BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF019L07

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588398.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       244   3e-77   Nicotiana tomentosiformis
gb|EYU20812.1|  hypothetical protein MIMGU_mgv1a011359mg                241   5e-76   Erythranthe guttata [common monkey flower]
emb|CDP06201.1|  unnamed protein product                                240   9e-76   Coffea canephora [robusta coffee]
emb|CDP20582.1|  unnamed protein product                                231   2e-72   Coffea canephora [robusta coffee]
ref|XP_006339259.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    228   3e-71   Solanum tuberosum [potatoes]
ref|XP_011079072.1|  PREDICTED: estradiol 17-beta-dehydrogenase 8...    228   8e-71   Sesamum indicum [beniseed]
ref|XP_011079073.1|  PREDICTED: estradiol 17-beta-dehydrogenase 8...    226   2e-70   Sesamum indicum [beniseed]
ref|XP_010653621.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    226   3e-70   Vitis vinifera
emb|CAN64848.1|  hypothetical protein VITISV_036158                     225   4e-70   Vitis vinifera
ref|XP_011075453.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    226   4e-70   Sesamum indicum [beniseed]
ref|XP_011075452.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    226   7e-70   Sesamum indicum [beniseed]
ref|XP_006430532.1|  hypothetical protein CICLE_v10012408mg             220   4e-69   
ref|XP_004249318.1|  PREDICTED: D-erythrulose reductase-like            223   4e-69   Solanum lycopersicum
ref|XP_006482062.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    223   5e-69   Citrus sinensis [apfelsine]
gb|AAN32641.1|AF416732_1  putative short-chain type alcohol dehyd...    223   6e-69   Solanum tuberosum [potatoes]
gb|EYU18609.1|  hypothetical protein MIMGU_mgv1a011131mg                223   7e-69   Erythranthe guttata [common monkey flower]
gb|KDO53624.1|  hypothetical protein CISIN_1g023555mg                   222   8e-69   Citrus sinensis [apfelsine]
ref|XP_010055797.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       222   9e-69   Eucalyptus grandis [rose gum]
ref|XP_006430531.1|  hypothetical protein CICLE_v10012408mg             220   4e-68   Citrus clementina [clementine]
ref|XP_006482064.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    220   5e-68   
ref|XP_004249319.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       219   8e-68   Solanum lycopersicum
ref|XP_002517315.1|  2,4-dienoyl-CoA reductase, putative                219   1e-67   Ricinus communis
ref|XP_006430535.1|  hypothetical protein CICLE_v10012421mg             219   1e-67   Citrus clementina [clementine]
ref|XP_007145484.1|  hypothetical protein PHAVU_007G242900g             218   2e-67   Phaseolus vulgaris [French bean]
ref|XP_011079077.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       218   5e-67   Sesamum indicum [beniseed]
ref|XP_008340560.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    218   7e-67   
gb|KDO53625.1|  hypothetical protein CISIN_1g023885mg                   216   1e-66   Citrus sinensis [apfelsine]
ref|XP_009417296.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    216   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008240678.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    215   2e-66   Prunus mume [ume]
ref|XP_006482063.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    215   2e-66   Citrus sinensis [apfelsine]
ref|XP_008386836.1|  PREDICTED: probable L-xylulose reductase           216   3e-66   
ref|XP_010112844.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG    214   1e-65   Morus notabilis
ref|XP_002282735.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    214   1e-65   Vitis vinifera
emb|CBI32789.3|  unnamed protein product                                214   1e-65   Vitis vinifera
ref|NP_001274762.1|  putative short-chain type alcohol dehydrogenase    213   2e-65   Solanum tuberosum [potatoes]
gb|AFK48641.1|  unknown                                                 213   3e-65   Medicago truncatula
ref|XP_003518977.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    213   4e-65   Glycine max [soybeans]
