26276.1|  hypothetical protein N331_02825                         158   1e-43   
ref|WP_020849415.1|  succinyl-CoA synthetase subsunit alpha             158   1e-43   
ref|WP_011166112.1|  succinyl-CoA synthetase subsunit alpha             158   1e-43   
ref|XP_006128463.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    160   1e-43   
ref|WP_011451122.1|  succinyl-CoA synthetase subsunit alpha             158   1e-43   
ref|XP_006629220.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   1e-43   
ref|WP_035260183.1|  succinate--CoA ligase                              158   1e-43   
ref|WP_021799836.1|  succinyl-CoA synthetase, alpha subunit             158   1e-43   
ref|XP_009078515.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   1e-43   
ref|WP_037241186.1|  succinate--CoA ligase                              158   1e-43   
ref|WP_038450336.1|  succinate--CoA ligase                              158   1e-43   
ref|WP_037245140.1|  succinate--CoA ligase                              158   1e-43   
gb|KFP44839.1|  hypothetical protein N324_09193                         158   1e-43   
ref|WP_020401362.1|  succinyl-CoA synthetase subsunit alpha             157   1e-43   
ref|WP_044105250.1|  succinate--CoA ligase                              158   1e-43   
gb|EMC83070.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    158   1e-43   
ref|XP_008871215.1|  succinyl-CoA ligase [GDP-forming] subunit al...    158   1e-43   
ref|WP_036561342.1|  succinate--CoA ligase                              157   1e-43   
gb|ACR08641.1|  succinyl coenzyme A synthetase alpha subunit            156   1e-43   
ref|XP_010897979.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   1e-43   
ref|XP_005517988.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   2e-43   
ref|XP_008934823.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   2e-43   
ref|WP_019954638.1|  succinyl-CoA synthetase subsunit alpha             157   2e-43   
ref|XP_009476923.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   2e-43   
ref|XP_003703951.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   2e-43   
gb|KFQ01862.1|  hypothetical protein N329_10861                         158   2e-43   
gb|KFQ74530.1|  hypothetical protein N335_12196                         158   2e-43   
ref|XP_011264080.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   2e-43   
gb|KFP07084.1|  hypothetical protein N300_01855                         158   2e-43   
ref|XP_010579045.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   2e-43   
ref|XP_005144667.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    158   2e-43   
ref|XP_003799266.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   2e-43   
emb|CEN55653.1|  succinyl-CoA synthetase alpha chain                    157   2e-43   
ref|WP_007793465.1|  succinyl-CoA synthetase subsunit alpha             157   2e-43   
ref|XP_005045683.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    158   2e-43   
ref|WP_005623893.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    157   2e-43   
gb|KFU88095.1|  hypothetical protein M959_07854                         158   2e-43   
ref|WP_008943061.1|  succinyl-CoA synthetase subsunit alpha             157   2e-43   
gb|KFW94030.1|  hypothetical protein N336_05397                         157   2e-43   
ref|XP_010124729.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   2e-43   
ref|WP_028099766.1|  succinate--CoA ligase                              157   2e-43   
ref|WP_038603019.1|  succinate--CoA ligase                              157   2e-43   
gb|KFP88214.1|  hypothetical protein N311_05181                         157   2e-43   
ref|XP_008500129.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   2e-43   
gb|KFH71911.1|  succinyl-CoA synthetase alpha subunit                   158   2e-43   
emb|CDW71518.1|  succinyl-ligase                                        158   2e-43   
ref|XP_009162469.1|  hypothetical protein T265_00432                    158   2e-43   
ref|XP_010212938.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   2e-43   
ref|WP_009816307.1|  succinyl-CoA synthetase subsunit alpha             157   2e-43   
gb|KFV90260.1|  hypothetical protein N326_04843                         157   3e-43   
ref|WP_008279485.1|  succinyl-CoA synthetase subsunit alpha             157   3e-43   
ref|XP_009933087.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   3e-43   
ref|WP_009507065.1|  succinyl-CoA synthetase subsunit alpha             157   3e-43   
ref|XP_010284942.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    157   3e-43   
ref|XP_005510017.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    158   3e-43   
ref|XP_009958005.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   3e-43   
gb|KFQ85711.1|  hypothetical protein N337_03119                         157   3e-43   
ref|XP_009914650.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   3e-43   
ref|XP_009508582.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    157   3e-43   
ref|WP_025046607.1|  succinate--CoA ligase                              157   3e-43   
ref|XP_009330174.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   4e-43   
ref|WP_028796070.1|  succinate--CoA ligase                              157   4e-43   
ref|XP_009287692.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   4e-43   
ref|NP_001012910.1|  succinyl-CoA ligase [ADP/GDP-forming] subuni...    157   4e-43   
ref|WP_029007879.1|  succinate--CoA ligase                              156   4e-43   
ref|XP_007063243.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    157   4e-43   
ref|WP_006831917.1|  succinyl-CoA synthetase subsunit alpha             157   4e-43   
ref|XP_001744918.1|  hypothetical protein                               157   4e-43   
ref|WP_018985877.1|  hypothetical protein                               156   4e-43   
ref|WP_043842830.1|  succinate--CoA ligase                              156   4e-43   
ref|WP_009605554.1|  succinyl-CoA synthetase subsunit alpha             156   4e-43   
ref|WP_006035775.1|  succinyl-CoA synthetase subunit alpha              156   4e-43   
ref|WP_039523079.1|  succinate--CoA ligase                              156   5e-43   
gb|KFV86963.1|  hypothetical protein N308_13961                         157   5e-43   
ref|WP_011046107.1|  succinyl-CoA synthetase subsunit alpha             156   5e-43   
ref|XP_005428398.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    158   5e-43   
ref|WP_028028426.1|  succinate--CoA ligase                              156   5e-43   
ref|WP_037260544.1|  succinate--CoA ligase                              156   5e-43   
ref|XP_001984386.1|  GH16428                                            157   5e-43   
ref|XP_009993919.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   5e-43   
ref|XP_009637900.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   5e-43   
ref|XP_003454252.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    157   5e-43   
ref|XP_002046562.1|  GJ12416                                            157   6e-43   
ref|WP_012453497.1|  succinyl-CoA synthetase subsunit alpha             156   6e-43   
emb|CDH53782.1|  probable succinyl-coa synthetase alpha gdp-forming     157   6e-43   
ref|WP_017485063.1|  succinyl-CoA synthetase subsunit alpha             156   6e-43   
ref|WP_007089205.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    156   6e-43   
gb|EPB83091.1|  succinyl-CoA synthetase alpha subunit                   157   6e-43   
emb|CDS02808.1|  Putative Succinyl-CoA ligase                           157   6e-43   
ref|WP_044143234.1|  succinate--CoA ligase                              156   6e-43   
sp|Q9YGD2.1|SUCA_COLLI  RecName: Full=Succinyl-CoA ligase subunit...    156   6e-43   
ref|WP_015927829.1|  succinyl-CoA synthetase subsunit alpha             156   6e-43   
gb|EFA80958.1|  Endo-beta-N-acetylglucosaminidase                       164   6e-43   
ref|XP_004612073.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    157   7e-43   
ref|WP_033444427.1|  succinate--CoA ligase                              156   7e-43   
gb|KFR10822.1|  hypothetical protein N306_07597                         156   7e-43   
ref|WP_028368926.1|  succinate--CoA ligase                              155   8e-43   
ref|WP_035707938.1|  succinate--CoA ligase                              155   8e-43   
ref|WP_029012089.1|  succinate--CoA ligase                              155   8e-43   
ref|WP_041861374.1|  succinate--CoA ligase                              155   8e-43   
ref|WP_011444840.1|  succinyl-CoA synthetase subsunit alpha             155   8e-43   
ref|WP_007206844.1|  succinyl-CoA synthetase subsunit alpha             155   9e-43   
ref|XP_002068543.1|  GK20526                                            156   1e-42   
ref|XP_009831202.1|  succinyl-CoA ligase [GDP-forming] subunit al...    156   1e-42   
ref|WP_025061191.1|  succinate--CoA ligase                              155   1e-42   
ref|WP_008383363.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   
ref|XP_001971787.1|  GG15160                                            156   1e-42   
ref|XP_002123295.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    156   1e-42   
dbj|GAN05815.1|  succinate-CoA ligase                                   156   1e-42   
gb|KFO83923.1|  hypothetical protein N320_09990                         155   1e-42   
ref|WP_014873464.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    155   1e-42   
ref|WP_037270069.1|  succinate--CoA ligase                              155   1e-42   
gb|ADE40076.1|  succinyl-CoA synthetase, alpha subunit                  156   1e-42   
gb|KDB02198.1|  succinyl-CoA synthetase subsunit alpha                  156   1e-42   
ref|WP_005978934.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   
ref|XP_002093588.1|  succinyl coenzyme A synthetase alpha subunit       156   1e-42   
ref|WP_043767739.1|  succinate--CoA ligase                              155   1e-42   
ref|WP_009573389.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   
ref|WP_011537127.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   
ref|WP_043971047.1|  succinate--CoA ligase                              155   1e-42   
ref|XP_002738240.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    152   1e-42   
ref|WP_019645135.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   
ref|XP_001627384.1|  predicted protein                                  156   1e-42   
ref|WP_035244086.1|  succinyl-CoA synthetase subunit alpha              155   1e-42   
ref|WP_008559701.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   
ref|WP_033068019.1|  succinate--CoA ligase                              155   1e-42   
ref|WP_003599893.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   
ref|XP_003206087.2|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    156   1e-42   
ref|XP_004549582.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    156   1e-42   
ref|WP_035744638.1|  succinate--CoA ligase                              155   1e-42   
ref|XP_321835.2|  AGAP001312-PA                                         156   1e-42   
ref|WP_012253228.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   
ref|WP_011567858.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   
ref|WP_044827266.1|  succinate--CoA ligase                              155   2e-42   
ref|WP_012520721.1|  succinyl-CoA synthetase subsunit alpha             155   2e-42   
ref|WP_042484035.1|  succinate--CoA ligase                              155   2e-42   
ref|WP_016845087.1|  hypothetical protein                               150   2e-42   
ref|WP_025056069.1|  succinate--CoA ligase                              155   2e-42   
ref|WP_013962963.1|  succinyl-CoA synthetase subsunit alpha             155   2e-42   
ref|XP_006018074.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    157   2e-42   
ref|WP_037908640.1|  succinate--CoA ligase                              155   2e-42   
ref|WP_024929657.1|  succinyl-CoA synthetase subunit alpha              155   2e-42   
ref|WP_004274388.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    155   2e-42   
ref|WP_011542514.1|  succinyl-CoA synthetase subsunit alpha             155   2e-42   
ref|XP_009495173.1|  succinyl-CoA synthetase alpha subunit              156   2e-42   
ref|WP_019881664.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    155   2e-42   
ref|WP_015816124.1|  succinyl-CoA synthetase subsunit alpha             155   2e-42   
ref|WP_018304231.1|  succinyl-CoA synthetase subsunit alpha             155   2e-42   
ref|WP_038035751.1|  hypothetical protein                               155   2e-42   
ref|WP_014246680.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    155   2e-42   
ref|WP_012110353.1|  succinyl-CoA synthetase subsunit alpha             155   2e-42   
gb|ETN59000.1|  Succinyl coenzyme A synthetase alpha subunit            155   2e-42   
ref|WP_010393091.1|  succinyl-CoA synthetase subsunit alpha             155   2e-42   
ref|WP_015822220.1|  succinyl-CoA synthetase subsunit alpha             155   2e-42   
ref|XP_004549581.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    155   2e-42   
ref|XP_003395161.1|  PREDICTED: succinyl-CoA ligase [GDP-forming]...    156   2e-42   
gb|ACO09718.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    155   2e-42   
gb|ACO11392.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    155   2e-42   
ref|WP_026757102.1|  succinate--CoA ligase                              155   2e-42   
ref|WP_017978730.1|  succinyl-CoA synthetase subsunit alpha             155   2e-42   
ref|XP_003395160.1|  PREDICTED: succinyl-CoA ligase [GDP-forming]...    155   2e-42   
ref|WP_029148401.1|  succinyl-CoA synthetase subunit alpha              155   2e-42   
ref|WP_022702490.1|  succinyl-CoA synthetase subsunit alpha             155   2e-42   
emb|CEG59647.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha        155   2e-42   
ref|WP_020951286.1|  succinyl-CoA synthetase, subunit alpha             155   2e-42   
ref|XP_005229934.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    155   2e-42   
ref|WP_007812200.1|  succinyl-CoA synthetase subsunit alpha             155   2e-42   
ref|WP_015493901.1|  succinyl-CoA synthetase subsunit alpha             154   2e-42   
ref|WP_020044584.1|  succinyl-CoA synthetase subsunit alpha             155   2e-42   
ref|WP_008756783.1|  succinyl-CoA synthetase subsunit alpha             154   2e-42   
ref|WP_008889739.1|  succinyl-CoA synthetase subsunit alpha             154   2e-42   
ref|XP_001652258.1|  AAEL006833-PA                                      155   2e-42   
gb|KJE93223.1|  succinate-CoA ligase                                    156   3e-42   
ref|WP_037316727.1|  succinate--CoA ligase                              154   3e-42   
gb|ACN58607.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    155   3e-42   
ref|WP_010543934.1|  succinyl-CoA synthetase subsunit alpha             154   3e-42   
ref|WP_008233149.1|  succinyl-CoA synthetase subsunit alpha             154   3e-42   
ref|WP_014955396.1|  succinyl-CoA synthetase subsunit alpha             154   3e-42   
ref|NP_001153970.1|  succinate-CoA ligase GDP-forming alpha subunit     155   3e-42   
ref|WP_043354951.1|  MULTISPECIES: succinate--CoA ligase                154   3e-42   
dbj|GAK44301.1|  succinyl-CoA synthetase subunit alpha                  154   3e-42   
ref|WP_004619223.1|  succinyl-CoA synthetase (ADP-forming) alpha ...    154   3e-42   
ref|WP_033073970.1|  succinate--CoA ligase                              154   3e-42   
ref|WP_008993483.1|  succinyl-CoA synthetase subsunit alpha             154   3e-42   
ref|WP_025422936.1|  succinyl-CoA synthetase subunit alpha              154   3e-42   
ref|WP_009809625.1|  succinyl-CoA synthetase subsunit alpha             154   3e-42   
gb|EUB56696.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha         155   3e-42   
ref|WP_010918227.1|  succinyl-CoA synthetase subsunit alpha             154   3e-42   
ref|WP_039616454.1|  succinate--CoA ligase                              154   3e-42   
ref|WP_039018970.1|  succinate--CoA ligase                              154   3e-42   
ref|WP_024081748.1|  succinyl-CoA synthetase, alpha subunit, NAD(...    154   3e-42   
ref|WP_005858958.1|  succinyl-CoA synthetase subsunit alpha             154   3e-42   



>ref|XP_006350379.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Solanum tuberosum]
Length=337

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 145/164 (88%), Gaps = 8/164 (5%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP----ITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGIT  247
            MA Q  RLI+N+S K+ P    I+ SPLW Q  +R FGSP P   VFVDKNTRVICQGIT
Sbjct  1    MARQATRLISNLSTKLNPSSPTISASPLWHQ--YRYFGSPPPPPAVFVDKNTRVICQGIT  58

Query  248  GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPF  427
            GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVPPPF
Sbjct  59   GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVPPPF  118

Query  428  agaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            A AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q++TRLI
Sbjct  119  AAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSRTRLI  162



>ref|XP_009623368.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Nicotiana tomentosiformis]
Length=338

 Score =   240 bits (613),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 143/165 (87%), Gaps = 9/165 (5%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR-----PITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGI  244
            MA Q  RLIAN+S K+      P   S LWQQ  +R FGSP P   VFVDKNTRVICQGI
Sbjct  1    MARQATRLIANLSAKLNSSNPTPSASSSLWQQ--YRFFGSPPPPPAVFVDKNTRVICQGI  58

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVPPP
Sbjct  59   TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVPPP  118

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q+KTRLI
Sbjct  119  FAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSKTRLI  163



>ref|NP_001234574.1| succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial 
[Solanum lycopersicum]
 sp|Q6DQL1.1|SUCA2_SOLLC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial; Short=SlSCoALalpha2; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAT67464.1| succinyl-CoA ligase alpha 2 subunit [Solanum lycopersicum]
Length=337

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 143/164 (87%), Gaps = 8/164 (5%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP----ITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGIT  247
            MA Q  RLI+N+S K+ P    ++ SPLW Q  +R FGSP P   VFVDKNTRVICQGIT
Sbjct  1    MARQATRLISNLSTKLNPSSPTMSASPLWHQ--YRYFGSPPPPPAVFVDKNTRVICQGIT  58

Query  248  GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPF  427
            GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AK ETKANASV+YVPPPF
Sbjct  59   GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKVETKANASVVYVPPPF  118

Query  428  agaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            A AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q +TRLI
Sbjct  119  AAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQLRTRLI  162



>gb|AIS71903.1| mitochondrial succinyl-CoA ligase ADP-forming subunit alpha-2 
[Nicotiana tabacum]
Length=340

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 143/167 (86%), Gaps = 11/167 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPIT-------QSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQ  238
            MA Q  RL++ +S K+ P +        SPLW Q  +R FGSP P   VFVDKNTRVICQ
Sbjct  1    MARQATRLVSKLSSKLSPNSPTISASPSSPLWHQ--YRYFGSPPPPPAVFVDKNTRVICQ  58

Query  239  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  418
            GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVP
Sbjct  59   GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVP  118

Query  419  PPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            PPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q+KTRLI
Sbjct  119  PPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSKTRLI  165



>ref|XP_009775900.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Nicotiana sylvestris]
Length=251

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 142/167 (85%), Gaps = 11/167 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPIT-------QSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQ  238
            MA Q  RL++ +S K+ P +        SPLW Q  +R FGSP P   VFVDKNTRVICQ
Sbjct  1    MARQATRLVSKLSSKLSPNSPTISASPSSPLWHQ--YRYFGSPPPPPAVFVDKNTRVICQ  58

Query  239  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  418
            GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV +AKAETKANASV+YVP
Sbjct  59   GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVEEAKAETKANASVVYVP  118

Query  419  PPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            PPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q+KTRLI
Sbjct  119  PPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSKTRLI  165



>ref|XP_006348504.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Solanum tuberosum]
Length=332

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 140/160 (88%), Gaps = 5/160 (3%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGS--PAPEVFVDKNTRVICQGITGKNG  259
            MA Q  +LIAN+S K   ++ S      Q+RLFGS  P P VFVDKNTRVICQGITGKNG
Sbjct  1    MARQATKLIANLSTK---LSSSNPTLATQNRLFGSAPPPPAVFVDKNTRVICQGITGKNG  57

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AA
Sbjct  58   TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAA  117

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IME +EAELDL+VCITEGIPQHDMV+VKAALK+Q++TRLI
Sbjct  118  IMEGLEAELDLIVCITEGIPQHDMVRVKAALKKQSRTRLI  157



>ref|XP_009781531.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Nicotiana sylvestris]
Length=338

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 144/165 (87%), Gaps = 9/165 (5%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSP-----LWQQQQHRLFGSP--APEVFVDKNTRVICQGI  244
            MA Q  R+IAN+S K+   + +P     LWQQ  +R FGSP   P VFVDKNTRVICQGI
Sbjct  1    MARQATRVIANLSTKLNSSSPTPSASSSLWQQ--YRFFGSPLPPPAVFVDKNTRVICQGI  58

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVPPP
Sbjct  59   TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVPPP  118

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q+KTRLI
Sbjct  119  FAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSKTRLI  163



>emb|CDP14400.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 142/161 (88%), Gaps = 6/161 (4%)
 Frame = +2

Query  86   MAWQTAR-LIANVSKKVRPITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGITGKN  256
            MA QT + LI N++ K   + Q+P  + QQ R FGSP P   VFVDKNTRVICQGITGKN
Sbjct  1    MARQTTKSLIGNLASK---LLQNPNGKSQQLRHFGSPPPPAAVFVDKNTRVICQGITGKN  57

Query  257  GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFaga  436
            GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA A
Sbjct  58   GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAA  117

Query  437  aimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            AIMEAMEAELDLVVCITEGIPQHDMVKVKAALK+Q+KTRLI
Sbjct  118  AIMEAMEAELDLVVCITEGIPQHDMVKVKAALKKQSKTRLI  158



>ref|XP_011091459.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Sesamum indicum]
Length=330

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 137/160 (86%), Gaps = 7/160 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGITGKNG  259
            MA    RLI N+S+++      P  + QQHR FGSP P   VFVDKNTRVICQGITGKNG
Sbjct  1    MARHATRLIGNLSRRLL----CP-KELQQHRNFGSPPPPPAVFVDKNTRVICQGITGKNG  55

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQAIEYGTKMVGGVTP KGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA  A
Sbjct  56   TFHTEQAIEYGTKMVGGVTPGKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAKA  115

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IME++EAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  116  IMESLEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLI  155



>gb|KJB79847.1| hypothetical protein B456_013G069200 [Gossypium raimondii]
Length=268

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 134/161 (83%), Gaps = 5/161 (3%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKN  256
            MA Q +RL+ ++S +        L   Q  R F +   P P VFVDKNTRVICQGITGKN
Sbjct  1    MARQASRLLRSLSSQFS--HHKSLLSPQHSRSFSAAPAPQPAVFVDKNTRVICQGITGKN  58

Query  257  GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFaga  436
            GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA  
Sbjct  59   GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAP  118

Query  437  aimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            AIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLI
Sbjct  119  AIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLI  159



>ref|NP_001234277.1| succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Solanum lycopersicum]
 sp|Q8GTQ9.1|SUCA1_SOLLC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial; Short=SlSCoALalpha1; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAN86619.1| succinyl-CoA ligase alpha 1 subunit [Solanum lycopersicum]
Length=332