ref|XP_004294537.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    213   4e-65   Fragaria vesca subsp. vesca
emb|CAN59905.1|  hypothetical protein VITISV_033145                     213   7e-65   Vitis vinifera
gb|KJB54602.1|  hypothetical protein B456_009G041000                    210   7e-65   Gossypium raimondii
gb|KHG26617.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG         211   2e-64   Gossypium arboreum [tree cotton]
ref|XP_009371362.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    211   2e-64   Pyrus x bretschneideri [bai li]
ref|XP_009631508.1|  PREDICTED: probable L-xylulose reductase           210   2e-64   Nicotiana tomentosiformis
gb|KJB54601.1|  hypothetical protein B456_009G041000                    210   3e-64   Gossypium raimondii
ref|XP_007028287.1|  2,4-dienoyl-CoA reductase isoform 2                210   3e-64   
gb|ACJ85419.1|  unknown                                                 207   3e-64   Medicago truncatula
ref|XP_009383217.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    210   4e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009371244.1|  PREDICTED: LOW QUALITY PROTEIN: estradiol 17...    210   4e-64   
gb|KEH30024.1|  enoyl-(acyl carrier) reductase                          209   9e-64   Medicago truncatula
ref|XP_006430533.1|  hypothetical protein CICLE_v10012432mg             206   1e-63   
ref|XP_009786105.1|  PREDICTED: D-erythrulose reductase-like            207   2e-63   Nicotiana sylvestris
gb|KEH41456.1|  NAD(P)-binding rossmann-fold protein                    208   2e-63   Medicago truncatula
ref|XP_009773767.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    208   3e-63   Nicotiana sylvestris
ref|XP_007028286.1|  2,4-dienoyl-CoA reductase, putative isoform 1      210   3e-63   
ref|XP_006430534.1|  hypothetical protein CICLE_v10012432mg             207   4e-63   Citrus clementina [clementine]
ref|XP_008339342.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    207   4e-63   
gb|ABK93994.1|  unknown                                                 207   5e-63   Populus trichocarpa [western balsam poplar]
ref|XP_003518969.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    207   6e-63   Glycine max [soybeans]
ref|XP_008340561.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    207   7e-63   
ref|XP_010913911.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    207   7e-63   Elaeis guineensis
ref|XP_006366156.1|  PREDICTED: probable L-xylulose reductase-like      207   1e-62   
ref|XP_008805478.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    206   2e-62   Phoenix dactylifera
ref|XP_010314314.1|  PREDICTED: probable L-xylulose reductase           204   3e-62   Solanum lycopersicum
gb|KDP23890.1|  hypothetical protein JCGZ_26632                         205   4e-62   Jatropha curcas
ref|XP_004252379.1|  PREDICTED: probable L-xylulose reductase           204   4e-62   Solanum lycopersicum
ref|XP_002323240.1|  short-chain dehydrogenase/reductase family p...    204   6e-62   Populus trichocarpa [western balsam poplar]
ref|XP_009394522.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    203   7e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010529958.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    204   1e-61   Tarenaya hassleriana [spider flower]
ref|XP_009150759.1|  PREDICTED: probable L-xylulose reductase iso...    203   1e-61   Brassica rapa
ref|XP_006361353.1|  PREDICTED: probable L-xylulose reductase-like      203   2e-61   
ref|XP_009607267.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    203   2e-61   Nicotiana tomentosiformis
ref|XP_007202394.1|  hypothetical protein PRUPE_ppa009414mg             203   2e-61   Prunus persica
ref|XP_009778773.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    203   3e-61   Nicotiana sylvestris
ref|XP_009150760.1|  PREDICTED: probable L-xylulose reductase iso...    202   3e-61   Brassica rapa
ref|XP_011000407.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    203   3e-61   Populus euphratica
ref|XP_007145483.1|  hypothetical protein PHAVU_007G242800g             202   4e-61   Phaseolus vulgaris [French bean]
ref|XP_009593495.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    202   6e-61   Nicotiana tomentosiformis