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 138/159 (87%), Gaps = 3/159 (2%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQ-QQQHRLFGSPAPEVFVDKNTRVICQGITGKNGT  262
            MA Q  +LIAN+SKK+   + +P  +  +Q    G+  P VFVDKNTRVICQGITGKNGT
Sbjct  1    MARQATKLIANLSKKLS--SSNPHTRCSEQTVWIGAAPPAVFVDKNTRVICQGITGKNGT  58

Query  263  FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaai  442
            FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV +AKAETKANASVIYVPPPFA AAI
Sbjct  59   FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVEEAKAETKANASVIYVPPPFAAAAI  118

Query  443  meameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ME +EAELDL+VCITEGIPQHDMV+VKAALK+Q++TRLI
Sbjct  119  MEGLEAELDLIVCITEGIPQHDMVRVKAALKKQSRTRLI  157



>gb|AFL48180.1| succinyl-CoA synthetase [Capsicum annuum]
 gb|AFL48181.1| succinyl-CoA synthetase [Capsicum annuum]
Length=326

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 137/160 (86%), Gaps = 11/160 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGS--PAPEVFVDKNTRVICQGITGKNG  259
            MA Q  R+I+  S K+ P          ++R FGS  P P VFVDKNTRVICQGITGKNG
Sbjct  1    MARQATRVISKWSTKLNP---------NEYRYFGSSAPPPAVFVDKNTRVICQGITGKNG  51

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVPPPFA AA
Sbjct  52   TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVPPPFAAAA  111

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q++TRLI
Sbjct  112  IMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSRTRLI  151



>gb|KJB79846.1| hypothetical protein B456_013G069200 [Gossypium raimondii]
Length=335

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 134/161 (83%), Gaps = 5/161 (3%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKN  256
            MA Q +RL+ ++S +        L   Q  R F +   P P VFVDKNTRVICQGITGKN
Sbjct  1    MARQASRLLRSLSSQFS--HHKSLLSPQHSRSFSAAPAPQPAVFVDKNTRVICQGITGKN  58

Query  257  GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFaga  436
            GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA  
Sbjct  59   GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAP  118

Query  437  aimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            AIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLI
Sbjct  119  AIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLI  159



>gb|EYU19899.1| hypothetical protein MIMGU_mgv1a009825mg [Erythranthe guttata]
Length=330

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 136/160 (85%), Gaps = 7/160 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGITGKNG  259
            M+ Q  RLI ++S ++      P  Q QQHR F SP P   VFVDKNTRVICQGITGKNG
Sbjct  1    MSRQATRLIHSLSSRLF----CP-KQLQQHRNFASPPPPPAVFVDKNTRVICQGITGKNG  55

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANA+VIYVPPPFA  A
Sbjct  56   TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANATVIYVPPPFAAKA  115

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IMEA+EAELDL VCITEGIPQHDM++VK+AL QQ+KTRLI
Sbjct  116  IMEAIEAELDLAVCITEGIPQHDMIRVKSALNQQSKTRLI  155



>gb|EPS68438.1| hypothetical protein M569_06331, partial [Genlisea aurea]
Length=329

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 135/160 (84%), Gaps = 7/160 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGITGKNG  259
            MA Q  RLI  +S +V      P  + Q  R FGSP P   VFVDKNTRVICQGITGKNG
Sbjct  1    MARQVNRLIGQLSSRVL----CP-GRIQNSRSFGSPPPPPAVFVDKNTRVICQGITGKNG  55

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQA+EYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAET+ANASVIYVPPPFA  A
Sbjct  56   TFHTEQAVEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETRANASVIYVPPPFAAKA  115

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            I+EA+EAELDL+VCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  116  ILEALEAELDLIVCITEGIPQHDMVRVKAALNKQSKTRLI  155



>ref|XP_010934473.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Elaeis guineensis]
Length=340

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 139/164 (85%), Gaps = 6/164 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKV----RPITQSPLWQQQQHRLFGSPAPE--VFVDKNTRVICQGIT  247
            M+ Q A+L+ +++ ++    +P   SPL  Q +     +P P   VFVDKNTRVICQGIT
Sbjct  1    MSRQAAKLVGSLASRLVSEPKPFVSSPLSSQYRRHFAAAPPPPPAVFVDKNTRVICQGIT  60

Query  248  GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPF  427
            GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPF
Sbjct  61   GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPF  120

Query  428  agaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            A AAI+EAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  121  AAAAILEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLI  164



>gb|KDO52721.1| hypothetical protein CISIN_1g0195001mg, partial [Citrus sinensis]
 gb|KDO52722.1| hypothetical protein CISIN_1g0195001mg, partial [Citrus sinensis]
Length=237

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 128/149 (86%), Gaps = 3/149 (2%)
 Frame = +2

Query  122  SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYG  292
            S+ VR +  S      Q R F +   PAP VFVDKNTRVICQGITGKNGTFHTEQAIEYG
Sbjct  7    SRVVRSLYMSSEICCGQSRSFTTAPPPAPAVFVDKNTRVICQGITGKNGTFHTEQAIEYG  66

Query  293  TKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDL  472
            TKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANAS IYVPPPFA AAI+EAMEAELDL
Sbjct  67   TKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASAIYVPPPFAAAAILEAMEAELDL  126

Query  473  VVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            VVCITEGIPQHDMV+VKAAL  Q+KTRL+
Sbjct  127  VVCITEGIPQHDMVRVKAALNNQSKTRLV  155



>ref|XP_002271746.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Vitis vinifera]
 emb|CBI29046.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 133/158 (84%), Gaps = 5/158 (3%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTF  265
            M  Q  RLI  V  +++    SPL    +H    +P P VFVDKNTRVICQGITGKNGTF
Sbjct  1    MVGQVRRLIPYVVSRIK----SPLAPPSRHLGTTAP-PAVFVDKNTRVICQGITGKNGTF  55

Query  266  HTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaim  445
            HTEQAIEYGTKMVGGVTPKKGG EHLGLP+FNTVA+AKAET+ANASVIYVPPPFA AAIM
Sbjct  56   HTEQAIEYGTKMVGGVTPKKGGMEHLGLPIFNTVAEAKAETRANASVIYVPPPFAAAAIM  115

Query  446  eameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            EA+EAELDLVVCITEGIPQHDMVKVKAAL +Q+KTRLI
Sbjct  116  EAVEAELDLVVCITEGIPQHDMVKVKAALNRQSKTRLI  153



>gb|KHG06820.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial 
[Gossypium arboreum]
Length=335

 Score =   219 bits (559),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPE--VFVDKNTRVICQGITGKNG  259
            MA Q +RL+ ++S +     +SPL          +PAP+  VFVDKNTRVICQGITGKNG
Sbjct  1    MARQASRLLRSLSSQFSH-RKSPLSPLHSRSFSAAPAPQPAVFVDKNTRVICQGITGKNG  59

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+A AETKANASVIYVPPPFA AA
Sbjct  60   TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEANAETKANASVIYVPPPFAAAA  119

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IMEAMEAELDLVVCITEGIPQHDMV+VK AL QQ+KTRLI
Sbjct  120  IMEAMEAELDLVVCITEGIPQHDMVRVKVALNQQSKTRLI  159



>gb|KHG04322.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Gossypium arboreum]
Length=346

 Score =   219 bits (559),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 138/170 (81%), Gaps = 12/170 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP---------ITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            MA Q +RLI ++S ++ P          + S      Q R F +   P P VFVDKNTRV
Sbjct  1    MARQASRLIQSLSSRISPHKPQISPLTPSSSSSQLLTQSRSFSAAPAPQPAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            YVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLI
Sbjct  121  YVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLI  170



>ref|XP_006441424.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
 gb|ESR54664.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
Length=281

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 139/172 (81%), Gaps = 15/172 (9%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRPITQSPLWQQQ---------QHRLFGSPA----PEVFVDKNT  223
            MA Q  A+LI ++  + RP T S +   +           R +GS A    P VFVDKNT
Sbjct  1    MARQALAKLIGSIGSR-RPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHPAVFVDKNT  59

Query  224  RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANAS  403
            RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS
Sbjct  60   RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANAS  119

Query  404  VIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            VIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  120  VIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLI  171



>ref|XP_009355925.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Pyrus x bretschneideri]
Length=334

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +2

Query  101  ARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQA  280
            A+LI +++ + +P   + L Q++ +     P P VFVDKNTRVICQGITGKNGTFHTEQA
Sbjct  7    AKLIGSIASR-KPSLSTSLLQRRHYSPAPPPPPAVFVDKNTRVICQGITGKNGTFHTEQA  65

Query  281  IEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeamea  460
            IEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAI+EA+EA
Sbjct  66   IEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAILEAVEA  125

Query  461  eLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ELDLVVCITEGIPQHDMV+VKAA+ +Q+KTRLI
Sbjct  126  ELDLVVCITEGIPQHDMVRVKAAINRQSKTRLI  158



>ref|XP_006493424.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Citrus sinensis]
Length=347

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 139/172 (81%), Gaps = 15/172 (9%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRPITQSPLWQQQ---------QHRLFGSPA----PEVFVDKNT  223
            MA Q  A+LI ++  + RP T S +   +           R +GS A    P VFVDKNT
Sbjct  1    MARQALAKLIGSIGCR-RPSTASSVSHYRLSTSAAPAAHSRYYGSSAAASQPAVFVDKNT  59

Query  224  RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANAS  403
            RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS
Sbjct  60   RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANAS  119

Query  404  VIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            VIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  120  VIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLI  171



>ref|XP_006374278.1| hypothetical protein POPTR_0015s056201g, partial [Populus trichocarpa]
 gb|ERP52075.1| hypothetical protein POPTR_0015s056201g, partial [Populus trichocarpa]
Length=181

 Score =   213 bits (541),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/119 (94%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  48   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  107

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ETKANASVIYVPPPFA AAI+EAMEAEL+LVVCITEGIPQHDMV+VKAAL +QTKTRLI
Sbjct  108  ETKANASVIYVPPPFAAAAILEAMEAELNLVVCITEGIPQHDMVRVKAALNRQTKTRLI  166



>ref|XP_007152547.1| hypothetical protein PHAVU_004G139300g [Phaseolus vulgaris]
 gb|ESW24541.1| hypothetical protein PHAVU_004G139300g [Phaseolus vulgaris]
Length=324

 Score =   217 bits (553),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  176  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  355
            R F S  P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPV
Sbjct  21   RQFSSATPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPV  80

Query  356  FNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
            FNTVA+AKAETKANASVIYVPPPFA AAIME+MEAELDLVVCITEGIPQHDMV+VKAAL 
Sbjct  81   FNTVAEAKAETKANASVIYVPPPFAAAAIMESMEAELDLVVCITEGIPQHDMVRVKAALN  140

Query  536  QQTKTRLI  559
            QQ+KTRLI
Sbjct  141  QQSKTRLI  148



>ref|XP_006394592.1| hypothetical protein EUTSA_v10004347mg [Eutrema salsugineum]
 gb|ESQ31878.1| hypothetical protein EUTSA_v10004347mg [Eutrema salsugineum]
Length=401

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 132/169 (78%), Gaps = 11/169 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPI--------TQSPLWQQQQHRLFGS---PAPEVFVDKNTRVI  232
            MA Q  RL+ ++S KVR          +   L    Q R FG+   P   VFVDKNTRVI
Sbjct  57   MARQVTRLLGSLSSKVRSSGGVSEVYPSCCYLTSLTQSRSFGTTPPPPAAVFVDKNTRVI  116

Query  233  CQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIY  412
            CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIY
Sbjct  117  CQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIY  176

Query  413  VPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            VP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  Q+KTRLI
Sbjct  177  VPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQSKTRLI  225



>ref|XP_006441425.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
 gb|ESR54665.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
Length=347

 Score =   218 bits (554),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 139/172 (81%), Gaps = 15/172 (9%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRPITQSPLWQQQ---------QHRLFGSPA----PEVFVDKNT  223
            MA Q  A+LI ++  + RP T S +   +           R +GS A    P VFVDKNT
Sbjct  1    MARQALAKLIGSIGSR-RPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHPAVFVDKNT  59

Query  224  RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANAS  403
            RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS
Sbjct  60   RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANAS  119

Query  404  VIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            VIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  120  VIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLI  171



>ref|XP_008375061.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Malus domestica]
Length=334

 Score =   217 bits (553),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +2

Query  101  ARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQA  280
            A+LI +++ + +P   + L Q++ +     P P VFVDKNTRVICQGITGKNGTFHTEQA
Sbjct  7    AKLIGSIASR-KPSPSTSLRQRRHYSPAPPPPPAVFVDKNTRVICQGITGKNGTFHTEQA  65

Query  281  IEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeamea  460
            IEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAI+EA+EA
Sbjct  66   IEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAILEAVEA  125

Query  461  eLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ELDLVVCITEGIPQHDMV+VKAA+ +Q+KTRLI
Sbjct  126  ELDLVVCITEGIPQHDMVRVKAAINRQSKTRLI  158



>ref|XP_009136375.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Brassica rapa]
Length=346

 Score =   217 bits (553),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 133/170 (78%), Gaps = 12/170 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPI---------TQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            M+ Q A+L+ ++  K+R           + S L    + R FG+   P   VFVDKNTRV
Sbjct  1    MSRQVAKLVGSLPSKLRSSVASSELLYPSCSSLTSLTKSRSFGTTPPPPAAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVI
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            YVP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  QTKTRLI
Sbjct  121  YVPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQTKTRLI  170



>ref|XP_008467310.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Cucumis melo]
Length=342

 Score =   217 bits (552),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            SP P VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V
Sbjct  43   SPPPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSV  102

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
            A+AKAETKANASVIYVPPPFA AAI+EAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+K
Sbjct  103  AEAKAETKANASVIYVPPPFAAAAILEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSK  162

Query  548  TRLI  559
            TRLI
Sbjct  163  TRLI  166



>ref|XP_002514510.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
 gb|EEF47910.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
Length=334

 Score =   216 bits (551),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 136/159 (86%), Gaps = 2/159 (1%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGT  262
            MA Q  A+LI +++ + +P   S   Q +Q+    SP   VFVDKNTRVICQGITGKNGT
Sbjct  1    MARQAVAKLIGSIASR-KPSLSSSAIQTRQYAAAASPPAAVFVDKNTRVICQGITGKNGT  59

Query  263  FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaai  442
            FHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AAI
Sbjct  60   FHTEQAIEYGTTMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAI  119

Query  443  meameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            MEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  120  MEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLI  158



>ref|XP_010423114.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Camelina sativa]
Length=343

 Score =   217 bits (552),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 133/167 (80%), Gaps = 10/167 (6%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQ  238
            M+ Q ARLI ++S K R      P  QS L    Q R F S   P   VFVDKNTRV+CQ
Sbjct  1    MSRQVARLIGSLSSKARGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTRVLCQ  59

Query  239  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  418
            GITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP
Sbjct  60   GITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVP  119

Query  419  PPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  120  APFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNGQSKTRLI  166



>ref|XP_007043270.1| Succinyl-CoA ligase, alpha subunit [Theobroma cacao]
 gb|EOX99101.1| Succinyl-CoA ligase, alpha subunit [Theobroma cacao]
Length=351

 Score =   217 bits (553),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 137/175 (78%), Gaps = 17/175 (10%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP---------------ITQSPLWQQQQHRLFGSPAPE--VFVD  214
            MA Q +RLI ++S K+ P                + S            +PAP+  VFVD
Sbjct  1    MARQASRLIKSMSSKISPRNPQISPLSPFSSTSSSSSSSSLTLSRSFSAAPAPQPAVFVD  60

Query  215  KNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKA  394
            KNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKA
Sbjct  61   KNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKA  120

Query  395  NASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            NASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLI
Sbjct  121  NASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLI  175



>emb|CDY61908.1| BnaC07g49680D [Brassica napus]
Length=345

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 132/169 (78%), Gaps = 11/169 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPI--------TQSPLWQQQQHRLFGS---PAPEVFVDKNTRVI  232
            M+ Q  RL+ ++  K+R          + S L    + R FG+   P   VFVDKNTRVI
Sbjct  1    MSRQVTRLLGSLPSKLRSSVSSSELYPSCSSLTSLTKSRSFGTTPPPPAAVFVDKNTRVI  60

Query  233  CQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIY  412
            CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIY
Sbjct  61   CQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIY  120

Query  413  VPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            VP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  QTKTRLI
Sbjct  121  VPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQTKTRLI  169



>ref|XP_006437603.1| hypothetical protein CICLE_v10032075mg [Citrus clementina]
 gb|ESR50843.1| hypothetical protein CICLE_v10032075mg [Citrus clementina]
Length=331

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 127/149 (85%), Gaps = 3/149 (2%)
 Frame = +2

Query  122  SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYG  292
            S+ VR +  S      Q R F +   PAP VFVDKNTRVICQGITGKNGTFHT QAIEYG
Sbjct  7    SRVVRSLYMSSEICCGQSRSFTTAPPPAPAVFVDKNTRVICQGITGKNGTFHTAQAIEYG  66

Query  293  TKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDL  472
            TKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS IYVPPPFA AAI+EAMEAELDL
Sbjct  67   TKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASAIYVPPPFAAAAILEAMEAELDL  126

Query  473  VVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            VVCITEGIPQHDMV+VKAAL  Q+KTRLI
Sbjct  127  VVCITEGIPQHDMVRVKAALNNQSKTRLI  155



>ref|XP_008240339.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Prunus mume]
Length=329

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = +2

Query  101  ARLIANV-SKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQ  277
            A+LI ++ S+K  P   + + Q++ +     P P VFVDKNTRVICQGITGKNGTFHTEQ
Sbjct  7    AKLIGSIASRKPSPSPSTSILQRRHYSPAPPPPPAVFVDKNTRVICQGITGKNGTFHTEQ  66

Query  278  AIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeame  457
            AIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAIMEAME
Sbjct  67   AIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAME  126

Query  458  aeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            AELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  127  AELDLVVCITEGIPQHDMVRVKAALNRQSKTRLI  160



>ref|NP_001241205.1| uncharacterized protein LOC100782001 [Glycine max]
 gb|ACU24596.1| unknown [Glycine max]
Length=324

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  176  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  355
            RLF + +P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPV
Sbjct  21   RLFSAASPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPV  80

Query  356  FNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
            FNTVA+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL 
Sbjct  81   FNTVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALN  140

Query  536  QQTKTRLI  559
            +Q+KTRLI
Sbjct  141  RQSKTRLI  148



>ref|XP_007209332.1| hypothetical protein PRUPE_ppa008341mg [Prunus persica]
 gb|EMJ10531.1| hypothetical protein PRUPE_ppa008341mg [Prunus persica]
Length=336

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = +2

Query  101  ARLIANV-SKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQ  277
            A+LI ++ S+K  P   + + Q++ +    SP P VFVDKNTRVICQGITGKNGTFHTEQ
Sbjct  7    AKLIGSIASRKPSPSPSTSILQRRHYSPAPSPPPAVFVDKNTRVICQGITGKNGTFHTEQ  66

Query  278  AIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeame  457
            AIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAIMEAME
Sbjct  67   AIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAME  126

Query  458  aeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            AELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  127  AELDLVVCITEGIPQHDMVRVKAALNRQSKTRLI  160



>ref|XP_010547709.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Tarenaya hassleriana]
Length=348

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 136/166 (82%), Gaps = 9/166 (5%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR--------PITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQG  241
            M+ Q ARL+ ++S KVR        P  +S L Q +       P P VFVDKNTRVICQG
Sbjct  1    MSRQVARLLGSLSSKVRRSGNQEVFPSCRS-LTQSRSFTAAPPPPPAVFVDKNTRVICQG  59

Query  242  ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPP  421
            ITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP 
Sbjct  60   ITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPA  119

Query  422  PFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            PFA AAIMEA+EAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  120  PFAAAAIMEAVEAELDLVVCITEGIPQHDMVRVKAALAKQSKTRLI  165



>ref|XP_010491456.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Camelina sativa]
Length=348

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 131/171 (77%), Gaps = 13/171 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q ARLI ++S K R          P     L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQVARLIGSLSSKARRCSTGGSEVFPSCHQSLTSLTQSRSFASDPHPPAAVFVDKNTR  60

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  61   VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  120

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  121  IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNGQSKTRLI  171



>ref|XP_009413310.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Musa acuminata subsp. malaccensis]
Length=336

 Score =   215 bits (547),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = +2

Query  86   MAWQTARLIANVSKKV--RPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNG  259
            M+ Q ++L+ +++ K+   P    P     +H     PAP VFVDKNTRVICQGITGKNG
Sbjct  1    MSRQASKLVGSLASKIFANPTPVVPSSPLSRHFAAAPPAPAVFVDKNTRVICQGITGKNG  60

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFH+EQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV++AKAETKANASVIYVPPPFA AA
Sbjct  61   TFHSEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVSEAKAETKANASVIYVPPPFAAAA  120

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IMEA+EAELDLVVC+TEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  121  IMEALEAELDLVVCVTEGIPQHDMVRVKAALDKQSKTRLI  160



>ref|XP_010452813.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Camelina sativa]
Length=347

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 133/171 (78%), Gaps = 14/171 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q ARLI ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQVARLIGSLSSKARRCSTGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60   VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  120  IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNGQSKTRLI  170



>ref|XP_006288079.1| hypothetical protein CARUB_v10001317mg [Capsella rubella]
 gb|EOA20977.1| hypothetical protein CARUB_v10001317mg [Capsella rubella]
Length=347

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 133/171 (78%), Gaps = 14/171 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q ARLI ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQVARLIGSLSSKARRCSTGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60   VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  120  IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNGQSKTRLI  170



>ref|XP_002514509.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
 gb|EEF47909.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
Length=334