gb|KFK34764.1|  hypothetical protein AALP_AA5G190600                    201   9e-61   Arabis alpina [alpine rockcress]
ref|XP_008455729.1|  PREDICTED: uncharacterized oxidoreductase C9...    201   1e-60   Cucumis melo [Oriental melon]
gb|KFK34763.1|  hypothetical protein AALP_AA5G190600                    201   1e-60   Arabis alpina [alpine rockcress]
ref|XP_010112832.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG    206   2e-60   
ref|XP_004515513.1|  PREDICTED: glucose 1-dehydrogenase-like            201   2e-60   Cicer arietinum [garbanzo]
ref|XP_002876294.1|  short-chain dehydrogenase/reductase family p...    201   2e-60   
ref|XP_009631506.1|  PREDICTED: probable L-xylulose reductase iso...    200   2e-60   Nicotiana tomentosiformis
gb|EMT14873.1|  3-oxoacyl-(acyl-carrier-protein) reductase              200   2e-60   
gb|EPS63859.1|  hypothetical protein M569_10924                         200   2e-60   Genlisea aurea
ref|XP_008808086.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    201   3e-60   Phoenix dactylifera
ref|XP_010427297.1|  PREDICTED: probable L-xylulose reductase iso...    200   3e-60   
ref|XP_006365803.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    200   3e-60   Solanum tuberosum [potatoes]
ref|XP_010530115.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    200   3e-60   Tarenaya hassleriana [spider flower]
ref|XP_010427295.1|  PREDICTED: probable L-xylulose reductase iso...    200   4e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010529885.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    199   5e-60   
ref|XP_010943529.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    199   1e-59   Elaeis guineensis
ref|XP_010530193.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    198   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_009394521.1|  PREDICTED: hydroxysteroid dehydrogenase-like...    205   2e-59   
ref|XP_009124575.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    198   2e-59   
ref|XP_010530038.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    197   2e-59   Tarenaya hassleriana [spider flower]
ref|XP_009390649.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    198   2e-59   
emb|CDY29203.1|  BnaA06g25540D                                          197   2e-59   Brassica napus [oilseed rape]
ref|XP_006403473.1|  hypothetical protein EUTSA_v10010610mg             197   3e-59   Eutrema salsugineum [saltwater cress]
ref|XP_010418256.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    197   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010257447.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    197   4e-59   Nelumbo nucifera [Indian lotus]
ref|XP_006291426.1|  hypothetical protein CARUB_v10017563mg             199   5e-59   
ref|XP_004252861.2|  PREDICTED: omega-6 fatty acid desaturase, en...    205   5e-59   
ref|XP_010314672.1|  PREDICTED: omega-6 fatty acid desaturase, en...    205   5e-59   
ref|XP_010473483.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    196   8e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010504386.1|  PREDICTED: probable L-xylulose reductase iso...    196   8e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010504384.1|  PREDICTED: probable L-xylulose reductase iso...    196   1e-58   Camelina sativa [gold-of-pleasure]
ref|NP_974441.1|  Rossmann-fold NAD(P)-binding domain-containing ...    196   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516097.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    196   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_004249129.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    196   2e-58   Solanum lycopersicum
ref|XP_006301634.1|  hypothetical protein CARUB_v10022077mg             195   2e-58   
ref|XP_006361361.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    196   2e-58   
ref|NP_001185300.1|  Rossmann-fold NAD(P)-binding domain-containi...    193   2e-58   
ref|NP_567019.1|  Rossmann-fold NAD(P)-binding domain-containing ...    195   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516096.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    195   2e-58   Camelina sativa [gold-of-pleasure]
ref|NP_191091.2|  Rossmann-fold NAD(P)-binding domain-containing ...    195   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291425.1|  hypothetical protein CARUB_v10017563mg             196   3e-58   
emb|CAB75763.1|  oxidoreductase-like protein                            194   4e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139176.1|  PREDICTED: probable L-xylulose reductase iso...    194   6e-58   Brassica rapa
ref|NP_176527.4|  Rossmann-fold NAD(P)-binding domain-containing ...    194   7e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139177.1|  PREDICTED: probable L-xylulose reductase iso...    194   8e-58   Brassica rapa
ref|XP_009139180.1|  PREDICTED: probable L-xylulose reductase iso...    193   8e-58   Brassica rapa
ref|XP_004170137.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[a...    194   1e-57   
ref|XP_004144326.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    194   1e-57   Cucumis sativus [cucumbers]
emb|CDX76107.1|  BnaA04g03710D                                          193   1e-57   
emb|CAB75765.1|  beta-ketoacyl-ACP reductase-like protein               194   1e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AAF19703.1|AC008047_10  F2K11.24                                     193   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403474.1|  hypothetical protein EUTSA_v10010605mg             193   1e-57   Eutrema salsugineum [saltwater cress]
gb|KFK40341.1|  hypothetical protein AALP_AA3G361500                    193   1e-57   Arabis alpina [alpine rockcress]
ref|XP_009391879.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    193   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009139179.1|  PREDICTED: probable L-xylulose reductase iso...    192   2e-57   Brassica rapa
emb|CDY07814.1|  BnaC03g48080D                                          192   2e-57   Brassica napus [oilseed rape]
emb|CDY65313.1|  BnaCnng46610D                                          192   3e-57   Brassica napus [oilseed rape]
emb|CDP21456.1|  unnamed protein product                                192   3e-57   Coffea canephora [robusta coffee]
emb|CDY48725.1|  BnaA09g10000D                                          192   4e-57   Brassica napus [oilseed rape]
ref|NP_974072.1|  putative ketoacyl-ACP reductase                       192   4e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDY44938.1|  BnaA02g04430D                                          192   4e-57   Brassica napus [oilseed rape]
ref|NP_001031220.1|  putative ketoacyl-ACP reductase                    192   4e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73333.1|  BnaC05g27730D                                          192   4e-57   
ref|NP_176449.2|  putative ketoacyl-ACP reductase                       192   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185294.1|  putative ketoacyl-ACP reductase                    191   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190203.1|  NAD(P)-binding Rossmann-fold superfamily protein      191   8e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139357.1|  PREDICTED: probable L-xylulose reductase           191   8e-57   
ref|XP_006408894.1|  hypothetical protein EUTSA_v10002227mg             191   8e-57   
ref|XP_006365797.1|  PREDICTED: probable L-xylulose reductase-like      191   1e-56   Solanum tuberosum [potatoes]
gb|AAD43618.1|AC005698_17  T3P18.17                                     192   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010673042.1|  PREDICTED: L-xylulose reductase-like               191   1e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009121071.1|  PREDICTED: probable L-xylulose reductase iso...    191   1e-56   Brassica rapa
ref|XP_009112627.1|  PREDICTED: probable L-xylulose reductase           191   1e-56   Brassica rapa
ref|XP_010265875.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    191   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_009116225.1|  PREDICTED: probable L-xylulose reductase iso...    190   2e-56   Brassica rapa
ref|XP_009121072.1|  PREDICTED: probable L-xylulose reductase iso...    189   3e-56   Brassica rapa
ref|XP_004172090.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    189   4e-56   