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 136/159 (86%), Gaps = 2/159 (1%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGT  262
            MA Q  A+LI +++ + +P   S   Q +Q+    SP   VFVDKNT +ICQGITGKNGT
Sbjct  1    MARQAVAKLIGSIASR-KPSLSSSAIQTRQYAAAASPPAAVFVDKNTGLICQGITGKNGT  59

Query  263  FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaai  442
            FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AAI
Sbjct  60   FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAI  119

Query  443  meameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            MEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  120  MEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLI  158



>ref|XP_004137529.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Cucumis sativus]
 gb|KGN64210.1| Succinyl-CoA ligase alpha 1 subunit [Cucumis sativus]
Length=342

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            SP P VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V
Sbjct  43   SPPPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSV  102

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
            A+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+K
Sbjct  103  AEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSK  162

Query  548  TRLI  559
            TRLI
Sbjct  163  TRLI  166



>emb|CDX81092.1| BnaC03g03460D [Brassica napus]
Length=346

 Score =   215 bits (547),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 132/170 (78%), Gaps = 13/170 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR-----------PITQSPLWQQQQHRLFGS-PAPEVFVDKNTRV  229
            M+ Q ARLI ++S K R           P  QS L    Q R F S P   VFVDKNTRV
Sbjct  1    MSRQVARLIGSLSSKARRCSNGGGSEAFPSRQS-LSSLTQSRSFASDPPAAVFVDKNTRV  59

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            +CQGITGKNGTFHTEQAIEYGT MV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  60   MCQGITGKNGTFHTEQAIEYGTNMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  119

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            YVP PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  120  YVPAPFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSKTRLI  169



>ref|XP_008393504.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Malus domestica]
Length=334

 Score =   214 bits (545),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 134/154 (87%), Gaps = 3/154 (2%)
 Frame = +2

Query  101  ARLIANV-SKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQ  277
            A+LI ++ S +  P T   L Q++ +     P P VFVDKNTRVICQGITGKNGTFHTEQ
Sbjct  7    AKLIRSIASHRTSPSTS--LLQRRHYSPAPPPPPAVFVDKNTRVICQGITGKNGTFHTEQ  64

Query  278  AIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeame  457
            AIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAI+EA+E
Sbjct  65   AIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAILEAVE  124

Query  458  aeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            AELDLVVCITEGIPQHDMV+VKAA+ +Q+KTRLI
Sbjct  125  AELDLVVCITEGIPQHDMVRVKAAINRQSKTRLI  158



>ref|NP_196447.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis 
thaliana]
 sp|P68209.1|SUCA1_ARATH RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha-1; Short=SCS-alpha-1; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA05023.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 emb|CAC08330.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAL61940.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAM47932.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAM60889.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AED91279.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis 
thaliana]
Length=347

 Score =   214 bits (546),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 133/171 (78%), Gaps = 14/171 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q ARLI ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQVARLIGSLSSKARRCSTGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKA+TKANASV
Sbjct  60   VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKADTKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  120  IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLI  170



>ref|XP_002871316.1| hypothetical protein ARALYDRAFT_487662 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47575.1| hypothetical protein ARALYDRAFT_487662 [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score =   214 bits (546),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 133/171 (78%), Gaps = 14/171 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q ARLI ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQVARLIGSLSSKARRCSTGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKA+TKANASV
Sbjct  60   VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKADTKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  120  IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLI  170



>emb|CDY02216.1| BnaA03g39510D [Brassica napus]
Length=346

 Score =   214 bits (545),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 132/170 (78%), Gaps = 12/170 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPI---------TQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            M+ +  +L+ ++  K+R           + S L    + R FG+   P   VFVDKNTRV
Sbjct  1    MSRRVTKLVGSLPSKLRSSVASSELLNPSCSSLTSLTKSRSFGTTPPPPAAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVI
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            YVP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  QTKTRLI
Sbjct  121  YVPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQTKTRLI  170



>ref|XP_003548295.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Glycine max]
Length=325

 Score =   214 bits (544),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 126/139 (91%), Gaps = 2/139 (1%)
 Frame = +2

Query  149  SPLWQQQQH--RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPK  322
            S +  ++ H  R F + +P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPK
Sbjct  11   SSIASRRHHGLRHFSAASPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPK  70

Query  323  KGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQ  502
            KGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQ
Sbjct  71   KGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQ  130

Query  503  HDMVKVKAALKQQTKTRLI  559
            HDMV+VKAAL +Q+KTRLI
Sbjct  131  HDMVRVKAALNRQSKTRLI  149



>ref|XP_006484523.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Citrus sinensis]
Length=331

 Score =   214 bits (544),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 126/149 (85%), Gaps = 3/149 (2%)
 Frame = +2

Query  122  SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYG  292
            S+ VR +  S      Q R F +   PAP VFVDKNTRVICQGITGKNGTFHT Q IEYG
Sbjct  7    SRVVRSLYMSSEICCGQSRSFTTAPPPAPAVFVDKNTRVICQGITGKNGTFHTAQGIEYG  66

Query  293  TKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDL  472
            TKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS IYVPPPFA AAI+EAMEAELDL
Sbjct  67   TKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASAIYVPPPFAAAAILEAMEAELDL  126

Query  473  VVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            VVCITEGIPQHDMV+VKAAL  Q+KTRL+
Sbjct  127  VVCITEGIPQHDMVRVKAALNNQSKTRLV  155



>ref|XP_002460917.1| hypothetical protein SORBIDRAFT_02g037420 [Sorghum bicolor]
 gb|EER97438.1| hypothetical protein SORBIDRAFT_02g037420 [Sorghum bicolor]
Length=332

 Score =   214 bits (544),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +2

Query  191  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  370
            P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  34   PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  93

Query  371  DAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKT  550
            +AKAETKANASVIYVPPPFA AAIMEAM+AELDLVVCITEGIPQHDMVKVKAAL +Q+KT
Sbjct  94   EAKAETKANASVIYVPPPFAAAAIMEAMDAELDLVVCITEGIPQHDMVKVKAALNRQSKT  153

Query  551  RLI  559
            RLI
Sbjct  154  RLI  156



>gb|KJB31856.1| hypothetical protein B456_005G211200 [Gossypium raimondii]
Length=288

 Score =   213 bits (541),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 137/170 (81%), Gaps = 12/170 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP---------ITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            MA Q +RLI ++S ++ P          + S      Q R F +   P P VFVDKNTRV
Sbjct  1    MARQASRLIQSLSSRISPHKPQLSPLTPSSSSSQLLTQSRSFSAAPAPQPAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            YVPP FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLI
Sbjct  121  YVPPAFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLI  170



>gb|AFK38534.1| unknown [Medicago truncatula]
Length=216

 Score =   210 bits (534),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +2

Query  149  SPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKG  328
            S +    +     +P+P V VDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKG
Sbjct  11   SSIASNNRRNFSSTPSPAVLVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKG  70

Query  329  GTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHD  508
            GTEHLGLPVFN+VA+AK ETKANASVIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHD
Sbjct  71   GTEHLGLPVFNSVAEAKTETKANASVIYVPPPFAAAAIMEAVEAELDLVVCITEGIPQHD  130

Query  509  MVKVKAALKQQTKTRLI  559
            MV+VKAAL +Q+KTRLI
Sbjct  131  MVRVKAALNRQSKTRLI  147



>gb|KJB31854.1| hypothetical protein B456_005G211200 [Gossypium raimondii]
Length=261

 Score =   211 bits (538),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 137/170 (81%), Gaps = 12/170 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP---------ITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            MA Q +RLI ++S ++ P          + S      Q R F +   P P VFVDKNTRV
Sbjct  1    MARQASRLIQSLSSRISPHKPQLSPLTPSSSSSQLLTQSRSFSAAPAPQPAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            YVPP FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLI
Sbjct  121  YVPPAFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLI  170



>ref|XP_003620150.1| Succinyl-CoA ligase [Medicago truncatula]
 gb|AES76368.1| succinyl-CoA ligase [ADP-forming] subunit alpha-2 [Medicago truncatula]
Length=323

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +2

Query  149  SPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKG  328
            S +    +     +P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKG
Sbjct  11   SSIASNNRRNFSSTPSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKG  70

Query  329  GTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHD  508
            GTEHLGLPVFN+VA+AK ETKANASVIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHD
Sbjct  71   GTEHLGLPVFNSVAEAKTETKANASVIYVPPPFAAAAIMEAVEAELDLVVCITEGIPQHD  130

Query  509  MVKVKAALKQQTKTRLI  559
            MV+VKAAL +Q+KTRLI
Sbjct  131  MVRVKAALNRQSKTRLI  147



>gb|KJB31855.1| hypothetical protein B456_005G211200 [Gossypium raimondii]
Length=275

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 137/170 (81%), Gaps = 12/170 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP---------ITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            MA Q +RLI ++S ++ P          + S      Q R F +   P P VFVDKNTRV
Sbjct  1    MARQASRLIQSLSSRISPHKPQLSPLTPSSSSSQLLTQSRSFSAAPAPQPAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            YVPP FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLI
Sbjct  121  YVPPAFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLI  170



>ref|XP_006288023.1| hypothetical protein CARUB_v10001256mg, partial [Capsella rubella]
 gb|EOA20921.1| hypothetical protein CARUB_v10001256mg, partial [Capsella rubella]
Length=359

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 132/168 (79%), Gaps = 11/168 (7%)
 Frame = +2

Query  86   MAWQTARLIANV-------SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVIC  235
            M+ Q  RL+ ++       S +V P   S L    Q R FG+   P   VFVDKNTRVIC
Sbjct  17   MSRQITRLLGSLRRSCGGGSSEVVPSCCS-LTSLTQSRSFGTTPPPPAAVFVDKNTRVIC  75

Query  236  QGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYV  415
            QGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYV
Sbjct  76   QGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYV  135

Query  416  PPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            P PFA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q+KTRLI
Sbjct  136  PAPFAAAAIMEGIAAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLI  183



>ref|XP_003562832.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Brachypodium distachyon]
Length=327

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            +P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+V
Sbjct  28   APSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSV  87

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
            A+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q+K
Sbjct  88   AEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQSK  147

Query  548  TRLI  559
            TRLI
Sbjct  148  TRLI  151



>gb|KJB31853.1| hypothetical protein B456_005G211200 [Gossypium raimondii]
Length=346

 Score =   213 bits (542),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 137/170 (81%), Gaps = 12/170 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP---------ITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            MA Q +RLI ++S ++ P          + S      Q R F +   P P VFVDKNTRV
Sbjct  1    MARQASRLIQSLSSRISPHKPQLSPLTPSSSSSQLLTQSRSFSAAPAPQPAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            YVPP FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLI
Sbjct  121  YVPPAFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLI  170



>emb|CDX69957.1| BnaA10g23060D [Brassica napus]
Length=347

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 132/171 (77%), Gaps = 14/171 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q  RL+ ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQFTRLLGSLSSKARRCSIGFSEVSPSCQS-LTSLTQSRSFASDPPPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60   VMCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IYVP PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  120  IYVPAPFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSKTRLI  170



>ref|XP_006399319.1| hypothetical protein EUTSA_v10013993mg [Eutrema salsugineum]
 gb|ESQ40772.1| hypothetical protein EUTSA_v10013993mg [Eutrema salsugineum]
Length=347

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 132/171 (77%), Gaps = 14/171 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q  RL+ ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQVTRLLGSLSSKARRCSIGGSEVFPSCQS-LSSLTQSRSFASDPPPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60   VMCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IYVP PFA AAIME ++AELDL+VCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  120  IYVPAPFAAAAIMEGIQAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLI  170



>ref|XP_011047755.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
Length=342

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 140/167 (84%), Gaps = 10/167 (6%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRP--------ITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQ  238
            MA Q  A+L+ +++ + +P        ++ SP+ Q + +     P P VFVDKNTRVICQ
Sbjct  1    MARQAVAKLLGSIASR-KPSSATSLINLSPSPVAQTRHYAAAPPPPPAVFVDKNTRVICQ  59

Query  239  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  418
            GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAET+ANASVIYVP
Sbjct  60   GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETRANASVIYVP  119

Query  419  PPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            PPFA AAIMEAMEAEL+LVVCITEGIPQHDMV+VKAAL +QTKTRLI
Sbjct  120  PPFAAAAIMEAMEAELNLVVCITEGIPQHDMVRVKAALNRQTKTRLI  166



>ref|XP_009125723.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Brassica rapa]
 emb|CDY40757.1| BnaAnng06200D [Brassica napus]
Length=342

 Score =   212 bits (540),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 131/165 (79%), Gaps = 7/165 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSP----LWQQQQHRLFGS---PAPEVFVDKNTRVICQGI  244
            M+ Q ARL+ ++S++    +       L    Q R F S   P   VFVDKNTRV+CQGI
Sbjct  1    MSRQVARLLGSLSRRCSSTSSEAIPPTLSSFTQSRSFASDPPPPAAVFVDKNTRVMCQGI  60

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP P
Sbjct  61   TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPAP  120

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            FA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  121  FAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLI  165



>ref|XP_002268479.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Vitis vinifera]
Length=340

 Score =   212 bits (540),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = +2

Query  86   MAWQTA--RLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNG  259
            MA + A  +LI +++ K+   T S   Q +       P P VFVDKNTRVICQGITGKNG
Sbjct  5    MARRAAAQQLIDSIASKLSSATASS-AQTRGFAAAAHPPPAVFVDKNTRVICQGITGKNG  63

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKAN SVIYVPPPFA AA
Sbjct  64   TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANTSVIYVPPPFAAAA  123

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IMEAMEAELDLVVCITEGIPQHDMVKVKAAL +QTKTRLI
Sbjct  124  IMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQTKTRLI  163



>ref|XP_010421123.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Camelina sativa]
Length=345

 Score =   212 bits (540),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 120/140 (86%), Gaps = 3/140 (2%)
 Frame = +2

Query  149  SPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTP  319
            S L    Q R FG+   P   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV GVTP
Sbjct  30   SSLTSLTQSRSFGTTPPPPAAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVAGVTP  89

Query  320  KKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIP  499
            KKGGTEHLGLPVFNTVA+AKAETKANASVIYVP PFA AAIME + AELDLVVCITEGIP
Sbjct  90   KKGGTEHLGLPVFNTVAEAKAETKANASVIYVPAPFAAAAIMEGVAAELDLVVCITEGIP  149

Query  500  QHDMVKVKAALKQQTKTRLI  559
            QHDMV+VKAAL  Q+KTRLI
Sbjct  150  QHDMVRVKAALNSQSKTRLI  169



>emb|CBI35274.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = +2

Query  86   MAWQTA--RLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNG  259
            MA + A  +LI +++ K+   T S   Q +       P P VFVDKNTRVICQGITGKNG
Sbjct  1    MARRAAAQQLIDSIASKLSSATASS-AQTRGFAAAAHPPPAVFVDKNTRVICQGITGKNG  59

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKAN SVIYVPPPFA AA
Sbjct  60   TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANTSVIYVPPPFAAAA  119

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IMEAMEAELDLVVCITEGIPQHDMVKVKAAL +QTKTRLI
Sbjct  120  IMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQTKTRLI  159



>emb|CDX78333.1| BnaA03g02450D [Brassica napus]
Length=346

 Score =   212 bits (540),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 131/170 (77%), Gaps = 13/170 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR-----------PITQSPLWQQQQHRLFGS-PAPEVFVDKNTRV  229
            M  Q ARLI ++S K R           P  Q+ L    Q R F S P   VFVDKNTRV
Sbjct  1    MFRQVARLIGSLSSKARRCSSGGGSEAFPSCQT-LSSLTQSRSFASDPPAAVFVDKNTRV  59

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            +CQGITGKNGTFHTEQAIEYGT MV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  60   MCQGITGKNGTFHTEQAIEYGTNMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  119

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            YVP PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  120  YVPAPFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSKTRLI  169



>ref|XP_004958125.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Setaria italica]
Length=332

 Score =   211 bits (538),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +2

Query  191  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  370
            P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  34   PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  93

Query  371  DAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKT  550
            +AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q+KT
Sbjct  94   EAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQSKT  153

Query  551  RLI  559
            RLI
Sbjct  154  RLI  156



>ref|NP_001136494.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 gb|ACF82043.1| unknown [Zea mays]
 tpg|DAA63303.1| TPA: succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=331

 Score =   211 bits (538),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +2

Query  191  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  370
            P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  33   PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  92

Query  371  DAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKT  550
            +AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q+KT
Sbjct  93   EAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQSKT  152

Query  551  RLI  559
            RLI
Sbjct  153  RLI  155



>ref|XP_008788992.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Phoenix dactylifera]
Length=341

 Score =   212 bits (539),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/119 (94%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  47   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  106

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ETKANASVIYVPPPFA AAI+EAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  107  ETKANASVIYVPPPFAAAAILEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLI  165



>ref|XP_010493442.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Camelina sativa]
Length=345

 Score =   212 bits (539),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 132/170 (78%), Gaps = 13/170 (8%)
 Frame = +2

Query  86   MAWQTARLIANV---------SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            M+ Q  RL+ ++         S+ V P + S L      R FG+   P   VFVDKNTRV
Sbjct  1    MSRQVTRLLGSLRRCSGGGGSSELVIP-SCSSLTSLTHSRSFGTTPPPPAAVFVDKNTRV  59

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVI
Sbjct  60   ICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVI  119

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            YVP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  Q+KTRLI
Sbjct  120  YVPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQSKTRLI  169



>emb|CDY21531.1| BnaC09g47610D [Brassica napus]
Length=347

 Score =   211 bits (538),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 133/171 (78%), Gaps = 14/171 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS-PAP--EVFVDKNTR  226
            M+ Q  RL+ ++S   R          P  QS L    Q R F S P+P   VFVDKNTR
Sbjct  1    MSRQVTRLLGSLSSNARRCSIGFSEVSPSCQS-LTSLTQSRSFASDPSPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60   VMCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IYVP PFA AAIME ++AELDL+VCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  120  IYVPAPFAAAAIMEGIQAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLI  170



>sp|Q6ZL94.1|SUCA_ORYSJ RecName: Full=Probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial; AltName: Full=Succinyl-CoA synthetase 
subunit alpha; Short=SCS-alpha; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAC83073.1| putative succinyl-CoA ligase alpha subunit [Oryza sativa Japonica 
Group]
 gb|EAZ40411.1| hypothetical protein OsJ_24862 [Oryza sativa Japonica Group]
 dbj|BAH01520.1| unnamed protein product [Oryza sativa Japonica Group]
Length=331

 Score =   211 bits (537),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +2

Query  191  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  370
            P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  33   PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTTMVGGVTPKKGGTEHLGLPVFNSVA  92

Query  371  DAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKT  550
            +AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q+KT
Sbjct  93   EAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNKQSKT  152

Query  551  RLI  559
            RLI
Sbjct  153  RLI  155



>ref|XP_011022031.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Populus euphratica]
Length=331

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  37   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKA  96

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ETKANASVIYVPPPFA AAI+EA+EAELDLVVCITEGIPQHDMV+VKAA+K+Q+KTRLI
Sbjct  97   ETKANASVIYVPPPFAAAAILEAVEAELDLVVCITEGIPQHDMVRVKAAIKKQSKTRLI  155



>gb|KDP45810.1| hypothetical protein JCGZ_17417 [Jatropha curcas]
Length=339

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTR+ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  45   VFVDKNTRLICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  104

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ETKANASVIYVPPPFA AAIMEA EAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  105  ETKANASVIYVPPPFAAAAIMEATEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLI  163



>ref|XP_011003681.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
 ref|XP_011003682.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
Length=373

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 137/158 (87%), Gaps = 6/158 (4%)
 Frame = +2

Query  101  ARLIANVSKKVRPITQSPLWQ--QQQHRLFGSPAPE---VFVDKNTRVICQGITGKNGTF  265
            A+L+ +++ + +P +   L+   + Q R + +P P    VFVDKNTRVICQGITGKNGTF
Sbjct  41   AKLLGSIASR-KPSSTPSLFNLSRSQTRYYAAPPPPPPAVFVDKNTRVICQGITGKNGTF  99

Query  266  HTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaim  445
            HTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AAI+
Sbjct  100  HTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAIL  159

Query  446  eameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            EAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  160  EAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLI  197



>ref|XP_002307162.2| hypothetical protein POPTR_0005s09370g [Populus trichocarpa]
 gb|EEE94158.2| hypothetical protein POPTR_0005s09370g [Populus trichocarpa]
Length=331

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V++AKA
Sbjct  37   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVSEAKA  96

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ETKANASVIYVPPPFA AAI+EA+EAELDLVVCITEGIPQHDMV+VKAA+K+QTKTRLI
Sbjct  97   ETKANASVIYVPPPFAAAAILEAVEAELDLVVCITEGIPQHDMVRVKAAIKKQTKTRLI  155



>gb|ABK95068.1| unknown [Populus trichocarpa]
Length=331

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V++AKA
Sbjct  37   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVSEAKA  96

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ETKANASVIYVPPPFA AAI+EA+EAELDLVVCITEGIPQHDMV+VKAA+K+QTKTRLI
Sbjct  97   ETKANASVIYVPPPFAAAAILEAVEAELDLVVCITEGIPQHDMVRVKAAIKKQTKTRLI  155



>ref|XP_010087141.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1 [Morus notabilis]
 gb|EXB27046.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1 [Morus notabilis]
Length=273

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  42   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKA  101

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ETKANASVIYVPPPFA AAIMEA+EAELDLVVC+TEGIPQHDMV+VKAAL +Q+KTR+I
Sbjct  102  ETKANASVIYVPPPFAAAAIMEAVEAELDLVVCVTEGIPQHDMVRVKAALNRQSKTRVI  160



>ref|XP_009131054.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Brassica rapa]
Length=343

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 132/167 (79%), Gaps = 10/167 (6%)
 Frame = +2