ref|XP_009116226.1|  PREDICTED: probable L-xylulose reductase iso...    189   6e-56   Brassica rapa
ref|XP_004252844.1|  PREDICTED: probable L-xylulose reductase           188   6e-56   Solanum lycopersicum
ref|XP_004172089.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    190   7e-56   
ref|XP_002886464.1|  predicted protein                                  189   7e-56   
ref|XP_004973876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    188   8e-56   Setaria italica
ref|XP_008443382.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    189   9e-56   Cucumis melo [Oriental melon]
emb|CDP06198.1|  unnamed protein product                                189   9e-56   Coffea canephora [robusta coffee]
emb|CDP06199.1|  unnamed protein product                                188   1e-55   Coffea canephora [robusta coffee]
emb|CDY02920.1|  BnaC04g25660D                                          186   2e-55   
ref|XP_006367949.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    187   3e-55   
ref|XP_004136692.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    187   3e-55   Cucumis sativus [cucumbers]
ref|XP_004136691.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    187   5e-55   
ref|NP_565425.1|  Rossmann-fold NAD(P)-binding domain-containing ...    187   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011079076.1|  PREDICTED: L-rhamnose-1-dehydrogenase-like         186   7e-55   Sesamum indicum [beniseed]
emb|CDY40209.1|  BnaA09g34910D                                          187   8e-55   Brassica napus [oilseed rape]
ref|XP_009599584.1|  PREDICTED: probable L-xylulose reductase           185   1e-54   Nicotiana tomentosiformis
ref|XP_009631507.1|  PREDICTED: probable L-xylulose reductase iso...    185   1e-54   Nicotiana tomentosiformis
ref|XP_011079074.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    185   2e-54   Sesamum indicum [beniseed]
ref|XP_008455802.1|  PREDICTED: probable L-xylulose reductase           185   3e-54   
emb|CDX73391.1|  BnaC08g26120D                                          188   7e-54   
ref|XP_002444769.1|  hypothetical protein SORBIDRAFT_07g027700          183   9e-54   Sorghum bicolor [broomcorn]
ref|XP_009763303.1|  PREDICTED: probable L-xylulose reductase iso...    182   1e-53   Nicotiana sylvestris
emb|CDY03343.1|  BnaC09g10050D                                          183   1e-53   
ref|XP_009763295.1|  PREDICTED: probable L-xylulose reductase iso...    182   3e-53   Nicotiana sylvestris
ref|XP_004248275.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       181   4e-53   Solanum lycopersicum
ref|XP_009594209.1|  PREDICTED: probable L-xylulose reductase           181   6e-53   Nicotiana tomentosiformis
ref|XP_006364793.1|  PREDICTED: dehydrogenase/reductase SDR famil...    177   7e-53   
gb|EYU20811.1|  hypothetical protein MIMGU_mgv11b022665mg               178   1e-52   Erythranthe guttata [common monkey flower]
ref|XP_009794629.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    175   2e-52   Nicotiana sylvestris
gb|EYU20810.1|  hypothetical protein MIMGU_mgv1a011271mg                180   2e-52   Erythranthe guttata [common monkey flower]
gb|KGN54692.1|  hypothetical protein Csa_4G427280                       179   6e-52   Cucumis sativus [cucumbers]
ref|XP_006367340.1|  PREDICTED: probable L-xylulose reductase-like      178   9e-52   Solanum tuberosum [potatoes]
ref|XP_004144361.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    178   1e-51   
ref|XP_003632638.2|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    178   1e-51   
ref|XP_011075456.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    178   1e-51   
ref|NP_001062206.1|  Os08g0510400                                       177   1e-51   
ref|XP_004157996.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    178   2e-51   
ref|XP_009781380.1|  PREDICTED: L-xylulose reductase-like               177   2e-51   Nicotiana sylvestris
ref|XP_004144362.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    177   2e-51   
dbj|BAK03236.1|  predicted protein                                      177   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006302904.1|  hypothetical protein CARUB_v10021033mg             173   5e-51   