Query  86   MAWQTAR-LIANVSKKVR-------PITQSPLWQQQQHRLFGS-PAPEVFVDKNTRVICQ  238
            M+ Q AR LI ++S K R       P  Q+ L    Q R F S P   VFVDKNTRV+CQ
Sbjct  1    MSRQVARRLIGSLSSKARRCSSEVFPSCQT-LSSLTQSRSFASDPPAAVFVDKNTRVMCQ  59

Query  239  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  418
            GITGKNGTFHTEQAIEYGT MV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP
Sbjct  60   GITGKNGTFHTEQAIEYGTNMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVP  119

Query  419  PPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  120  APFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSKTRLI  166



>ref|XP_010454606.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Camelina sativa]
Length=346

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 131/170 (77%), Gaps = 12/170 (7%)
 Frame = +2

Query  86   MAWQTARLIANV---------SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            M+ Q  RL+ ++         S+ V   + S L    Q R FG+   P   VFVDKNTRV
Sbjct  1    MSRQVTRLLGSLRRCSGGGGSSELVVVPSCSSLTSLTQSRSFGTTHPPPAAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASV 
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVS  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            YVP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  Q+KTRLI
Sbjct  121  YVPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQSKTRLI  170



>ref|XP_002872045.1| hypothetical protein ARALYDRAFT_489184 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48304.1| hypothetical protein ARALYDRAFT_489184 [Arabidopsis lyrata subsp. 
lyrata]
Length=339

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 119/138 (86%), Gaps = 3/138 (2%)
 Frame = +2

Query  155  LWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKK  325
            L    Q R FG+   P   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV GVTPKK
Sbjct  26   LTSLTQSRSFGTTPPPPAAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVAGVTPKK  85

Query  326  GGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQH  505
            GGTEHLGLPVFNTVA+AKAETKANASVIYVP PFA AAIME + AELDL+VCITEGIPQH
Sbjct  86   GGTEHLGLPVFNTVAEAKAETKANASVIYVPAPFAAAAIMEGLAAELDLIVCITEGIPQH  145

Query  506  DMVKVKAALKQQTKTRLI  559
            DMV+VKAAL  Q+KTRLI
Sbjct  146  DMVRVKAALNSQSKTRLI  163



>gb|KFK27646.1| hypothetical protein AALP_AA8G410300 [Arabis alpina]
Length=347

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 131/171 (77%), Gaps = 13/171 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKK----------VRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q  RL+ ++S K          V P   S L    Q R FG+   P   VFVDKNTR
Sbjct  1    MSRQVTRLLGSLSSKALRSGSSSSEVYPSCSSSLTSLTQSRSFGTTPPPPAAVFVDKNTR  60

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            VICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKA ASV
Sbjct  61   VICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKATASV  120

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IYVP PFA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q+KTRLI
Sbjct  121  IYVPAPFAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLI  171



>ref|NP_001119263.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
 gb|AED93142.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
Length=297

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 128/165 (78%), Gaps = 7/165 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQ----SPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGI  244
            M+ Q  RL+ ++       +       L    Q R FG+   P   VFVDKNTRVICQGI
Sbjct  1    MSRQVTRLLGSLRHSGGGCSGSSKVCSLTSLVQSRSFGTTPPPPAAVFVDKNTRVICQGI  60

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVP P
Sbjct  61   TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPAP  120

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            FA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q+KTRLI
Sbjct  121  FAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLI  165



>gb|KCW57893.1| hypothetical protein EUGRSUZ_H00643 [Eucalyptus grandis]
Length=255

 Score =   207 bits (527),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P VFVDK+TRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+A
Sbjct  42   PAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEA  101

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRL  556
            KAETKANASV+YVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRL
Sbjct  102  KAETKANASVVYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRL  161

Query  557  I  559
            I
Sbjct  162  I  162



>gb|AAM65450.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
Length=341

 Score =   210 bits (534),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 128/165 (78%), Gaps = 7/165 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQ----SPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGI  244
            M+ Q  RL+ ++       +       L    Q R FG+   P   VFVDKNTRVICQGI
Sbjct  1    MSRQVTRLLGSLRHSGGGCSGSSKVCSLTSLVQSRSFGTTPPPPAAVFVDKNTRVICQGI  60

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVP P
Sbjct  61   TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPAP  120

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            FA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q+KTRLI
Sbjct  121  FAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLI  165



>ref|NP_197716.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
 sp|Q8LAD2.2|SUCA2_ARATH RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha-2; Short=SCS-alpha-2; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB11180.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
 gb|AAM12993.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
 gb|AAM47926.1| succinyl-CoA synthetase alpha subunit [Arabidopsis thaliana]
 gb|AED93141.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
Length=341

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 128/165 (78%), Gaps = 7/165 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQ----SPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGI  244
            M+ Q  RL+ ++       +       L    Q R FG+   P   VFVDKNTRVICQGI
Sbjct  1    MSRQVTRLLGSLRHSGGGCSGSSKVCSLTSLVQSRSFGTTPPPPAAVFVDKNTRVICQGI  60

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVP P
Sbjct  61   TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPAP  120

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            FA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q+KTRLI
Sbjct  121  FAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLI  165



>gb|KDP45811.1| hypothetical protein JCGZ_17418 [Jatropha curcas]
Length=341

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/119 (95%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  47   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  106

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  107  ETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLI  165



>ref|XP_004515280.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Cicer arietinum]
Length=327

 Score =   209 bits (531),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFNTV++A
Sbjct  31   PAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNTVSEA  90

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRL  556
            KAETKANASVIYVPPPFA AAIME++EAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRL
Sbjct  91   KAETKANASVIYVPPPFAAAAIMESLEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRL  150

Query  557  I  559
            I
Sbjct  151  I  151



>ref|XP_009122444.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Brassica rapa]
Length=347

 Score =   209 bits (533),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 131/170 (77%), Gaps = 12/170 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPIT-----QSPLWQQ----QQHRLFGS---PAPEVFVDKNTRV  229
            M+ Q  RL+ ++S   R  +      SP  Q      Q R F S   P   VFVDKNTRV
Sbjct  1    MSRQVTRLLGSLSSNARRCSIGFSEVSPSCQYLTSLTQSRSFASDPPPPAAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            +CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61   MCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            YVP PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  121  YVPAPFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSKTRLI  170



>ref|XP_010069514.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Eucalyptus grandis]
 gb|KCW57892.1| hypothetical protein EUGRSUZ_H00643 [Eucalyptus grandis]
Length=339

 Score =   209 bits (532),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P VFVDK+TRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+A
Sbjct  42   PAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEA  101

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRL  556
            KAETKANASV+YVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRL
Sbjct  102  KAETKANASVVYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRL  161

Query  557  I  559
            I
Sbjct  162  I  162



>ref|XP_009389047.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Musa acuminata subsp. malaccensis]
Length=341

 Score =   209 bits (532),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 134/165 (81%), Gaps = 7/165 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKV--RP-----ITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGI  244
            M  Q +RLI  ++ K+  RP      + +     +       P P VFVDKNTRVICQGI
Sbjct  1    MNRQASRLIGTLASKIFSRPNPSAASSSTLSSPSRHFAAAPPPPPAVFVDKNTRVICQGI  60

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPP
Sbjct  61   TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPP  120

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  121  FAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLI  165



>dbj|BAJ94034.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92411.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   208 bits (530),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  35   VFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKA  94

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ETKANASVIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHDMVKVKAAL +Q+KTRLI
Sbjct  95   ETKANASVIYVPPPFAAAAIMEALEAELDLVVCITEGIPQHDMVKVKAALNRQSKTRLI  153



>ref|XP_010688675.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=342

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 130/166 (78%), Gaps = 8/166 (5%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQH----RLFGS----PAPEVFVDKNTRVICQG  241
            MA Q +RL+A +S K++    S            R FG+    P P VFVDK+TRVICQG
Sbjct  1    MARQASRLVATLSSKIQSPKSSISSSISSSSPKTRDFGTVARHPPPAVFVDKHTRVICQG  60

Query  242  ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPP  421
            ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLG+PVFN+VA+AK  T A ASVIYVPP
Sbjct  61   ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGVPVFNSVAEAKEATGAQASVIYVPP  120

Query  422  PFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            PFA  AIME +EAELDL+VCITEGIPQHDMV+VKAAL  Q+KTRLI
Sbjct  121  PFAAKAIMEGLEAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLI  166



>gb|EMT17065.1| Putative succinyl-CoA ligase (GDP-forming) subunit alpha, mitochondrial 
[Aegilops tauschii]
Length=356

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  36   VFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKA  95

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ETKANASVIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHDMVKVKAAL +Q+KTRLI
Sbjct  96   ETKANASVIYVPPPFAAAAIMEALEAELDLVVCITEGIPQHDMVKVKAALNRQSKTRLI  154



>gb|ACG31861.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=320

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  26   VFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKA  85

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ETKANASVIYVPPPFA AAIME+MEAELDLVVCITEGIPQHDMVKVKAAL +Q+KTRLI
Sbjct  86   ETKANASVIYVPPPFAAAAIMESMEAELDLVVCITEGIPQHDMVKVKAALNRQSKTRLI  144



>dbj|BAK03449.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  35   VFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKA  94

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ETKANASVIYVPPPFA A IMEA+EAELDLVVCITEGIPQHDMVKVKAAL +Q+KTRLI
Sbjct  95   ETKANASVIYVPPPFAAATIMEALEAELDLVVCITEGIPQHDMVKVKAALNRQSKTRLI  153



>ref|XP_008796686.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Phoenix dactylifera]
Length=340

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 138/164 (84%), Gaps = 6/164 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKV----RPITQSPLWQQQQHRLFGSPAPE--VFVDKNTRVICQGIT  247
            M+ Q ++L+ +++ K+    R    SPL  Q +     +P+P   VFVDKNTRVICQGIT
Sbjct  1    MSRQASKLVGSLASKLVSQPRFSASSPLSSQLRRHFAAAPSPPPAVFVDKNTRVICQGIT  60

Query  248  GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPF  427
            GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPP F
Sbjct  61   GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPAF  120

Query  428  agaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            A AAI+EA+EAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLI
Sbjct  121  AAAAILEALEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLI  164



>ref|NP_001149702.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 gb|ACG36440.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 tpg|DAA41208.1| TPA: succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=331

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +2

Query  191  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  370
            P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  33   PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  92

Query  371  DAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKT  550
            +AKAETKANA+VIYVPPPFA AAIMEAMEAELDL VCITEGIPQHDMVKVKAAL  Q+KT
Sbjct  93   EAKAETKANATVIYVPPPFAAAAIMEAMEAELDLAVCITEGIPQHDMVKVKAALNSQSKT  152

Query  551  RLI  559
            RLI
Sbjct  153  RLI  155



>gb|AGT16123.1| succinyl-CoA ligase [Saccharum hybrid cultivar R570]
Length=458

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +2

Query  191  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  370
            P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  33   PSPVVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  92

Query  371  DAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKT  550
            +AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q+KT
Sbjct  93   EAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQSKT  152

Query  551  RLI  559
            RLI
Sbjct  153  RLI  155



>ref|XP_010546242.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Tarenaya hassleriana]
Length=346

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 132/165 (80%), Gaps = 7/165 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQ----QQHRLF---GSPAPEVFVDKNTRVICQGI  244
            M+    RL+ ++S  VR    S ++       Q R F     P P VFVDKNTRVICQGI
Sbjct  1    MSRLVTRLLGSLSSNVRRSGNSEVFPSCPLLTQSRSFTAAPPPPPAVFVDKNTRVICQGI  60

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP P
Sbjct  61   TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPAP  120

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL  Q+KTRLI
Sbjct  121  FAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNSQSKTRLI  165



>ref|XP_004299462.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Fragaria vesca subsp. vesca]
Length=337

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 136/161 (84%), Gaps = 3/161 (2%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKK--VRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKN  256
            MA Q+ A+LI +++ +    P T +    Q++H     P P VFVDKNTRVICQGITGKN
Sbjct  1    MARQSVAKLIGSIASRKLSSPSTSTTSIIQRRHYAAAPPPPAVFVDKNTRVICQGITGKN  60

Query  257  GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFaga  436
            GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V +AKAETKANA+VIYVPPPFA A
Sbjct  61   GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVVEAKAETKANATVIYVPPPFAAA  120

Query  437  aimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            AIMEAMEAELDLVVCITEGIPQHDMV+VKAAL  Q+KTRLI
Sbjct  121  AIMEAMEAELDLVVCITEGIPQHDMVRVKAALNSQSKTRLI  161



>ref|XP_006394390.1| hypothetical protein EUTSA_v10003962mg [Eutrema salsugineum]
 gb|ESQ31676.1| hypothetical protein EUTSA_v10003962mg [Eutrema salsugineum]
Length=539

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 132/171 (77%), Gaps = 14/171 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q  RL+ ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQVTRLLGSLSSKARRCSIGGSEVFPSCQS-LSSLTQSRSFASDPPPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60   VMCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            IYVP PFA AAIME ++AELDL+VCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  120  IYVPAPFAAAAIMEGIQAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLI  170



>ref|XP_010241497.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
 ref|XP_010241498.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
 ref|XP_010241499.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
Length=346

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/116 (94%), Positives = 114/116 (98%), Gaps = 0/116 (0%)
 Frame = +2

Query  212  DKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETK  391
            DKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETK
Sbjct  55   DKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETK  114

Query  392  ANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ANASVIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLI
Sbjct  115  ANASVIYVPPPFAAAAIMEALEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLI  170



>ref|XP_010031908.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Eucalyptus grandis]
 gb|KCW51304.1| hypothetical protein EUGRSUZ_J00864 [Eucalyptus grandis]
Length=333

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDK+TRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  39   VFVDKSTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKA  98

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ETKANAS +YVPPPFA AAIMEA+EAELDLVVCITEGIPQHDMV+VKAA+  Q+KTRLI
Sbjct  99   ETKANASAVYVPPPFAAAAIMEAVEAELDLVVCITEGIPQHDMVRVKAAINSQSKTRLI  157



>emb|CAA48891.1| succinate--CoA ligase (GDP-forming) [Arabidopsis thaliana]
Length=345

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
            +VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AK
Sbjct  50   QVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAK  109

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            AETKANASVIYVP PFA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q+KTRLI
Sbjct  110  AETKANASVIYVPAPFAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLI  169



>gb|ABK94372.1| unknown [Populus trichocarpa]
Length=331

 Score =   204 bits (520),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V++AKA
Sbjct  37   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVSEAKA  96

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ETKANASVIYV PPFA AAI+EA+EAELDLVVCITEGIPQHD+V+VKAA+K+Q+KTRLI
Sbjct  97   ETKANASVIYVTPPFAAAAILEAVEAELDLVVCITEGIPQHDVVRVKAAIKKQSKTRLI  155



>ref|XP_006658733.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like, partial [Oryza brachyantha]
Length=294

 Score =   203 bits (517),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  206  FVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAE  385
            FVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKAE
Sbjct  1    FVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKAE  60

Query  386  TKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            TKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q+KTRLI
Sbjct  61   TKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNKQSKTRLI  118



>gb|KHN23614.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Glycine soja]
Length=345

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 122/149 (82%), Gaps = 21/149 (14%)
 Frame = +2

Query  176  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  355
            RLF + +P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPV
Sbjct  21   RLFSAASPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPV  80

Query  356  FNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDM--------  511
            FNTVA+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDM        
Sbjct  81   FNTVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMASRFGILN  140

Query  512  -------------VKVKAALKQQTKTRLI  559
                         V+VKAAL +Q+KTRLI
Sbjct  141  SGEMYLAPLNGGKVRVKAALNRQSKTRLI  169



>ref|XP_001765853.1| predicted protein [Physcomitrella patens]
 gb|EDQ69444.1| predicted protein [Physcomitrella patens]
Length=324

 Score =   201 bits (510),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 126/153 (82%), Gaps = 6/153 (4%)
 Frame = +2

Query  104  RLIANVSKKV-RPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQA  280
            R +A +++++ R  T S   ++Q      S  P VFVDK TRVICQGITGKNGTFHTEQA
Sbjct  2    RRVAGIARQLGRLATHSDGGRRQL-----SSRPAVFVDKTTRVICQGITGKNGTFHTEQA  56

Query  281  IEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeamea  460
            I+YGT MVGGVTPKKGGTEHLGLPVFNTVA+AK ETKANASVIYVP   A  AI+EA++A
Sbjct  57   IDYGTNMVGGVTPKKGGTEHLGLPVFNTVAEAKKETKANASVIYVPASLAANAILEALDA  116

Query  461  eLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ELDLVVCITEGIPQHDMVKVK+AL QQ+KTRLI
Sbjct  117  ELDLVVCITEGIPQHDMVKVKSALLQQSKTRLI  149



>gb|KDO46157.1| hypothetical protein CISIN_1g030169mg [Citrus sinensis]
Length=181

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 125/157 (80%), Gaps = 15/157 (10%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRPITQSPLWQQQ---------QHRLFGSPA----PEVFVDKNT  223
            MA Q  A+LI ++  + RP T S +   +           R +GS A    P VFVDKNT
Sbjct  1    MARQALAKLIGSIGSR-RPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHPAVFVDKNT  59

Query  224  RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANAS  403
            RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS
Sbjct  60   RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANAS  119

Query  404  VIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMV  514
            VIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV
Sbjct  120  VIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMV  156



>ref|XP_004172973.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Cucumis sativus]
Length=154

 Score =   193 bits (491),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            SP P VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V
Sbjct  43   SPPPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSV  102

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMV  514
            A+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV
Sbjct  103  AEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMV  151



>ref|XP_002964011.1| hypothetical protein SELMODRAFT_405593 [Selaginella moellendorffii]
 gb|EFJ34344.1| hypothetical protein SELMODRAFT_405593 [Selaginella moellendorffii]
Length=150

 Score =   192 bits (488),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = +2

Query  116  NVSKKVRPITQSPLWQQQQHRLFGSPA--PEVFVDKNTRVICQGITGKNGTFHTEQAIEY  289
            + ++++    +       Q R FGS A  P VFVDKNTRV+CQGITGKNGTFHTEQAIEY
Sbjct  3    SAARRIAAFVERSSSAGSQRRGFGSSASTPAVFVDKNTRVLCQGITGKNGTFHTEQAIEY  62

Query  290  GTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLD  469
            GTKMVGGVTPKKGGTEHLGLPVFN+V +AKAETKANA+VIYVPP FA AAIMEA+EAELD
Sbjct  63   GTKMVGGVTPKKGGTEHLGLPVFNSVHEAKAETKANATVIYVPPKFAAAAIMEAVEAELD  122

Query  470  LVVCITEGIPQHDM  511
            LVVCITEGIPQHDM
Sbjct  123  LVVCITEGIPQHDM  136



>ref|XP_001762925.1| predicted protein [Physcomitrella patens]
 gb|EDQ72130.1| predicted protein [Physcomitrella patens]
Length=324

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 123/152 (81%), Gaps = 4/152 (3%)
 Frame = +2

Query  104  RLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAI  283
            R I  +++++    Q    Q+   R   +  P VFVDK TRVICQGITGKNGTFHTEQAI
Sbjct  2    RGIGGIARQL----QRLAAQRDGARRQLTTGPAVFVDKTTRVICQGITGKNGTFHTEQAI  57

Query  284  EYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameae  463
            +YGT MVGGVTPKKGGTEHLGLPVFNTVA+AK ET+ANASVIYVP   A  AI+EA++AE
Sbjct  58   DYGTNMVGGVTPKKGGTEHLGLPVFNTVAEAKKETRANASVIYVPASLAANAILEALDAE  117

Query  464  LDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            LDLVVCITEGIPQHDMVKVK+AL QQ+KTRLI
Sbjct  118  LDLVVCITEGIPQHDMVKVKSALLQQSKTRLI  149



>ref|XP_002967911.1| hypothetical protein SELMODRAFT_408824 [Selaginella moellendorffii]
 gb|EFJ31258.1| hypothetical protein SELMODRAFT_408824 [Selaginella moellendorffii]
Length=150

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = +2

Query  116  NVSKKVRPITQSPLWQQQQHRLFGSPA--PEVFVDKNTRVICQGITGKNGTFHTEQAIEY  289
            + ++++    +       Q R FGS A  P VFVDKNTRV+CQGITGKNGTFHTEQAIEY
Sbjct  3    SAARRIAAFVERSNSAGSQRRGFGSSASTPAVFVDKNTRVLCQGITGKNGTFHTEQAIEY  62

Query  290  GTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLD  469
            GTKMVGGVTPKKGGTEHLGLPVFN+V +AKAETKANA+VIYVPP FA AAIMEA+EAELD
Sbjct  63   GTKMVGGVTPKKGGTEHLGLPVFNSVHEAKAETKANATVIYVPPKFAAAAIMEAVEAELD  122

Query  470  LVVCITEGIPQHDM  511
            LVVCITEGIPQHDM
Sbjct  123  LVVCITEGIPQHDM  136



>gb|KDO46156.1| hypothetical protein CISIN_1g030169mg [Citrus sinensis]
Length=182

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 125/158 (79%), Gaps = 16/158 (10%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRPITQSPLWQQQ---------QHRLFGSPA----PEVFVDKNT  223
            MA Q  A+LI ++  + RP T S +   +           R +GS A    P VFVDKNT
Sbjct  1    MARQALAKLIGSIGSR-RPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHPAVFVDKNT  59

Query  224  RVICQGITGKNGTFHTEQAIEYGTKMV-GGVTPKKGGTEHLGLPVFNTVADAKAETKANA  400
            RVICQGITGKNGTFHTEQAIEYGTKMV GGVTPKKGGTEHLGLPVFN+VA+AKAETKANA
Sbjct  60   RVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANA  119

Query  401  SVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMV  514
            SVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV
Sbjct  120  SVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMV  157



>ref|XP_010923343.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Elaeis guineensis]
Length=340

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 139/165 (84%), Gaps = 8/165 (5%)
 Frame = +2