ref|XP_006364792.1|  PREDICTED: dehydrogenase/reductase SDR famil...    172   7e-51   
ref|XP_011075454.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    172   2e-49   
ref|XP_009596119.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    172   4e-49   Nicotiana tomentosiformis
ref|XP_009792301.1|  PREDICTED: dehydrogenase/reductase SDR famil...    166   5e-48   Nicotiana sylvestris
dbj|BAK02348.1|  predicted protein                                      168   7e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006850022.1|  hypothetical protein AMTR_s00022p00187970          168   1e-47   Amborella trichopoda
ref|XP_003574753.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    167   1e-47   Brachypodium distachyon [annual false brome]
ref|NP_001152499.1|  LOC100286139                                       167   3e-47   Zea mays [maize]
gb|KDO37848.1|  hypothetical protein CISIN_1g033624mg                   160   9e-47   Citrus sinensis [apfelsine]
gb|ACS12983.1|  2,4-dienoyl-CoA reductase                               165   1e-46   Jatropha curcas
tpg|DAA47976.1|  TPA: 3-oxoacyl-reductase                               164   3e-46   
ref|XP_008680945.1|  PREDICTED: LOC100286139 isoform X4                 164   3e-46   Zea mays [maize]
ref|XP_008680943.1|  PREDICTED: LOC100286139 isoform X3                 164   5e-46   Zea mays [maize]
ref|XP_008680941.1|  PREDICTED: LOC100286139 isoform X2                 164   7e-46   Zea mays [maize]
tpg|DAA47977.1|  TPA: hypothetical protein ZEAMMB73_585385              164   9e-46   
ref|XP_008680935.1|  PREDICTED: LOC100286139 isoform X1                 164   2e-45   Zea mays [maize]
ref|XP_002884088.1|  short-chain dehydrogenase/reductase family p...    160   6e-45   
ref|XP_006362945.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    159   1e-44   
ref|XP_006362944.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    159   1e-44   Solanum tuberosum [potatoes]
ref|XP_006362943.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    159   2e-44   Solanum tuberosum [potatoes]
pir||S39508  alcohol dehydrogenase homolog, ripening-related - to...    157   3e-44
ref|XP_006365822.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    153   5e-44   Solanum tuberosum [potatoes]
ref|XP_008340684.1|  PREDICTED: dehydrogenase/reductase SDR famil...    153   6e-44   
ref|XP_006364794.1|  PREDICTED: dehydrogenase/reductase SDR famil...    150   9e-43   
ref|XP_006299633.1|  hypothetical protein CARUB_v10015813mg             152   1e-42   
ref|XP_001760079.1|  predicted protein                                  153   3e-42   
ref|XP_006303027.1|  hypothetical protein CARUB_v10021183mg             147   9e-42   
gb|EAZ43296.1|  hypothetical protein OsJ_27892                          150   6e-41   Oryza sativa Japonica Group [Japonica rice]
gb|ABK21106.1|  unknown                                                 149   1e-40   Picea sitchensis
gb|EYU20809.1|  hypothetical protein MIMGU_mgv11b016674mg               146   2e-39   Erythranthe guttata [common monkey flower]
gb|ADE77298.1|  unknown                                                 144   2e-38   Picea sitchensis
ref|XP_006660269.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    141   6e-38   Oryza brachyantha
ref|XP_009391135.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    135   4e-37   
ref|XP_004174045.1|  PREDICTED: dehydrogenase/reductase SDR famil...    133   2e-36   
gb|EMS67034.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG         134   6e-35   Triticum urartu
gb|EMT10558.1|  3-oxoacyl-(acyl-carrier-protein) reductase 3, chl...    131   6e-35   
gb|KGN54696.1|  hypothetical protein Csa_4G429300                       129   1e-34   Cucumis sativus [cucumbers]
gb|KHN24253.1|  3-oxoacyl-[acyl-carrier-protein] reductase 1            127   9e-33   Glycine soja [wild soybean]
ref|XP_008351408.1|  PREDICTED: very-long-chain 3-oxoacyl-CoA red...    125   2e-32   
ref|XP_006303056.1|  hypothetical protein CARUB_v10021215mg             115   1e-29   
gb|EMS50889.1|  Gluconate 5-dehydrogenase                               119   1e-29   Triticum urartu
ref|XP_002974604.1|  hypothetical protein SELMODRAFT_101607             119   3e-29   