Query  86   MAWQTARLIANVSKKV----RPITQSPLWQQQQHRLFGSPAPE---VFVDKNTRVICQGI  244
            M+ Q A+L+ +++ K+    +    SPL  Q + R FG+  P    VFVDKNTR+ICQGI
Sbjct  1    MSRQAAKLVGSLASKLVSQPKLSASSPLASQSR-RHFGAAPPPAPAVFVDKNTRIICQGI  59

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAE KANASVIYVPPP
Sbjct  60   TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAEAKANASVIYVPPP  119

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            FA AAI+EA+EAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLI
Sbjct  120  FAAAAILEALEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLI  164



>ref|XP_006376608.1| hypothetical protein POPTR_0012s00920g [Populus trichocarpa]
 gb|ERP54405.1| hypothetical protein POPTR_0012s00920g [Populus trichocarpa]
Length=282

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  45   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  104

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMV  514
            ETKANASVIYVPPPFA AAI+EAMEAELDLVVCITEGIPQHDMV
Sbjct  105  ETKANASVIYVPPPFAAAAILEAMEAELDLVVCITEGIPQHDMV  148



>tpg|DAA41209.1| TPA: hypothetical protein ZEAMMB73_389921 [Zea mays]
Length=142

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +2

Query  191  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  370
            P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  33   PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  92

Query  371  DAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMV  514
            +AKAETKANA+VIYVPPPFA AAIMEAMEAELDL VCITEGIPQHDMV
Sbjct  93   EAKAETKANATVIYVPPPFAAAAIMEAMEAELDLAVCITEGIPQHDMV  140



>ref|XP_001693108.1| succinyl-coa ligase alpha chain [Chlamydomonas reinhardtii]
 ref|XP_001693109.1| succinyl-CoA ligase [Chlamydomonas reinhardtii]
 gb|EDP03134.1| succinyl-coa ligase alpha chain [Chlamydomonas reinhardtii]
 gb|EDP03135.1| succinyl-CoA ligase [Chlamydomonas reinhardtii]
Length=329

 Score =   192 bits (487),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 3/131 (2%)
 Frame = +2

Query  176  RLFGSPA---PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLG  346
            R F S A   P VFVDKNT+VICQG+TGKNGTFHTEQAI YGT+MVGGVTPKKGGT HLG
Sbjct  24   RGFASQAAHNPAVFVDKNTKVICQGLTGKNGTFHTEQAIAYGTQMVGGVTPKKGGTSHLG  83

Query  347  LPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKA  526
            LPVFNTVA+AKA T  +A+VIYVPPPFA  AI+EA+EAEL+LVVCITEGIPQHDMV+VK 
Sbjct  84   LPVFNTVAEAKAATGCHATVIYVPPPFAAKAILEAVEAELELVVCITEGIPQHDMVRVKK  143

Query  527  ALKQQTKTRLI  559
            A++ QTKTRLI
Sbjct  144  AMQGQTKTRLI  154



>ref|XP_002507022.1| succinate-coa ligase [Micromonas sp. RCC299]
 gb|ACO68280.1| succinate-coa ligase [Micromonas sp. RCC299]
Length=326

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +2

Query  149  SPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKG  328
            + + + +Q        P VFV+K+T+VICQG TGKNGTFH+EQAI YGT MVGGVTPKKG
Sbjct  15   ASVGRARQMSYAAGEEPAVFVNKHTKVICQGFTGKNGTFHSEQAIAYGTNMVGGVTPKKG  74

Query  329  GTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHD  508
            GT HLGLPVFNTVA+AKAET ANAS IYVPPPFA  AIMEAMEAE+DLVVCITEGIPQHD
Sbjct  75   GTTHLGLPVFNTVAEAKAETGANASAIYVPPPFAAKAIMEAMEAEIDLVVCITEGIPQHD  134

Query  509  MVKVKAALKQQTKTRLI  559
            MV+VK AL +Q+KTRLI
Sbjct  135  MVRVKQALMRQSKTRLI  151



>ref|XP_002957241.1| succinate-coa ligase alpha chain, succinyl-CoA synthetase mitochondrial 
precursor [Volvox carteri f. nagariensis]
 gb|EFJ41739.1| succinate-coa ligase alpha chain, succinyl-CoA synthetase mitochondrial 
precursor [Volvox carteri f. nagariensis]
Length=328

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 3/131 (2%)
 Frame = +2

Query  176  RLFGSPA---PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLG  346
            R F S A   P VFVDKNT+VICQGITGKNGTFHTEQAI YGT+MVGGVTPKKGG+ HLG
Sbjct  23   RGFASQAAYNPAVFVDKNTKVICQGITGKNGTFHTEQAIAYGTQMVGGVTPKKGGSTHLG  82

Query  347  LPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKA  526
            LPVFN+V +AK+ T  +ASVIYVPPPFA  AI+EA+EAELDLVVCITEGIPQHDMVKVK 
Sbjct  83   LPVFNSVKEAKSATGCHASVIYVPPPFAARAILEAVEAELDLVVCITEGIPQHDMVKVKK  142

Query  527  ALKQQTKTRLI  559
             L++Q+KTRLI
Sbjct  143  TLQEQSKTRLI  153



>emb|CAN73796.1| hypothetical protein VITISV_018824 [Vitis vinifera]
Length=468

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 118/142 (83%), Gaps = 5/142 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTF  265
            M  Q  RLI  V  +++    SPL    +H L  +  P VFVDKNTRVICQGITGKNGTF
Sbjct  1    MVGQVRRLIPYVVSRIK----SPLAPPSRH-LGTTAPPAVFVDKNTRVICQGITGKNGTF  55

Query  266  HTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaim  445
            HTEQAIEYGTKMVGGVTPKKGG EHLGLP+FNTVA+AKAET+ANASVIYVPPPFA AAIM
Sbjct  56   HTEQAIEYGTKMVGGVTPKKGGMEHLGLPIFNTVAEAKAETRANASVIYVPPPFAAAAIM  115

Query  446  eameaeLDLVVCITEGIPQHDM  511
            EA+EAELDLVVCITEGIPQHDM
Sbjct  116  EAVEAELDLVVCITEGIPQHDM  137



>gb|KDD74604.1| hypothetical protein H632_c1190p0 [Helicosporidium sp. ATCC 50920]
Length=326

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 114/129 (88%), Gaps = 2/129 (2%)
 Frame = +2

Query  176  RLFGS-PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLP  352
            RL+ S P P VFVDKNTRVICQG TGKNGTFH+EQA+ YGTKMVGGVTPKKGG+ HLGLP
Sbjct  24   RLYSSVPPPAVFVDKNTRVICQGFTGKNGTFHSEQAVAYGTKMVGGVTPKKGGSTHLGLP  83

Query  353  VFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
            VFN+V +AK  T ANA+VIYVPPPFA AAI+EA+EAELDLVVCITEG+PQHDMV+VK AL
Sbjct  84   VFNSVREAKEATNANATVIYVPPPFAAAAILEAVEAELDLVVCITEGVPQHDMVRVKQAL  143

Query  533  KQQTKTRLI  559
              ++KTRLI
Sbjct  144  -ARSKTRLI  151



>emb|CDY44764.1| BnaC02g01230D [Brassica napus]
Length=343

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 130/166 (78%), Gaps = 8/166 (5%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPL-----WQQQQHRLFGS---PAPEVFVDKNTRVICQG  241
            M+ Q ARL+ ++S++    T   +         Q R F S   P   VFVDKNTRV+CQG
Sbjct  1    MSRQVARLLGSLSRRCSSTTSEAIPPTLSSLTTQSRSFASDPPPPAAVFVDKNTRVMCQG  60

Query  242  ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPP  421
            ITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAE KANASVIYVP 
Sbjct  61   ITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAEAKANASVIYVPA  120

Query  422  PFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            PFA AAIME ++AELDL+VCITEGIPQHDMV+VK AL  Q+KTRLI
Sbjct  121  PFAAAAIMEGIQAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLI  166



>ref|XP_003078495.1| putative succinyl-CoA ligase alpha subunit (ISS) [Ostreococcus 
tauri]
 emb|CAL53236.1| Succinyl-CoA synthetase-like [Ostreococcus tauri]
Length=331

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 123/157 (78%), Gaps = 10/157 (6%)
 Frame = +2

Query  89   AWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFH  268
            A ++ R +AN       +T+S + +   +    S AP VFVD NTRVI QG TGKNGTFH
Sbjct  10   ARESQRGVANA------LTRSSIARTADY----STAPAVFVDGNTRVIVQGFTGKNGTFH  59

Query  269  TEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaime  448
            +EQAI YGTK+VGGVTPKKGGT HLGLPVF+TV +A  ETKANASVIYVPPPFA  AIME
Sbjct  60   SEQAIAYGTKVVGGVTPKKGGTTHLGLPVFDTVREAVVETKANASVIYVPPPFAAKAIME  119

Query  449  ameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            A+EAE+DLVVCITEG+PQHDMV+VK AL  Q+KTRLI
Sbjct  120  AVEAEIDLVVCITEGVPQHDMVRVKRALMSQSKTRLI  156



>gb|KHN24503.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Glycine soja]
Length=352

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 119/160 (74%), Gaps = 36/160 (23%)
 Frame = +2

Query  176  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  355
            RLF + +P    DK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPV
Sbjct  21   RLFSAASP----DKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPV  76

Query  356  FNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDM--------  511
            FNTVA+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDM        
Sbjct  77   FNTVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMASRFGILN  136

Query  512  ------------------------VKVKAALKQQTKTRLI  559
                                    V+VKAAL +Q+KTRLI
Sbjct  137  STYFKKAAYGEVYPDRAEITLPFKVRVKAALNRQSKTRLI  176



>gb|KIY97057.1| succinyl-CoA synthetase alpha subunit [Monoraphidium neglectum]
Length=188

 Score =   182 bits (462),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            +  P VFVDK T+VICQGITGKNGTFHTEQAI YGT+MVGGVTPKKGG+ HLGLP+FNTV
Sbjct  27   AAGPAVFVDKTTKVICQGITGKNGTFHTEQAIAYGTQMVGGVTPKKGGSTHLGLPIFNTV  86

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
             +AKA T   ASVIYVPPPFA AAI+EA+ AELDLVV ITEGIPQHDMVKVK  + +Q+K
Sbjct  87   EEAKAATGCTASVIYVPPPFAAAAILEAVRAELDLVVAITEGIPQHDMVKVKKIMSEQSK  146

Query  548  TRLI  559
            TRLI
Sbjct  147  TRLI  150



>ref|XP_003054766.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60018.1| predicted protein [Micromonas pusilla CCMP1545]
Length=312

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P VFVDK+T+V+ QG TGKNGTFH++QAI YGT+MVGGVTPKKGG+ HLGLPVFNTVA+A
Sbjct  17   PAVFVDKDTKVLVQGFTGKNGTFHSQQAIAYGTRMVGGVTPKKGGSTHLGLPVFNTVAEA  76

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRL  556
            K  T ANAS IYVPPPFA  AI+EA+EAELDLVVCITEGIPQHDM++VK A+  Q+KTRL
Sbjct  77   KTATGANASAIYVPPPFAAKAILEAVEAELDLVVCITEGIPQHDMIRVKQAMMTQSKTRL  136

Query  557  I  559
            I
Sbjct  137  I  137



>ref|XP_001416813.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95106.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=344

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  194  APEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAD  373
            +P VFVDKNTRVI QG TGKNGTFH+EQAI YGT++VGGVTP+KGGT HL LPVF+TV +
Sbjct  48   SPAVFVDKNTRVIVQGFTGKNGTFHSEQAIAYGTQVVGGVTPRKGGTTHLNLPVFDTVRE  107

Query  374  AKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTR  553
            AK  TKANASVIYVPPPFA  A+MEA+EAE++LVVCITEGIPQHDMV+VK AL  Q+KTR
Sbjct  108  AKESTKANASVIYVPPPFAARAVMEAIEAEVELVVCITEGIPQHDMVRVKQALMSQSKTR  167

Query  554  LI  559
            LI
Sbjct  168  LI  169



>ref|XP_005643816.1| succinyl-CoA ligase alpha chain [Coccomyxa subellipsoidea C-169]
 gb|EIE19272.1| succinyl-CoA ligase alpha chain [Coccomyxa subellipsoidea C-169]
Length=299

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 104/120 (87%), Gaps = 1/120 (1%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
            EV  DK T+VICQG TGKNGTFH+EQAI YGT+MVGGVTPKKGGT+HLGLPVF+TV +A 
Sbjct  6    EVSEDKTTKVICQGFTGKNGTFHSEQAIAYGTQMVGGVTPKKGGTKHLGLPVFDTVKEAV  65

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            AET A ASVIYVPPPFA  AI+E ++A LDLVVCITEGIPQHDMVKVK  LK ++KTRLI
Sbjct  66   AETGATASVIYVPPPFAAKAILEGVDAGLDLVVCITEGIPQHDMVKVKKVLK-ESKTRLI  124



>ref|XP_007512066.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66154.1| predicted protein [Bathycoccus prasinos]
Length=391

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P+VFV+K+T+V+CQG TGKNGTFH+EQAI+YGTK+VGGVTPKKGGT HL LPVFNTV +A
Sbjct  96   PKVFVNKDTKVVCQGFTGKNGTFHSEQAIKYGTKLVGGVTPKKGGTMHLNLPVFNTVREA  155

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRL  556
            K +T A+A+ IYVPPPFA +AI+EA+EAELDL+VCITEG+PQHDM++VK AL  Q+++RL
Sbjct  156  KEQTGASATSIYVPPPFAASAILEALEAELDLIVCITEGVPQHDMIRVKDALMSQSRSRL  215

Query  557  I  559
            I
Sbjct  216  I  216



>dbj|GAM28077.1| hypothetical protein SAMD00019534_112530 [Acytostelium subglobosum 
LB1]
Length=320

 Score =   173 bits (438),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P V +DKNT+VICQG TGK GTFH++QAIEYGTKMVGGV+P KGG+ HL LPVFNTVADA
Sbjct  27   PYVLIDKNTKVICQGFTGKQGTFHSQQAIEYGTKMVGGVSPGKGGSTHLQLPVFNTVADA  86

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRL  556
            K  T ANASVIYVPPP A AAI+EA+EAE++LVVCITEGIPQ DMV+VK+ L +QTKTRL
Sbjct  87   KKGTGANASVIYVPPPGAAAAIIEAIEAEMELVVCITEGIPQQDMVRVKSILNRQTKTRL  146

Query  557  I  559
            I
Sbjct  147  I  147



>ref|XP_001780609.1| predicted protein [Physcomitrella patens]
 gb|EDQ54592.1| predicted protein [Physcomitrella patens]
Length=299

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDK TR+I QGITGKNGTFHTEQAI YGT++VGGVTP KGGT+HLGLPVFNTVA+AK 
Sbjct  6    VFVDKATRLIVQGITGKNGTFHTEQAIAYGTQVVGGVTPNKGGTQHLGLPVFNTVAEAKQ  65

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
              +ANA+VIYVPP  A  AI+EA++AELDLVVCITEGIPQ DM +VKAAL  Q+KTRLI
Sbjct  66   GVQANATVIYVPPKMACNAILEALDAELDLVVCITEGIPQQDMARVKAALLSQSKTRLI  124



>ref|XP_004920729.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like, partial [Xenopus (Silurana) tropicalis]
Length=182

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 115/160 (72%), Gaps = 9/160 (6%)
 Frame = +2

Query  80   VVMAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNG  259
             + AW    L   +S +   + Q      ++H         +++DK+TRVICQG TGK G
Sbjct  2    CIGAWLRRNLCFCLSVQQNGVRQCSYTASRKH---------LYIDKDTRVICQGFTGKQG  52

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFH++QA+EYGTK+VGGV+P KGG+ HLGLPVFN+VA+AK  T A ASVIYVPPPFA AA
Sbjct  53   TFHSQQALEYGTKLVGGVSPGKGGSAHLGLPVFNSVAEAKEATGATASVIYVPPPFAAAA  112

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            I EA++AE+ LVVCITEGIPQ DMV+VK  L +QT TRLI
Sbjct  113  IHEAIDAEISLVVCITEGIPQQDMVRVKHRLLRQTTTRLI  152



>ref|XP_009524111.1| hypothetical protein PHYSODRAFT_557468 [Phytophthora sojae]
 gb|EGZ21394.1| hypothetical protein PHYSODRAFT_557468 [Phytophthora sojae]
Length=316

 Score =   169 bits (429),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S + +V+++K+T+VICQG TGK GTFH++QAIEYGT MVGGVTPKKGG+ HLGLPVFNTV
Sbjct  19   SASAKVWINKDTKVICQGFTGKQGTFHSQQAIEYGTNMVGGVTPKKGGSTHLGLPVFNTV  78

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
            A+AK ET A+ASVIYVPPPF  A+I+EA+EAE+ LVV ITEGIPQ DMVKVK  L+ Q K
Sbjct  79   AEAKQETGADASVIYVPPPFCAASIIEAIEAEIPLVVAITEGIPQQDMVKVKWHLRNQNK  138

Query  548  TRLI  559
            TRLI
Sbjct  139  TRLI  142



>gb|EDK99001.1| succinate-CoA ligase, GDP-forming, alpha subunit, isoform CRA_b 
[Mus musculus]
Length=149

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    +++DKNT++ICQG TGK GTFH++QA+EYGTK+VGG TP KGG +HLGL
Sbjct  10   RHGSYTASRKHIYIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQKHLGL  69

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  
Sbjct  70   PVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCITEGIPQQDMVRVKHR  129

Query  530  LKQQTKTRLI  559
            L +Q  TRLI
Sbjct  130  LTRQGTTRLI  139



>ref|XP_008905429.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica INRA-310]
 gb|ETI47142.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P1569]
 gb|ETK87077.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETL40492.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETL93622.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETM46890.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETN09596.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica INRA-310]
 gb|ETO75838.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P1976]
 gb|ETP16936.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica CJ01A1]
Length=318

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S + +V+++K+T+VICQG TGK GTFH++QAIEYGT MVGGVTPKKGG+ HLGLPVFNTV
Sbjct  21   SASAKVWINKDTKVICQGFTGKQGTFHSQQAIEYGTNMVGGVTPKKGGSTHLGLPVFNTV  80

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
            A+AK ET A+ASVIYVPPPF  A+I+EA+EAE+ LVV ITEGIPQ DMVKVK  L+ Q+ 
Sbjct  81   AEAKKETGADASVIYVPPPFCAASIIEAIEAEIPLVVAITEGIPQQDMVKVKWHLRNQST  140

Query  548  TRLI  559
            TRLI
Sbjct  141  TRLI  144



>ref|XP_002908607.1| succinyl-CoA ligase subunit alpha, mitochondrial precursor [Phytophthora 
infestans T30-4]
 gb|EEY61690.1| succinyl-CoA ligase subunit alpha, mitochondrial precursor [Phytophthora 
infestans T30-4]
Length=339

 Score =   168 bits (425),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S + +V+++K+T+VICQG TGK GTFH++QAIEYGT MVGGVTPKKGG+ HLGLPVFNTV
Sbjct  42   SASAKVWINKDTKVICQGFTGKQGTFHSQQAIEYGTNMVGGVTPKKGGSTHLGLPVFNTV  101

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
            A+AK ET A+ASVIYVPPPF  A+I+EA+EA++ LVV ITEGIPQ DMVKVK  L+ Q+ 
Sbjct  102  AEAKKETGADASVIYVPPPFCAASIIEAIEAKIPLVVAITEGIPQQDMVKVKWHLRNQST  161

Query  548  TRLI  559
            TRLI
Sbjct  162  TRLI  165



>gb|ACO52022.1| Succinyl-CoA ligase subunit alpha, mitochondrial precursor [Rana 
catesbeiana]
Length=325

 Score =   167 bits (424),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 113/143 (79%), Gaps = 1/143 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ-QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGG  310
            R IT+  L Q   +H  + +    +++DK+T+VICQG TGK GTFH++QA+EYGTK+VGG
Sbjct  5    RLITRLLLQQNGVRHNSYTASRKHLYIDKDTKVICQGFTGKQGTFHSQQALEYGTKLVGG  64

Query  311  VTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITE  490
            V+P KGG  HLGLPVFN+VA+AKA T A ASVIYVPPPFA AAI E+++AE+ LVVCITE
Sbjct  65   VSPGKGGKTHLGLPVFNSVAEAKAGTGATASVIYVPPPFAAAAIHESIDAEMPLVVCITE  124

Query  491  GIPQHDMVKVKAALKQQTKTRLI  559
            GIPQ DMV+VK  L +QT TRLI
Sbjct  125  GIPQQDMVRVKHRLLRQTTTRLI  147



>ref|XP_004351803.1| succinate-CoA ligase [Dictyostelium fasciculatum]
 gb|EGG15083.1| succinate-CoA ligase [Dictyostelium fasciculatum]
Length=320

 Score =   167 bits (424),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = +2

Query  125  KKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV  304
            KK + + +S + +Q   R + S  P V V+K+T+VICQG TGK GTFH++QAI+YGT+MV
Sbjct  2    KKRKMLARSSILRQAFVRGYAS-KPFVMVNKDTKVICQGFTGKQGTFHSQQAIDYGTQMV  60

Query  305  GGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCI  484
            GGV+P KGG++HL LPVFN+V +AK  T ANASVIYVPPP+A  AI+EA+EAE++LVVCI
Sbjct  61   GGVSPGKGGSKHLDLPVFNSVKEAKKATDANASVIYVPPPYAAQAIIEAIEAEMELVVCI  120

Query  485  TEGIPQHDMVKVKAALKQQTKTRLI  559
            TEGIPQ DMV+VK  L +Q KTRLI
Sbjct  121  TEGIPQQDMVRVKYLLNRQNKTRLI  145



>ref|XP_004415607.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Odobenus rosmarus divergens]
Length=333

 Score =   167 bits (423),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L QQ   +H  + +    ++VDKNT+VICQG TGK GTFH++QA++YGT++VG
Sbjct  12   RLLSRSFLLQQNGIRHCSYIASRKHLYVDKNTKVICQGFTGKQGTFHSQQALDYGTQLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK ET A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  72   GTTPGKGGQTHLGLPVFNTVKEAKEETGATASVIYVPPPFAAAAINEAVEAEVPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  132  EGIPQQDMVRVKHKLLRQGKTRLI  155



>gb|ETP44985.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P10297]
Length=318

 Score =   167 bits (422),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S + +V+++K+T+VICQG TGK GTFH++QAIEYGT MVGGVTPKKGG+ HLGLPVFNTV
Sbjct  21   SASAKVWINKDTKVICQGFTGKQGTFHSQQAIEYGTNMVGGVTPKKGGSTHLGLPVFNTV  80

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
            A+AK +T A+ASVIYVPPPF  A+I+EA+EAE+ LVV ITEGIPQ DMVKVK  L+ Q+ 
Sbjct  81   AEAKKDTGADASVIYVPPPFCAASIIEAIEAEIPLVVAITEGIPQQDMVKVKWHLRNQST  140

Query  548  TRLI  559
            TRLI
Sbjct  141  TRLI  144



>ref|NP_001025589.1| succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial 
[Xenopus (Silurana) tropicalis]
 gb|AAH91038.1| succinate-CoA ligase, alpha subunit [Xenopus (Silurana) tropicalis]
Length=325

 Score =   167 bits (423),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             +++DK+TRVICQG TGK GTFH++QA+EYGTK+VGGV+P KGG+ HLGLPVFN+VA+AK
Sbjct  28   HLYIDKDTRVICQGFTGKQGTFHSQQALEYGTKLVGGVSPGKGGSAHLGLPVFNSVAEAK  87

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
              T A ASVIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  L +QT TRLI
Sbjct  88   EATGATASVIYVPPPFAAAAIHEAIDAEISLVVCITEGIPQQDMVRVKHRLLRQTTTRLI  147



>ref|XP_009182789.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Papio anubis]
 gb|EHH22270.1| hypothetical protein EGK_05503 [Macaca mulatta]
 gb|EHH55709.1| hypothetical protein EGM_04965 [Macaca fascicularis]
Length=346

 Score =   167 bits (424),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLAQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  145  EGIPQQDMVRVKHKLLRQGKTRLI  168



>dbj|BAB22331.1| unnamed protein product [Mus musculus]
Length=333

 Score =   167 bits (423),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    +++DKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12   RLLSRTFLLQQNGIRHGSYTASRKHIYIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG +HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  72   GTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q  TRLI
Sbjct  132  EGIPQQDMVRVKHRLTRQGTTRLI  155



>dbj|BAB23804.1| unnamed protein product [Mus musculus]
 gb|AAH11087.1| Succinate-CoA ligase, GDP-forming, alpha subunit [Mus musculus]
 gb|EDK99000.1| succinate-CoA ligase, GDP-forming, alpha subunit, isoform CRA_a 
[Mus musculus]
Length=333

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    +++DKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12   RLLSRTFLLQQNGIRHGSYTASRKHIYIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG +HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  72   GTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q  TRLI
Sbjct  132  EGIPQQDMVRVKHRLTRQGTTRLI  155



>gb|AAD33927.2|AF144101_1 succinyl-CoA synthetase [Mus musculus]
Length=333

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    +++DKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12   RLLSRTFLLQQNGIRHGSYTASRKHIYIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG +HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  72   GTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q  TRLI
Sbjct  132  EGIPQQDMVRVKHRLTRQGTTRLI  155



>ref|NP_001270301.1| uncharacterized protein LOC101867049 [Macaca fascicularis]
 dbj|BAE87929.1| unnamed protein product [Macaca fascicularis]
Length=346

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLAQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  145  EGIPQQDMVRVKHKLLRQGKTRLI  168



>dbj|BAC40634.1| unnamed protein product [Mus musculus]
Length=333

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    +++DKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12   RLLSRTFLLQQNGIRHGSYTASRKHIYIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG +HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  72   GTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q  TRLI
Sbjct  132  EGIPQQDMVRVKHRLTRQGTTRLI  155



>gb|EGV93208.1| Succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Cricetulus griseus]
Length=333

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L Q    +H  + +    +++DKNT+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12   RLLSRTFLLQHNGIRHASYDASRKHIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G +P KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  72   GTSPGKGGKTHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAITEAVDAEIPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+V+  L  Q KTRLI
Sbjct  132  EGIPQQDMVRVRHTLSHQGKTRLI  155



>gb|KDO21510.1| succinyl-CoA ligase subunit alpha [Saprolegnia parasitica CBS 
223.65]
Length=312

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S + +V+++K+T+VICQG TGK GTFH+EQAI YGT MVGGVTPKKGGT HLGLPVFNTV
Sbjct  13   SASAKVWINKDTKVICQGFTGKQGTFHSEQAIAYGTNMVGGVTPKKGGTTHLGLPVFNTV  72

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
            A+AK ET+A+ASVIYVPPPF  AAI++A+EAE+ L+V ITEGIPQ DMVKVK AL QQ  
Sbjct  73   AEAKKETQADASVIYVPPPFCAAAIIDAIEAEIPLIVAITEGIPQQDMVKVKWALAQQNI  132

Query  548  TRLI  559
            +RLI
Sbjct  133  SRLI  136



>ref|XP_003282290.2| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like [Nomascus leucogenys]
Length=206

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLPQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  145  EGIPQQDMVRVKHKLLRQGKTRLI  168



>ref|NP_063932.2| succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial 
precursor [Mus musculus]
 sp|Q9WUM5.4|SUCA_MOUSE RecName: Full=Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha; Short=SCS-alpha; Flags: Precursor [Mus musculus]
Length=346

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    +++DKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRTFLLQQNGIRHGSYTASRKHIYIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG +HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  85   GTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q  TRLI
Sbjct  145  EGIPQQDMVRVKHRLTRQGTTRLI  168



>ref|XP_007625515.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Cricetulus griseus]
Length=346

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L Q    +H  + +    +++DKNT+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRTFLLQHNGIRHASYDASRKHIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G +P KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  85   GTSPGKGGKTHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAITEAVDAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+V+  L  Q KTRLI
Sbjct  145  EGIPQQDMVRVRHTLSHQGKTRLI  168



>ref|XP_003505683.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Cricetulus griseus]
Length=346

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L Q    +H  + +    +++DKNT+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRTFLLQHNGIRHASYDASRKHIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G +P KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  85   GTSPGKGGKTHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAITEAVDAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+V+  L  Q KTRLI
Sbjct  145  EGIPQQDMVRVRHTLSHQGKTRLI  168



>dbj|BAH12424.1| unnamed protein product [Homo sapiens]
Length=248

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  145  EGIPQQDMVRVKHKLLRQEKTRLI  168



>ref|WP_035251770.1| succinate--CoA ligase [Actibacterium atlanticum]
 gb|KCV81620.1| succinyl-CoA synthetase subunit alpha [Actibacterium atlanticum]
Length=295

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            + VD+NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG EHLGLPVFN+V +AKA
Sbjct  3    ILVDENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGAEHLGLPVFNSVHEAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            +T+ANASVIYVPPPFAG +I+EA++AE++L++CITEGIP  DM+KVK AL + +K+RLI
Sbjct  63   KTEANASVIYVPPPFAGDSILEAIDAEMELIICITEGIPVLDMMKVKRAL-EDSKSRLI  120



>ref|XP_005837665.1| hypothetical protein GUITHDRAFT_157241 [Guillardia theta CCMP2712]
 gb|EKX50685.1| hypothetical protein GUITHDRAFT_157241 [Guillardia theta CCMP2712]
Length=297

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P  FV+K+TRVICQG TG  GTFH+EQ+I YGTKMVGGVTPKKGGT HLGLPVFNTV +A
Sbjct  5    PPPFVNKDTRVICQGFTGSQGTFHSEQSIAYGTKMVGGVTPKKGGTTHLGLPVFNTVREA  64

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRL  556
            K   K +ASVIYVPPPFA  A ++A+EAE+ LVV ITEGIPQ DMV+VK AL   TKTR+
Sbjct  65   KEAVKPDASVIYVPPPFAMRAALDAIEAEIPLVVVITEGIPQQDMVRVKHALNMSTKTRM  124

Query  557  I  559
            I
Sbjct  125  I  125



>ref|WP_038463120.1| succinate--CoA ligase [Candidatus Paracaedibacter acanthamoebae]
 gb|AIK95740.1| succinate--CoA ligase [Candidatus Paracaedibacter acanthamoebae]
Length=306

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             + VDKNT+VICQG TGKNGTFH+EQAI YGTKMVGGVTP KGGTEHLGLPVFNTV DA 
Sbjct  2    SILVDKNTKVICQGFTGKNGTFHSEQAIAYGTKMVGGVTPGKGGTEHLGLPVFNTVGDAV  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             +T A ASVIYVP P+A  +I+EA +A ++L+VCITEGIP  DMV+VK AL + TK+RLI
Sbjct  62   KKTGATASVIYVPAPYAADSILEAADAGIELIVCITEGIPVMDMVQVKRAL-EGTKSRLI  120



>gb|KFP25909.1| hypothetical protein N325_08777, partial [Colius striatus]
Length=168

 Score =   160 bits (406),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = +2

Query  152  PLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKK  325
            PL QQ   +H  + +    ++++KNT+VICQG TGK GTFH++QA++YGT +VGG++P K
Sbjct  2    PLVQQNGVRHCTYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISPGK  61

Query  326  GGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQH  505
            GG  HLGLPVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEGIPQ 
Sbjct  62   GGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIPQQ  121

Query  506  DMVKVKAALKQQTKTRLI  559
            DMV+VK  L +Q KTRL+
Sbjct  122  DMVRVKHRLLRQGKTRLV  139



>ref|XP_005843440.1| hypothetical protein CHLNCDRAFT_141133 [Chlorella variabilis]
 gb|EFN51338.1| hypothetical protein CHLNCDRAFT_141133 [Chlorella variabilis]
Length=330

 Score =   165 bits (418),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P VFVDK+T+VI QG TGKNGTFH+EQAI+YGT++VGGV PKKGGT HLGLPVF +V +A
Sbjct  35   PAVFVDKDTKVIVQGFTGKNGTFHSEQAIQYGTQVVGGVNPKKGGTTHLGLPVFASVREA  94

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRL  556
            K  T  +A+ IYVPPP A  AI+EA+EAELDLVVCITE IPQHDMV+VK  L +Q+KTRL
Sbjct  95   KEATGCHATAIYVPPPGAAKAILEAVEAELDLVVCITEAIPQHDMVRVKKVLSEQSKTRL  154

Query  557  I  559
            I
Sbjct  155  I  155



>ref|XP_007536491.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like [Erinaceus europaeus]
Length=304

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R + +S L QQ   +H  + +    ++VDKNT+VICQG TGK GTFH++QA++YGT++VG
Sbjct  12   RLLPRSYLLQQNGIRHCSYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALDYGTQLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG +HLGLPVFN+V +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  72   GTTPGKGGQKHLGLPVFNSVKEAKEKTGATASVIYVPPPFAAAAIDEAIEAEMSLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  132  EGIPQQDMVRVKHKLVRQGKTRLI  155



>ref|XP_003294260.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium purpureum]
 gb|EGC29214.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium purpureum]
Length=312

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  182  FGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN  361
            F S  P V +DKNT+VICQG TG  GTFH++QAIEYGT+MVGGV+P KGG +HL LPVFN
Sbjct  12   FFSTKPHVLIDKNTKVICQGFTGNQGTFHSKQAIEYGTQMVGGVSPGKGGQKHLELPVFN  71

Query  362  TVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQ  541
            TV +AK +T ANA+VIYVPPPFA AAI EA++A+++L+VCITEGIPQ DMVKVK  L ++
Sbjct  72   TVQEAKQQTGANATVIYVPPPFAAAAIKEAIDADMELIVCITEGIPQQDMVKVKKYLNEK  131

Query  542  TKTRLI  559
              TRLI
Sbjct  132  PTTRLI  137



>ref|XP_010201069.1| PREDICTED: LOW QUALITY PROTEIN: succinyl-CoA ligase [ADP/GDP-forming] 
subunit alpha, mitochondrial-like, partial [Colius 
striatus]
Length=175

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 112/142 (79%), Gaps = 2/142 (1%)
 Frame = +2

Query  140  ITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGV  313
            I+ S L QQ   +H  + +    ++++KNT+VICQG TGK GTFH++QA++YGT +VGG+
Sbjct  6    ISFSXLVQQNGVRHCTYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGI  65

Query  314  TPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEG  493
            +P KGG  HLGLPVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEG
Sbjct  66   SPGKGGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEG  125

Query  494  IPQHDMVKVKAALKQQTKTRLI  559
            IPQ DMV+VK  L +Q KTRL+
Sbjct  126  IPQQDMVRVKHRLLRQGKTRLV  147



>ref|WP_009540580.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Caenispirillum 
salinarum]
 gb|EKV30513.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Caenispirillum 
salinarum AK4]
Length=291

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 100/119 (84%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V +D NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVADAK 
Sbjct  3    VLIDSNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFDTVADAKE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             T ANA+VIYVPPPFA  AI+EA++AE+DL VCITEGIP  DMVKVK AL + +KTRL+
Sbjct  63   ATGANATVIYVPPPFAADAILEAIDAEMDLAVCITEGIPVLDMVKVKRAL-ENSKTRLV  120



>ref|XP_004742358.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X2 [Mustela putorius furo]
 ref|XP_004805738.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Mustela putorius furo]
Length=346

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L QQ   +H  + +    +++DKNT+VICQG TGK GTFH++QA++YGT++VG
Sbjct  25   RLLSRSFLLQQNGIRHCSYVASRKHLYIDKNTKVICQGFTGKQGTFHSQQALDYGTQLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAISEAVEAEVPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  145  EGIPQQDMVRVKHKLLRQGKTRLI  168



>gb|ERE66319.1| succinyl-CoA ligase [GDP-forming] subunit alpha [Cricetulus griseus]
Length=341

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    +++DKNT+VICQG TGK GTFH++QA+EYGTK+VGG +P KGG  HLGL
Sbjct  34   RHASYDASRKHIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVGGTSPGKGGKTHLGL  93

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+V+  
Sbjct  94   PVFNTVKEAKEKTGATASVIYVPPPFAAAAITEAVDAEIPLVVCITEGIPQQDMVRVRHT  153

Query  530  LKQQTKTRLI  559
            L  Q KTRLI
Sbjct  154  LSHQGKTRLI  163



>ref|XP_010077723.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like, partial [Pterocles gutturalis]
Length=230

 Score =   162 bits (410),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 118/162 (73%), Gaps = 2/162 (1%)
 Frame = +2

Query  80   VVMAWQTARLIANVSKKVRPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGK  253
            ++    T R  + +    R ++++ L QQ   +H  + +    +++ KNT+VICQG TGK
Sbjct  8    LIFEKHTYRNFSKLRIDKRKLSKTFLLQQNGVRHCSYSASRKNLYISKNTKVICQGFTGK  67

Query  254  NGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFag  433
             GTFH++QA++YGT +VGG +P KGG  HLGLPVFN+V +AK +T A+A+VIYVPPPFA 
Sbjct  68   QGTFHSQQALDYGTSLVGGTSPGKGGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAA  127

Query  434  aaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            AAI EA++AE+ LVVCITEGIPQ DMV+VK  L +Q KTRL+
Sbjct  128  AAINEAIDAEMPLVVCITEGIPQQDMVRVKHRLLRQDKTRLV  169



>ref|XP_011227722.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Ailuropoda melanoleuca]
Length=414

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L QQ   +H  + +    ++VDKNT+VICQG TGK GTFH++QA++YGT++VG
Sbjct  93   RLLSRSFLLQQNGIRHCSYIASRKHLYVDKNTKVICQGFTGKQGTFHSQQALDYGTQLVG  152

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK ET A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  153  GTTPGKGGQTHLGLPVFNTVKEAKEETGATASVIYVPPPFAAAAINEAVEAEVPLVVCIT  212

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  213  EGIPQQDMVRVKHKLLRQGKTRLI  236



>ref|XP_010366218.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial, partial [Rhinopithecus roxellana]
Length=332

 Score =   165 bits (417),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VGG TP KGG  HLGL
Sbjct  25   RHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGL  84

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCITEGIPQ DMV+VK  
Sbjct  85   PVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVEAEIPLVVCITEGIPQQDMVRVKHK  144

Query  530  LKQQTKTRLI  559
            L +Q KTRLI
Sbjct  145  LLRQGKTRLI  154



>ref|WP_043744920.1| succinate--CoA ligase [Oceanicola sp. 22II-S11g]
 gb|KGM50534.1| succinate--CoA ligase [Oceanicola sp. 22II-S11g]
Length=293

 Score =   164 bits (414),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VD+NT+VICQG+TG  GTFHTEQAI YGTKMVGGVTP KGGT HL LPVFN+V +AK 
Sbjct  3    VLVDENTKVICQGLTGSQGTFHTEQAIAYGTKMVGGVTPGKGGTTHLDLPVFNSVHEAKH  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             T+ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVKAALK  +K+RLI
Sbjct  63   VTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKAALK-NSKSRLI  120



>emb|CCA20859.1| unnamed protein product [Albugo laibachii Nc14]
Length=325

 Score =   164 bits (416),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 113/145 (78%), Gaps = 3/145 (2%)
 Frame = +2

Query  125  KKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV  304
            K VRP   +   + +  R   S A +V+++++TRVICQG TGK GTFH+EQAI YGTKMV
Sbjct  5    KDVRPFVCA--LETRAGRSMSSSA-KVWINEDTRVICQGFTGKQGTFHSEQAIAYGTKMV  61

Query  305  GGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCI  484
            GGVTPKKGG+ HLGLPVFN+V++AK  T A+ASVIYVPPPF   AI++A+EAE+ LVV I
Sbjct  62   GGVTPKKGGSTHLGLPVFNSVSEAKRATNADASVIYVPPPFCAQAIIDAIEAEIPLVVAI  121

Query  485  TEGIPQHDMVKVKAALKQQTKTRLI  559
            TEGIPQ DMVKVK  L+QQ  TRLI
Sbjct  122  TEGIPQQDMVKVKWHLRQQKVTRLI  146



>emb|CCI47060.1| unnamed protein product [Albugo candida]
Length=301

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S + +V+++K T+VICQG TGK GTFH+EQAI YGTKMVGGVTPKKGG+ HLGLPVFNTV
Sbjct  2    STSAKVWINKETKVICQGFTGKQGTFHSEQAISYGTKMVGGVTPKKGGSTHLGLPVFNTV  61

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
            ++AK  T A+ASVIYVPPPF   AI++A+EAE+ L+V ITEGIPQ DMV+VK  L+QQ  
Sbjct  62   SEAKRATNADASVIYVPPPFCAQAIIDAIEAEIPLIVAITEGIPQQDMVRVKWHLRQQKV  121

Query  548  TRLI  559
            TRLI
Sbjct  122  TRLI  125



>ref|XP_003420463.2| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Loxodonta africana]
Length=333

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +T+  L QQ   +H  + S    +++DK+T+VICQG TGK GTFH+++A+EYGTK+VG
Sbjct  12   RLLTRYFLVQQNGIRHSSYVSSRKHLYIDKDTKVICQGFTGKQGTFHSQKALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HL LPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  72   GTTPGKGGQMHLDLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEALEAEIALVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK AL +Q KTRLI
Sbjct  132  EGIPQQDMVRVKHALLRQGKTRLI  155



>ref|XP_002289446.1| precursor of synthetase [Thalassiosira pseudonana CCMP1335]
 gb|EED92983.1| precursor of synthetase [Thalassiosira pseudonana CCMP1335]
Length=299

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
            +V++DK+TRVICQG TGK GTFH+ QAIEYGT MVGGVTPKKGG EHLGLPVF++VADA 
Sbjct  6    KVWIDKDTRVICQGFTGKQGTFHSTQAIEYGTNMVGGVTPKKGGQEHLGLPVFDSVADAV  65

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             E K +ASVIYVPPP+  AAI++A+E E+ LVV ITEG+PQ DMV+VK AL  Q KTRLI
Sbjct  66   LEVKPDASVIYVPPPYCAAAILDAIENEIPLVVAITEGVPQQDMVRVKKALLSQDKTRLI  125



>ref|WP_026988416.1| succinate--CoA ligase [Fodinicurvata fenggangensis]
Length=292

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             V VDKNTRVICQG TG  GTFH+EQAI YGT+MVGGVTP KGG++HL LPVFNTV+DA 
Sbjct  2    SVLVDKNTRVICQGFTGAQGTFHSEQAIAYGTQMVGGVTPGKGGSKHLDLPVFNTVSDAV  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            +ET ANASVIYVPPPFA  AI+EA++  ++LVVCITEGIP  DMVKVK AL   + TRLI
Sbjct  62   SETGANASVIYVPPPFAADAILEAIDGGIELVVCITEGIPVLDMVKVKRAL-ADSNTRLI  120



>ref|XP_008608930.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Saprolegnia diclina VS20]
 gb|EQC37410.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Saprolegnia diclina VS20]
Length=312

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S + +V+++K+T+VICQG TGK GTFH+EQAI YGT MVGGVTPKKGGT HLGLPVFNTV
Sbjct  13   SASAKVWINKDTKVICQGFTGKQGTFHSEQAIAYGTNMVGGVTPKKGGTTHLGLPVFNTV  72

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
            A+AK  T+A+ASVIYVPPPF  AAI++A+EAE+ L+V ITEGIPQ DMVKVK AL QQ  
Sbjct  73   AEAKTATQADASVIYVPPPFCAAAIIDAIEAEIPLIVAITEGIPQQDMVKVKWALAQQNI  132

Query  548  TRLI  559
            +RLI
Sbjct  133  SRLI  136



>ref|XP_004660591.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Jaculus jaculus]
Length=348

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    ++VDKNT+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  27   RLLSRTFLLQQNGIRHSSYVASRKNLYVDKNTKVICQGFTGKQGTFHSQQALEYGTKLVG  86

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVF++V +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  87   GTTPGKGGMTHLGLPVFDSVKEAKEKTGATASVIYVPPPFAAAAITEAIDAEIPLVVCIT  146

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+V+  L  Q KTRL+
Sbjct  147  EGIPQQDMVRVRHKLSHQGKTRLV  170



>ref|XP_007968242.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Chlorocebus sabaeus]
Length=415

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  94   RLLSRSFLLAQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  153

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  154  GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVEAEIPLVVCIT  213

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  214  EGIPQQDMVRVKHKLLRQGKTRLI  237



>ref|XP_001082705.2| PREDICTED: succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Macaca mulatta]
Length=382

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VGG TP KGG  HLGL
Sbjct  50   RHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGL  109

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCITEGIPQ DMV+VK  
Sbjct  110  PVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVEAEIPLVVCITEGIPQQDMVRVKHK  169

Query  530  LKQQTKTRLI  559
            L +Q KTRLI
Sbjct  170  LLRQGKTRLI  179



>ref|WP_010137369.1| succinyl-CoA synthetase subsunit alpha [Oceanicola sp. S124]
Length=294

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 101/119 (85%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VD+NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGTEHLGLPVF+ VA+A  
Sbjct  3    VLVDENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTEHLGLPVFDGVAEAVE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             T ANASVIYVPPPFA  +I+EA++AE+ L+VCITEGIP  DM+KVKAALK  +K+RLI
Sbjct  63   RTGANASVIYVPPPFAADSILEAIDAEIPLIVCITEGIPVLDMMKVKAALK-NSKSRLI  120



>ref|WP_028287755.1| succinate--CoA ligase [Oceanicola nanhaiensis]
Length=293

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 102/119 (86%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VD+NTRVICQG+TG  GTFHTEQAI YGTKMVGGVTP KGGT HL LPV+N+V +A  
Sbjct  3    VLVDENTRVICQGLTGSQGTFHTEQAIAYGTKMVGGVTPGKGGTTHLDLPVYNSVHEAMH  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ET+ANASVIYVPPPFA  +I+EA++AE+ L++CITEGIP  DM+KVKAAL Q +K+RLI
Sbjct  63   ETQANASVIYVPPPFAADSILEAIDAEMPLIICITEGIPVLDMMKVKAAL-QTSKSRLI  120



>ref|XP_004469843.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform 1 [Dasypus novemcinctus]
Length=344

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 117/162 (72%), Gaps = 7/162 (4%)
 Frame = +2

Query  80   VVMAWQTARLIANVSKKVRPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGK  253
            V MA   + L A      R + +S L +Q   +H  + S    +++DKNT+V+CQG TGK
Sbjct  10   VTMASGCSGLSA-----ARLLARSFLLRQNGIRHCSYTSSRKYIYIDKNTKVVCQGFTGK  64

Query  254  NGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFag  433
             GTFH++QA+ YGT +VGG +P KGG  HLGLPVFNT+ +AK +T A ASVIYVPPPFA 
Sbjct  65   QGTFHSQQALAYGTNLVGGTSPGKGGKTHLGLPVFNTLKEAKEQTGATASVIYVPPPFAA  124

Query  434  aaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            AAI EA+E E+ LVVCITEGIPQ DMV+VK +L +Q+KTRLI
Sbjct  125  AAINEAVEVEMPLVVCITEGIPQQDMVRVKHSLLRQSKTRLI  166



>emb|CCI47059.1| unnamed protein product [Albugo candida]
Length=322

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 113/145 (78%), Gaps = 3/145 (2%)
 Frame = +2

Query  125  KKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV  304
            K VRP+  +   + +  R   + A +V+++K T+VICQG TGK GTFH+EQAI YGTKMV
Sbjct  5    KDVRPLVCA--LEARAGRSMSTSA-KVWINKETKVICQGFTGKQGTFHSEQAISYGTKMV  61

Query  305  GGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCI  484
            GGVTPKKGG+ HLGLPVFNTV++AK  T A+ASVIYVPPPF   AI++A+EAE+ L+V I
Sbjct  62   GGVTPKKGGSTHLGLPVFNTVSEAKRATNADASVIYVPPPFCAQAIIDAIEAEIPLIVAI  121

Query  485  TEGIPQHDMVKVKAALKQQTKTRLI  559
            TEGIPQ DMV+VK  L+QQ  TRLI
Sbjct  122  TEGIPQQDMVRVKWHLRQQKVTRLI  146



>ref|XP_006376690.1| hypothetical protein POPTR_0012s033102g, partial [Populus trichocarpa]
 gb|ERP54487.1| hypothetical protein POPTR_0012s033102g, partial [Populus trichocarpa]
Length=137

 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/75 (99%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  48   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  107

Query  383  ETKANASVIYVPPPF  427
            ETKANASVIYVPPPF
Sbjct  108  ETKANASVIYVPPPF  122



>ref|XP_004742357.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X1 [Mustela putorius furo]
Length=352

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L QQ   +H  + +    +++DKNT+VICQG TGK GTFH++QA++YGT++VG
Sbjct  25   RLLSRSFLLQQNGIRHCSYVASRKHLYIDKNTKVICQGFTGKQGTFHSQQALDYGTQLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAISEAVEAEVPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  145  EGIPQQDMVRVKHKLLRQGKTRLI  168



>ref|WP_022728556.1| succinyl-CoA synthetase subsunit alpha [Fodinicurvata sediminis]
Length=292

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             V VDKNTRVICQG TG  GTFH+EQAI YGT+MVGGVTP KGG++HL LPVFNTV+DA 
Sbjct  2    SVLVDKNTRVICQGFTGAQGTFHSEQAIAYGTQMVGGVTPGKGGSKHLDLPVFNTVSDAV  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            +ET ANASVIYVPPPFA  AI+EA++  ++LVVCITEGIP  DMVKVK AL   + TRL+
Sbjct  62   SETGANASVIYVPPPFAAEAILEAIDGGIELVVCITEGIPVLDMVKVKRAL-ADSNTRLV  120



>ref|XP_007470656.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Lipotes vexillifer]
Length=346

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    ++VDK+T+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRAFLLQQNGIRHCSYTASRKHLYVDKDTKVICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVF+TV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGETHLGLPVFSTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEVSLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  145  EGIPQQDMVRVKHKLLRQEKTRLI  168



>gb|AAH00504.1| SUCLG1 protein [Homo sapiens]
 emb|CAG33420.1| SUCLG1 [Homo sapiens]
 gb|AAY24107.1| unknown [Homo sapiens]
 gb|AIC59436.1| SUCLG1, partial [synthetic construct]
Length=333

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12   RLLSRSFLLPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  72   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  132  EGIPQQDMVRVKHKLLRQEKTRLI  155



>dbj|BAF83771.1| unnamed protein product [Homo sapiens]
Length=333

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12   RLLSRSFLLPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  72   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  132  EGIPQQDMVRVKHKLLRQEKTRLI  155



>ref|XP_003816644.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Pan paniscus]
 ref|XP_004029567.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Gorilla gorilla gorilla]
Length=346

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLPQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  145  EGIPQQDMVRVKHKLLRQEKTRLI  168



>ref|XP_001164971.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X1 [Pan troglodytes]
Length=346

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLPQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  145  EGIPQQDMVRVKHKLLRQEKTRLI  168



>ref|XP_007666525.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Ornithorhynchus anatinus]
Length=327

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 109/138 (79%), Gaps = 3/138 (2%)
 Frame = +2

Query  155  LWQQQ---QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKK  325
            LW QQ   +H  + +    ++V+K T+VICQG TGK GTFH++QA++YGT +VGG +P K
Sbjct  12   LWMQQNGIRHCSYTASRNNLYVNKTTKVICQGFTGKQGTFHSQQALDYGTNLVGGTSPGK  71

Query  326  GGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQH  505
            GG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCITEGIPQ 
Sbjct  72   GGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVEAEMPLVVCITEGIPQQ  131

Query  506  DMVKVKAALKQQTKTRLI  559
            DMV+VK +L +Q+KTRL+
Sbjct  132  DMVRVKHSLTRQSKTRLV  149



>ref|XP_002757610.3| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X2 [Callithrix jacchus]
Length=346

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLPQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L  Q KTRLI
Sbjct  145  EGIPQQDMVRVKHKLLHQGKTRLI  168



>dbj|BAG36098.1| unnamed protein product [Homo sapiens]
Length=333

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12   RLLSRSFLLPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  72   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  132  EGIPQQDMVRVKHKLLRQEKTRLI  155



>ref|XP_007118275.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Physeter catodon]
Length=346

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    ++VDK+T+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRAFLLQQNGIRHCSYTASRKHLYVDKDTKVICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVF+TV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGETHLGLPVFSTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEVSLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  145  EGIPQQDMVRVKHRLLRQEKTRLI  168



>ref|NP_003840.2| succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial 
precursor [Homo sapiens]
 sp|P53597.4|SUCA_HUMAN RecName: Full=Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha; Short=SCS-alpha; Flags: Precursor [Homo sapiens]
 gb|EAW99558.1| succinate-CoA ligase, GDP-forming, alpha subunit [Homo sapiens]
Length=346

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  145  EGIPQQDMVRVKHKLLRQEKTRLI  168



>ref|NP_001126825.1| succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial 
[Pongo abelii]
 emb|CAH93082.1| hypothetical protein [Pongo abelii]
Length=346

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLPQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  145  EGIPQQDMVRVKHKLLRQGKTRLI  168



>gb|KFP67749.1| hypothetical protein N322_02167, partial [Cariama cristata]
Length=167

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++++KNT+VICQG TGK GTFH++QA++YGT +VGG++P KGG  HLGL
Sbjct  10   RHCSYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISPGKGGKTHLGL  69

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  
Sbjct  70   PVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIPQQDMVRVKHR  129

Query  530  LKQQTKTRLI  559
            L +Q KTRL+
Sbjct  130  LLRQDKTRLV  139



>ref|XP_008698280.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X1 [Ursus maritimus]
Length=346

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++ S L QQ   +H  + +    ++VDKNT+VICQG TGK GTFH++QA++YGT++VG
Sbjct  25   RLLSPSFLLQQNGIRHCSYIASRKHLYVDKNTKVICQGFTGKQGTFHSQQALDYGTQLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK ET A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEETGATASVIYVPPPFAAAAINEAVEAEVPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q  TRLI
Sbjct  145  EGIPQQDMVRVKHKLLRQGTTRLI  168



>gb|EFB17847.1| hypothetical protein PANDA_011931 [Ailuropoda melanoleuca]
Length=308

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             ++VDKNT+VICQG TGK GTFH++QA++YGT++VGG TP KGG  HLGLPVFNTV +AK
Sbjct  19   HLYVDKNTKVICQGFTGKQGTFHSQQALDYGTQLVGGTTPGKGGQTHLGLPVFNTVKEAK  78

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             ET A ASVIYVPPPFA AAI EA+EAE+ LVVCITEGIPQ DMV+VK  L +Q KTRLI
Sbjct  79   EETGATASVIYVPPPFAAAAINEAVEAEVPLVVCITEGIPQQDMVRVKHKLLRQGKTRLI  138



>ref|XP_008167941.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X4 [Chrysemys picta bellii]
Length=314

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++++KNT+VICQG TGK GTFH++QA+EYGTK+VGG++P KGG  HLGL
Sbjct  7    RHCSYSATRKNLYINKNTKVICQGFTGKQGTFHSQQALEYGTKLVGGISPGKGGKTHLGL  66

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  
Sbjct  67   PVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVDAEIPLVVCITEGIPQQDMVRVKHK  126

Query  530  LKQQTKTRLI  559
            L +Q KTRL+
Sbjct  127  LIRQDKTRLV  136



>gb|AAA85724.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium discoideum 
AX2]
Length=310

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +2

Query  176  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  355
            + F S  P V ++KNT+VICQG TG  GTFH++QAIEYGT MVGGV+P KGG +HL LP 
Sbjct  13   KRFFSTKPSVLINKNTKVICQGFTGNQGTFHSKQAIEYGTNMVGGVSPGKGGQKHLDLPA  72

Query  356  FNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
            FNTV +AK  T ANA+VIYVPPP A AAI EA++AE++LVVCITEGIPQ DMVKVK  L 
Sbjct  73   FNTVKEAKEATGANATVIYVPPPHAAAAIKEAIDAEMELVVCITEGIPQQDMVKVKYLLN  132

Query  536  QQTKTRLI  559
            +Q KTRLI
Sbjct  133  KQNKTRLI  140



>ref|WP_022731741.1| succinyl-CoA synthetase subsunit alpha [Thalassospira lucentensis]
Length=291

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 101/119 (85%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVFNTVA+AK 
Sbjct  3    VLVDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFNTVAEAKH  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             T+ANASVIYVPPPFA  AI+EA++A+++L VCITEGIP  DMV+VK AL + + TRLI
Sbjct  63   VTEANASVIYVPPPFAADAILEAIDAKIELAVCITEGIPVADMVRVKRAL-EGSSTRLI  120



>gb|ABW76150.1| succinyl-CoA synthetase alpha subunit [Blastocystis sp. NandII]
 gb|ABY62723.1| mitochondrial succinyl-CoA synthetase alpha subunit [Blastocystis 
sp. ATCC 50177]
Length=318

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S    V+VDKNTRVI QGITGKNGTFHT+QAIEYGTKMVGGV PKK GT HLGLP+F +V
Sbjct  19   SSTARVWVDKNTRVIGQGITGKNGTFHTQQAIEYGTKMVGGVNPKKAGTTHLGLPIFASV  78

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
             +AK  T A+A+VIYVPP  A  AI+EA+ AE+ L+VCITEGIPQHDM++VK  +K Q K
Sbjct  79   EEAKKATNADATVIYVPPSGAAGAILEAVAAEIPLIVCITEGIPQHDMLRVKDIMKSQNK  138

Query  548  TRLI  559
            +RLI
Sbjct  139  SRLI  142



>ref|XP_005292517.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X2 [Chrysemys picta bellii]
Length=330

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++++KNT+VICQG TGK GTFH++QA+EYGTK+VGG++P KGG  HLGL
Sbjct  23   RHCSYSATRKNLYINKNTKVICQGFTGKQGTFHSQQALEYGTKLVGGISPGKGGKTHLGL  82

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  
Sbjct  83   PVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVDAEIPLVVCITEGIPQQDMVRVKHK  142

Query  530  LKQQTKTRLI  559
            L +Q KTRL+
Sbjct  143  LIRQDKTRLV  152



>ref|WP_015466944.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Micavibrio aeruginosavorus]
 gb|AGH97391.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Micavibrio aeruginosavorus 
EPB]
Length=293

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 98/119 (82%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVA AKA
Sbjct  3    VLVDKNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLNLPVFDTVAQAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ET  NASVIYVPPPFA  AI+EA++A +DL +CITEGIP  DMV+V+ AL   + TRLI
Sbjct  63   ETGCNASVIYVPPPFAADAILEAIDAGIDLAICITEGIPVLDMVRVRRAL-DGSNTRLI  120



>ref|WP_002721254.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [Rhodobacter]
 ref|YP_354050.1| Succinyl-CoA synthetase, alpha subunit [Rhodobacter sphaeroides 
2.4.1]
 gb|ABA80149.1| Succinyl-CoA synthetase, alpha subunit [Rhodobacter sphaeroides 
2.4.1]
 gb|ABN77728.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Rhodobacter 
sphaeroides ATCC 17029]
 gb|ACM02218.1| 2-oxoglutarate dehydrogenase E1 component [Rhodobacter sphaeroides 
KD131]
 gb|EGJ22466.1| succinyl-CoA synthetase, alpha subunit [Rhodobacter sphaeroides 
WS8N]
 gb|EKX58032.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Rhodobacter sp. 
AKP1]
Length=294

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 102/119 (86%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V V++NT+VICQGITG  GTFHTEQAI YGTKMVGGVTP KGG+EHLGLPVFN+V +A+ 
Sbjct  3    VLVNENTKVICQGITGSQGTFHTEQAIAYGTKMVGGVTPGKGGSEHLGLPVFNSVYEARE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             T ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVK AL Q + +RLI
Sbjct  63   VTGANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRAL-QGSSSRLI  120



>ref|WP_036634769.1| succinate--CoA ligase [Paenirhodobacter enshiensis]
 gb|KFI29705.1| succinate--CoA ligase [Paenirhodobacter enshiensis]
Length=295

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 103/119 (87%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            + +DK TRV+CQG+TG  GTFHTEQAI YGT+MVGGVTP KGGTEHLGLPVFN+V +A A
Sbjct  3    ILIDKTTRVLCQGLTGSQGTFHTEQAIAYGTQMVGGVTPGKGGTEHLGLPVFNSVHEAAA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            +T+ANA+VIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVK AL   +K+RLI
Sbjct  63   KTQANATVIYVPPPFAADSILEAIDAEIELIVCITEGIPVLDMMKVKRAL-SGSKSRLI  120



>ref|XP_005292518.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X3 [Chrysemys picta bellii]
Length=323

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++++KNT+VICQG TGK GTFH++QA+EYGTK+VGG++P KGG  HLGL
Sbjct  16   RHCSYSATRKNLYINKNTKVICQGFTGKQGTFHSQQALEYGTKLVGGISPGKGGKTHLGL  75

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  
Sbjct  76   PVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVDAEIPLVVCITEGIPQQDMVRVKHK  135

Query  530  LKQQTKTRLI  559
            L +Q KTRL+
Sbjct  136  LIRQDKTRLV  145



>ref|XP_010400527.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Corvus cornix cornix]
Length=358

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 111/141 (79%), Gaps = 4/141 (3%)
 Frame = +2

Query  149  SPLWQQQQ----HRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVT  316
            S  WQ QQ    H  + +    ++V+KNT+VICQG TGK GTFH++QA++YGT +VGG++
Sbjct  40   SVFWQFQQNGVRHCSYTASRKNLYVNKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGIS  99

Query  317  PKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGI  496
            P KGG  HLGLPVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEGI
Sbjct  100  PGKGGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGI  159

Query  497  PQHDMVKVKAALKQQTKTRLI  559
            PQ DMV+VK  L +Q+KTRL+
Sbjct  160  PQQDMVRVKHRLLRQSKTRLV  180



>ref|WP_023386589.1| succinyl-CoA synthetase subsunit alpha [Anaplasma marginale]
 gb|AGZ78618.1| succinyl-CoA synthetase subsunit alpha [Anaplasma marginale str. 
Gypsy Plains]
 gb|AGZ79469.1| succinyl-CoA synthetase subsunit alpha [Anaplasma marginale str. 
Dawn]
Length=294

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             V VDKNTRVICQG TG NGTFH+EQAI YGTKMVGGVTP KGGT HLGLPVF+TV  AK
Sbjct  2    SVLVDKNTRVICQGFTGSNGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFDTVLQAK  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             ET+ANASVIYVP P+A  AI EA+EAE++L+VCITEGIP  DMV+VK AL   +K+R+I
Sbjct  62   VETQANASVIYVPAPYAADAIFEAIEAEIELIVCITEGIPVLDMVQVKRALA-GSKSRMI  120



>ref|WP_011907146.1| succinyl-CoA synthetase subsunit alpha [Rhodobacter sphaeroides]
 gb|ABP68989.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Rhodobacter 
sphaeroides ATCC 17025]
Length=294

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 103/119 (87%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V V++NT+VICQGITG  GTFHTEQAI YGTKMVGGVTP KGG+EHLGLPVFN+V +A+ 
Sbjct  3    VLVNENTKVICQGITGSQGTFHTEQAIAYGTKMVGGVTPGKGGSEHLGLPVFNSVFEARD  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             T ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVK AL + +K+RLI
Sbjct  63   VTGANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRAL-EGSKSRLI  120



>ref|XP_009580012.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial, partial [Fulmarus glacialis]
Length=191

 Score =   159 bits (401),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++++KNT+VICQG TGK GTFH++QA++YGT +VGG++P KGG  HLGL
Sbjct  6    RHCSYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISPGKGGKTHLGL  65

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  
Sbjct  66   PVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIPQQDMVRVKHR  125

Query  530  LKQQTKTRLI  559
            L +Q KTRL+
Sbjct  126  LLRQDKTRLV  135



>gb|KFV94110.1| hypothetical protein N327_08715, partial [Fulmarus glacialis]
Length=196

 Score =   159 bits (401),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 109/137 (80%), Gaps = 2/137 (1%)
 Frame = +2

Query  155  LWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKG  328
            L QQ   +H  + +    ++++KNT+VICQG TGK GTFH++QA++YGT +VGG++P KG
Sbjct  3    LVQQNGVRHCSYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISPGKG  62

Query  329  GTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHD  508
            G  HLGLPVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEGIPQ D
Sbjct  63   GKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIPQQD  122

Query  509  MVKVKAALKQQTKTRLI  559
            MV+VK  L +Q KTRL+
Sbjct  123  MVRVKHRLLRQDKTRLV  139



>ref|XP_011398589.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Auxenochlorella protothecoides]
 gb|KFM25693.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Auxenochlorella protothecoides]
Length=321

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P VFVDK TRVI QG TGKNGTFH++QAI+YGT MVGGVTPKKGGT HLGLPVF+TVA+A
Sbjct  26   PAVFVDKTTRVIVQGFTGKNGTFHSQQAIDYGTNMVGGVTPKKGGTTHLGLPVFDTVAEA  85

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRL  556
            +A T A A+ IYVPPPFA AAIMEA+EAE+ L+VCITEGIPQHDMV+VK AL QQ+ +RL
Sbjct  86   RAATGATATAIYVPPPFAAAAIMEALEAEIPLIVCITEGIPQHDMVRVKKALSQQSASRL  145

Query  557  I  559
            I
Sbjct  146  I  146



>ref|XP_636263.1| succinate-CoA ligase [Dictyostelium discoideum AX4]
 sp|P36967.3|SUCA_DICDI RecName: Full=Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha; Short=SCS-alpha; AltName: Full=p36; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL62749.1| succinate-CoA ligase [Dictyostelium discoideum AX4]
Length=315

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +2

Query  176  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  355
            + F S  P V ++K+T+VICQG TG  GTFH++QAIEYGT MVGGV+P KGG +HL LPV
Sbjct  13   KRFFSTKPSVLINKHTKVICQGFTGNQGTFHSKQAIEYGTNMVGGVSPGKGGQKHLDLPV  72

Query  356  FNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
            FNTV +AK  T ANA+VIYVPPP A AAI EA++AE++LVVCITEGIPQ DMVKVK  L 
Sbjct  73   FNTVKEAKEATGANATVIYVPPPHAAAAIKEAIDAEMELVVCITEGIPQQDMVKVKYLLN  132

Query  536  QQTKTRLI  559
            +Q KTRLI
Sbjct  133  KQNKTRLI  140



>ref|XP_002180696.1| ligase succinate-coa ligase [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48104.1| ligase succinate-coa ligase [Phaeodactylum tricornutum CCAP 1055/1]
Length=309

 Score =   162 bits (409),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S   +V+VDKN+RVICQG TGK GTFH+ QAI+YGT MVGGVTPKKGG EHLGLPVFNTV
Sbjct  2    SSTAKVWVDKNSRVICQGFTGKQGTFHSTQAIDYGTNMVGGVTPKKGGQEHLGLPVFNTV  61

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
             +A    + +ASVIYVPPP+A  AI++A+EAE+ LVVCITEGIPQ DM +VK AL+ Q +
Sbjct  62   QEAVDGVQPDASVIYVPPPYAAQAILDAIEAEIGLVVCITEGIPQQDMARVKHALRLQDR  121

Query  548  TRLI  559
            TRLI
Sbjct  122  TRLI  125



>ref|XP_009703991.1| PREDICTED: succinyl-CoA ligase subunit alpha, mitochondrial-like, 
partial [Cariama cristata]
Length=190

 Score =   158 bits (400),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++++KNT+VICQG TGK GTFH++QA++YGT +VGG++P KGG  HLGL
Sbjct  33   RHCSYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISPGKGGKTHLGL  92

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  
Sbjct  93   PVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIPQQDMVRVKHR  152

Query  530  LKQQTKTRLI  559
            L +Q KTRL+
Sbjct  153  LLRQDKTRLV  162



>ref|XP_005292516.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X1 [Chrysemys picta bellii]
Length=336

 Score =   162 bits (411),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++++KNT+VICQG TGK GTFH++QA+EYGTK+VGG++P KGG  HLGL
Sbjct  29   RHCSYSATRKNLYINKNTKVICQGFTGKQGTFHSQQALEYGTKLVGGISPGKGGKTHLGL  88

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  
Sbjct  89   PVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVDAEIPLVVCITEGIPQQDMVRVKHK  148

Query  530  LKQQTKTRLI  559
            L +Q KTRL+
Sbjct  149  LIRQDKTRLV  158



>emb|CBJ28950.1| Succinate--CoA ligase (GDP-forming), alpha subunit [Ectocarpus 
siliculosus]
Length=322

 Score =   162 bits (410),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S + +V++D+NT+VI QG TGK GTFH EQAIEYG++ VGGVTPKKGG  HLG PVFNTV
Sbjct  22   SSSAKVWIDQNTKVIVQGFTGKQGTFHAEQAIEYGSQYVGGVTPKKGGQTHLGKPVFNTV  81

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
            A+AK   K +ASV+YVPPPFAGAA+++A+E E+ LVVCITEGIPQ DM KVK AL+QQT 
Sbjct  82   AEAKEGVKPDASVVYVPPPFAGAAVLDAIENEIPLVVCITEGIPQKDMAKVKHALRQQTA  141

Query  548  TRLI  559
            TRLI
Sbjct  142  TRLI  145



>ref|XP_008978670.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X1 [Callithrix jacchus]
Length=370

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLPQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L  Q KTRLI
Sbjct  145  EGIPQQDMVRVKHKLLHQGKTRLI  168



>ref|WP_038066282.1| succinate--CoA ligase [Thioclava dalianensis]
 gb|KEP69482.1| succinate--CoA ligase [Thioclava dalianensis]
Length=294

 Score =   161 bits (407),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 103/119 (87%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V V++NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG EHLGLPVFN+V +AKA
Sbjct  3    VLVNENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGQEHLGLPVFNSVHEAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            +T+ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVK AL   +K+RLI
Sbjct  63   KTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRAL-IDSKSRLI  120



>emb|CBK25395.2| Succinyl-CoA Synthetase subunit ? (SCS?) [Blastocystis hominis]
Length=318

 Score =   162 bits (409),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S    V++DKNT+VI QGITGKNGTFHT+QAIEYGTKMVGGV PKK G+ HLGLP+F++V
Sbjct  19   SSTARVWIDKNTKVIGQGITGKNGTFHTQQAIEYGTKMVGGVNPKKAGSTHLGLPIFSSV  78

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
             +AK  T A+A+VIYVPP  A +AI+EA+ AE+ L+VCITEGIPQHDM++VK  +K Q+K
Sbjct  79   EEAKKATNADATVIYVPPSGAASAILEAVAAEIPLIVCITEGIPQHDMLRVKDIMKSQSK  138

Query  548  TRLI  559
            +RLI
Sbjct  139  SRLI  142



>ref|XP_009441016.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X2 [Pan troglodytes]
Length=338

 Score =   162 bits (410),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VGG TP KGG  HLGL
Sbjct  31   RHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGL  90

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCITEGIPQ DMV+VK  
Sbjct  91   PVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCITEGIPQQDMVRVKHK  150

Query  530  LKQQTKTRLI  559
            L +Q KTRLI
Sbjct  151  LLRQEKTRLI  160



>ref|WP_010263012.1| succinyl-CoA ligase chain A (sucD), partial [Anaplasma marginale]
Length=294

 Score =   161 bits (407),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             V VDKNTRVICQG TG NGTFH+EQA+ YGTKMVGGVTP KGGT HLGLPVF+TV  AK
Sbjct  2    SVLVDKNTRVICQGFTGSNGTFHSEQAVAYGTKMVGGVTPGKGGTTHLGLPVFDTVLQAK  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             ET+ANASVIYVP P+A  AI EA+EAE++L+VCITEGIP  DMV+VK AL   +K+R+I
Sbjct  62   VETQANASVIYVPAPYAADAIFEAIEAEIELIVCITEGIPVLDMVQVKRALA-GSKSRMI  120



>emb|CBK19683.2| Succinyl-CoA Synthetase subunit ? (SCS?) [Blastocystis hominis]
Length=318

 Score =   161 bits (408),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S    V++DKNT+VI QGITGKNGTFHT+QAIEYGTKMVGGV PKK G+ HLGLP+F++V
Sbjct  19   SSTARVWIDKNTKVIGQGITGKNGTFHTQQAIEYGTKMVGGVNPKKAGSTHLGLPIFSSV  78

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
             +AK  T A+A+VIYVPP  A +AI+EA+ AE+ L+VCITEGIPQHDM++VK  +K Q+K
Sbjct  79   EEAKKATNADATVIYVPPSGAASAILEAVAAEIPLIVCITEGIPQHDMLRVKDIMKSQSK  138

Query  548  TRLI  559
            +RLI
Sbjct  139  SRLI  142



>gb|KFQ29616.1| hypothetical protein N332_09956, partial [Mesitornis unicolor]
Length=309

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = +2

Query  152  PLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKK  325
            PL QQ   +H  + +    ++++KNT+VICQG TGK GTFH++QA++YGT +VGG++P K
Sbjct  2    PLVQQNGVRHCSYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISPGK  61

Query  326  GGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQH  505
            GG  HLGLPVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEGIPQ 
Sbjct  62   GGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIPQQ  121

Query  506  DMVKVKAALKQQTKTRLI  559
            DMV+VK  L +Q KTRL+
Sbjct  122  DMVRVKHRLLRQDKTRLV  139



>gb|AAD17940.2| succinyl-CoA synthetase alpha subunit [Homo sapiens]
Length=333

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12   RLLSRSFLLPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G  P KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  72   GTLPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQTKTRLI  559
            EGIPQ DMV+VK  L +Q KTRLI
Sbjct  132  EGIPQQDMVRVKHKLLRQEKTRLI  155



>ref|XP_009867186.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial, partial [Apaloderma vittatum]
Length=395

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 118/167 (71%), Gaps = 7/167 (4%)
 Frame = +2

Query  80   VVMAWQTARLIANVSKKVR-----PITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQ  238
            VV       L+A + K        P+  SP  QQ   +H  + +    ++++KNT+VICQ
Sbjct  51   VVSCAHEESLVAGIGKDAVIFLGVPVDISPTVQQNGVRHCSYSASRKNLYINKNTKVICQ  110

Query  239  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  418
            G TGK GTFH++QA++YGT +VGG +P KGG  HLGLPVFN+V +AK +T A+A+VIYVP
Sbjct  111  GFTGKQGTFHSQQALDYGTNLVGGTSPGKGGKTHLGLPVFNSVKEAKEQTGASATVIYVP  170

Query  419  PPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            PPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  L +Q KTRL+
Sbjct  171  PPFAAAAINEAIDAEMPLVVCITEGIPQQDMVRVKHRLLRQDKTRLV  217



>gb|KFV41379.1| hypothetical protein N341_08030, partial [Tyto alba]
Length=309

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = +2

Query  152  PLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKK  325
            PL QQ   +H  + +    ++++KNT+VICQG TGK GTFH++QA++YGT +VGG++P K
Sbjct  2    PLVQQNGVRHCSYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISPGK  61

Query  326  GGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQH  505
            GG  HLGLPVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ L+VCITEGIPQ 
Sbjct  62   GGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLIVCITEGIPQQ  121

Query  506  DMVKVKAALKQQTKTRLI  559
            DMV+VK  L +Q KTRL+
Sbjct  122  DMVRVKHRLLRQDKTRLV  139



>gb|EAQ24007.1| succinyl-CoA synthase, alpha subunit [Roseovarius sp. 217]
Length=159

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 102/119 (86%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDK+TRVICQG+TG  GTFH+EQAI YGT+MVGGVTP KGGT HL LPVFN+V +AK 
Sbjct  3    VLVDKHTRVICQGLTGSQGTFHSEQAIAYGTQMVGGVTPGKGGTTHLDLPVFNSVHEAKH  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             T+ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM++VK AL + +K+RLI
Sbjct  63   VTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMRVKRAL-EGSKSRLI  120



>gb|KFV11936.1| hypothetical protein N339_07129, partial [Pterocles gutturalis]
Length=196

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 107/137 (78%), Gaps = 2/137 (1%)
 Frame = +2

Query  155  LWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKG  328
            L QQ   +H  + +    +++ KNT+VICQG TGK GTFH++QA++YGT +VGG +P KG
Sbjct  3    LVQQNGVRHCSYSASRKNLYISKNTKVICQGFTGKQGTFHSQQALDYGTSLVGGTSPGKG  62

Query  329  GTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHD  508
            G  HLGLPVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEGIPQ D
Sbjct  63   GKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIPQQD  122

Query  509  MVKVKAALKQQTKTRLI  559
            MV+VK  L +Q KTRL+
Sbjct  123  MVRVKHRLLRQDKTRLV  139



>ref|XP_008698282.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X2 [Ursus maritimus]
Length=314

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             ++VDKNT+VICQG TGK GTFH++QA++YGT++VGG TP KGG  HLGLPVFNTV +AK
Sbjct  17   HLYVDKNTKVICQGFTGKQGTFHSQQALDYGTQLVGGTTPGKGGQTHLGLPVFNTVKEAK  76

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
             ET A ASVIYVPPPFA AAI EA+EAE+ LVVCITEGIPQ DMV+VK  L +Q  TRLI
Sbjct  77   EETGATASVIYVPPPFAAAAINEAVEAEVPLVVCITEGIPQQDMVRVKHKLLRQGTTRLI  136



>ref|WP_014102208.1| succinyl-CoA synthetase subsunit alpha [Micavibrio aeruginosavorus]
 gb|AEP08985.1| succinyl-CoA synthetase, alpha subunit [Micavibrio aeruginosavorus 
ARL-13]
Length=293

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 98/119 (82%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVA AKA
Sbjct  3    VLVDKNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLNLPVFDTVAQAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            ET  NASVIYVPPPFA  AI+EA++A ++L +CITEGIP  DMV+V+ AL   + TRLI
Sbjct  63   ETGCNASVIYVPPPFAADAILEAIDAGIELAICITEGIPVLDMVRVRRAL-DGSNTRLI  120



>ref|WP_014241630.1| succinyl-CoA synthetase subsunit alpha [Azospirillum brasilense]
 emb|CCC99459.1| succinyl-CoA synthetase, alpha subunit,NAD(P)-binding [Azospirillum 
brasilense Sp245]
 gb|EZQ09513.1| succinate--CoA ligase [Azospirillum brasilense]
 gb|AIB12739.1| succinate--CoA ligase [Azospirillum brasilense]
Length=291

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 100/119 (84%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVADA  
Sbjct  3    VLVDKNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFDTVADAVE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            +T ANASVIYVPPPFA  AI+EA++AE+ LVVCITEGIP  DMV+VK AL   +KTRLI
Sbjct  63   KTGANASVIYVPPPFAADAILEAIDAEIPLVVCITEGIPVLDMVRVKRAL-GNSKTRLI  120



>emb|CBK23557.2| Succinyl-CoA Synthetase subunit ? (SCS?) [Blastocystis hominis]
Length=318

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S    V++DKNT+VI QGITGKNGTFHT+QAIEYGTKMVGGV PKK G+ HLGLP+F +V
Sbjct  19   SSTARVWIDKNTKVIGQGITGKNGTFHTQQAIEYGTKMVGGVNPKKAGSTHLGLPIFASV  78

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTK  547
             +AK  T A+A+VIYVPP  A +AI+EA+ AE+ L+VCITEGIPQHDM++VK  +K Q+K
Sbjct  79   EEAKKATNADATVIYVPPSGAASAILEAVAAEIPLIVCITEGIPQHDMLRVKDIMKSQSK  138

Query  548  TRLI  559
            +RLI
Sbjct  139  SRLI  142



>ref|WP_038528120.1| succinate--CoA ligase [Azospirillum brasilense]
 gb|EZQ08744.1| succinate--CoA ligase [Azospirillum brasilense]
 gb|AIB11866.1| succinate--CoA ligase [Azospirillum brasilense]
Length=291

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 100/119 (84%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVADA  
Sbjct  3    VLVDKNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFDTVADAVE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            +T ANASVIYVPPPFA  AI+EA++AE+ LVVCITEGIP  DMV+VK AL   +KTRLI
Sbjct  63   KTGANASVIYVPPPFAADAILEAIDAEIPLVVCITEGIPVLDMVRVKRAL-GNSKTRLI  120



>ref|XP_009973222.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Tyto alba]
Length=325

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 110/138 (80%), Gaps = 2/138 (1%)
 Frame = +2

Query  152  PLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKK  325
            PL QQ   +H  + +    ++++KNT+VICQG TGK GTFH++QA++YGT +VGG++P K
Sbjct  10   PLVQQNGVRHCSYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISPGK  69

Query  326  GGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQH  505
            GG  HLGLPVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ L+VCITEGIPQ 
Sbjct  70   GGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLIVCITEGIPQQ  129

Query  506  DMVKVKAALKQQTKTRLI  559
            DMV+VK  L +Q KTRL+
Sbjct  130  DMVRVKHRLLRQDKTRLV  147



>ref|XP_008643339.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial, partial [Corvus brachyrhynchos]
Length=320

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = +2

Query  149  SPLWQQQ-QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKK  325
            SP+ Q   +H  + +    ++V+KNT+VICQG TGK GTFH++QA++YGT +VGG++P K
Sbjct  5    SPVQQNGVRHCSYTASRKNLYVNKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISPGK  64

Query  326  GGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQH  505
            GG  HLGLPVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEGIPQ 
Sbjct  65   GGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIPQQ  124

Query  506  DMVKVKAALKQQTKTRLI  559
            DMV+VK  L +Q+KTRL+
Sbjct  125  DMVRVKHRLLRQSKTRLV  142



>gb|KFV12475.1| hypothetical protein N340_07169, partial [Tauraco erythrolophus]
Length=302

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 109/137 (80%), Gaps = 2/137 (1%)
 Frame = +2

Query  155  LWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKG  328
            L QQ   +H  + +    ++++KNT+VICQG TGK GTFH++QA++YGT +VGG++P KG
Sbjct  3    LVQQNGVRHSSYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISPGKG  62

Query  329  GTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHD  508
            G  HLGLPVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEGIPQ D
Sbjct  63   GKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIPQQD  122

Query  509  MVKVKAALKQQTKTRLI  559
            MV+VK  L +Q KTRL+
Sbjct  123  MVRVKHRLLRQDKTRLV  139



>gb|KFQ48697.1| hypothetical protein N333_04199, partial [Nestor notabilis]
Length=309

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 109/137 (80%), Gaps = 2/137 (1%)
 Frame = +2

Query  155  LWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKG  328
            L QQ   +H  + S    ++V+KNT+VICQG TGK GTFH++QA++YGT +VGG++P KG
Sbjct  3    LVQQNGVRHCSYTSSRKNLYVNKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISPGKG  62

Query  329  GTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHD  508
            G  HLGLPVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEGIPQ D
Sbjct  63   GKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIPQQD  122

Query  509  MVKVKAALKQQTKTRLI  559
            MV+VK  L +Q KTRL+
Sbjct  123  MVRVKHRLLRQNKTRLV  139



>ref|XP_005089236.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like isoform X1 [Aplysia californica]
 ref|XP_005089237.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like isoform X2 [Aplysia californica]
Length=346

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 116/154 (75%), Gaps = 9/154 (6%)
 Frame = +2

Query  98   TARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQ  277
            +++++A +    RP  +S     +Q+         + +D+NT+VICQG TGK GTFH++Q
Sbjct  4    SSKVLARLPGLFRPAVRSVYTASRQN---------LMLDENTKVICQGFTGKQGTFHSQQ  54

Query  278  AIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeame  457
            A+EYGTK+VGGV+P K GTEHLGLPVF +V +AK  T A ASV++VPPPFA AA+MEAM+
Sbjct  55   ALEYGTKLVGGVSPAKAGTEHLGLPVFASVKEAKDATGATASVVFVPPPFAAAAVMEAMD  114

Query  458  aeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            AE+ LVVCITEGIPQ DMV+VK  L +Q+KTRLI
Sbjct  115  AEIPLVVCITEGIPQQDMVRVKHRLVRQSKTRLI  148



>ref|XP_005089238.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like isoform X3 [Aplysia californica]
 ref|XP_005089239.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like isoform X4 [Aplysia californica]
Length=326

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 116/154 (75%), Gaps = 9/154 (6%)
 Frame = +2

Query  98   TARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQ  277
            +++++A +    RP  +S     +Q+         + +D+NT+VICQG TGK GTFH++Q
Sbjct  4    SSKVLARLPGLFRPAVRSVYTASRQN---------LMLDENTKVICQGFTGKQGTFHSQQ  54

Query  278  AIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeame  457
            A+EYGTK+VGGV+P K GTEHLGLPVF +V +AK  T A ASV++VPPPFA AA+MEAM+
Sbjct  55   ALEYGTKLVGGVSPAKAGTEHLGLPVFASVKEAKDATGATASVVFVPPPFAAAAVMEAMD  114

Query  458  aeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            AE+ LVVCITEGIPQ DMV+VK  L +Q+KTRLI
Sbjct  115  AEIPLVVCITEGIPQQDMVRVKHRLVRQSKTRLI  148



>ref|WP_038144207.1| succinate--CoA ligase [Thioclava sp. 13D2W-2]
 gb|KFE35934.1| succinyl-CoA synthetase subunit alpha [Thioclava sp. 13D2W-2]
Length=295

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V V++NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG EHLGLPVF++V +AKA
Sbjct  3    VLVNENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGQEHLGLPVFDSVHEAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            +T+ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVK AL   +K+RLI
Sbjct  63   KTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRAL-VDSKSRLI  120



>gb|KFP54334.1| hypothetical protein N323_03013, partial [Cathartes aura]
Length=309

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +2

Query  152  PLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKK  325
            PL QQ   +H  + +    ++++KNT+VICQG TGK GTFH++QA++YGT +VGG +P K
Sbjct  2    PLVQQNGVRHCSYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGTSPGK  61

Query  326  GGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQH  505
            GG  HLGLPVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEGIPQ 
Sbjct  62   GGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIPQQ  121

Query  506  DMVKVKAALKQQTKTRLI  559
            DMV+VK  L +Q KTRL+
Sbjct  122  DMVRVKHRLLRQDKTRLV  139



>ref|WP_011386313.1| succinyl-CoA synthetase subsunit alpha [Magnetospirillum magneticum]
 dbj|BAE52763.1| Succinyl-CoA synthetase [Magnetospirillum magneticum AMB-1]
Length=291

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 99/119 (83%), Gaps = 1/119 (1%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V V+ NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT HL LPVFNTVA+AKA
Sbjct  3    VLVNSNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLDLPVFNTVAEAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  559
            +T  NASVIYVPPPFA  AI+EA++AE++L VCITEGIP  DM+ VK AL Q +KTRLI
Sbjct  63   KTGCNASVIYVPPPFAADAILEAIDAEIELAVCITEGIPVADMLAVKRAL-QGSKTRLI  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840