ref|XP_002963314.1|  hypothetical protein SELMODRAFT_80357              117   1e-28   
ref|XP_009139356.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    111   2e-26   
ref|XP_009599582.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    109   2e-26   
ref|XP_009599581.1|  PREDICTED: glucose and ribitol dehydrogenase...    109   3e-26   
emb|CBI32788.3|  unnamed protein product                                111   4e-26   Vitis vinifera
ref|XP_010091025.1|  hypothetical protein L484_005062                   103   1e-24   
ref|WP_016208602.1|  short-chain dehydrogenase/reductase SDR            106   1e-24   Clostridium sartagoforme
ref|WP_008679993.1|  short-chain dehydrogenase                          105   4e-24   Clostridium
ref|WP_010074325.1|  short-chain dehydrogenase                          105   4e-24   Clostridium cellulovorans
ref|WP_029011209.1|  2-deoxy-D-gluconate 3-dehydrogenase                103   2e-23   Azospirillum halopraeferens
ref|WP_014188226.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase      103   2e-23   Azospirillum lipoferum
ref|WP_029453556.1|  short-chain dehydrogenase                          100   1e-22   Clostridium algidicarnis
ref|WP_036097343.1|  short-chain dehydrogenase                          100   4e-22   Listeria floridensis
ref|WP_007184030.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase      100   4e-22   Hydrocarboniphaga effusa
ref|WP_020383780.1|  hypothetical protein                             99.8    5e-22   
ref|WP_028325262.1|  hypothetical protein                             99.0    8e-22   Desulfatirhabdium butyrativorans
ref|WP_043560423.1|  short-chain dehydrogenase                        98.6    1e-21   Actinomyces israelii
ref|WP_009470814.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase    98.6    1e-21   gamma proteobacterium HIMB55
ref|WP_031534413.1|  3-oxoacyl-ACP reductase                          97.1    4e-21   Bacillus
ref|WP_035150584.1|  short-chain dehydrogenase                        97.1    5e-21   Clostridium tetanomorphum
ref|WP_034727142.1|  2-deoxy-D-gluconate 3-dehydrogenase              97.1    5e-21   Idiomarina sediminum
ref|WP_012976744.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase    97.1    5e-21   Azospirillum lipoferum
emb|CAN59906.1|  hypothetical protein VITISV_033146                   94.0    6e-21   Vitis vinifera
ref|WP_042595473.1|  oxidoreductase                                   96.7    6e-21   Xanthomonas campestris
ref|WP_014871553.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase    96.7    7e-21   Marinobacter sp. BSs20148
ref|WP_015129205.1|  3-oxoacyl-(acyl-carrier-protein) reductase       96.3    8e-21   Calothrix sp. PCC 7507
ref|WP_027624622.1|  short-chain dehydrogenase                        95.9    1e-20   Clostridium lundense
ref|WP_011956226.1|  short-chain dehydrogenase                        95.5    1e-20   Roseiflexus sp. RS-1
ref|WP_010755678.1|  hypothetical protein                             95.5    2e-20   
gb|EEB79892.1|  NAD dependent epimerase/dehydratase family protein    95.5    2e-20   marine gamma proteobacterium HTCC2148
ref|WP_040540396.1|  2-deoxy-D-gluconate 3-dehydrogenase              95.5    2e-20   marine gamma proteobacterium HTCC2148
ref|WP_029654352.1|  2-deoxy-D-gluconate 3-dehydrogenase              95.1    2e-20   Marinobacter daepoensis
ref|WP_027626441.1|  short-chain dehydrogenase                        95.1    2e-20   Clostridium lundense
ref|WP_041865623.1|  2-deoxy-D-gluconate 3-dehydrogenase              92.4    2e-20   
gb|ACC80716.1|  short-chain dehydrogenase/reductase SDR               94.7    3e-20   Nostoc punctiforme PCC 73102
ref|WP_041565320.1|  short-chain dehydrogenase                        94.7    3e-20   Nostoc punctiforme
ref|WP_010742658.1|  hypothetical protein                             95.1    3e-20   Enterococcus malodoratus
ref|WP_042474704.1|  hypothetical protein                             94.7    3e-20   Agrobacterium rhizogenes
ref|WP_015084404.1|  MULTISPECIES: Mannopine oxidoreductase           94.7    3e-20   Agrobacterium
ref|WP_035612727.1|  2-deoxy-D-gluconate 3-dehydrogenase              94.7    3e-20   Hyphomonas johnsonii
ref|XP_002535226.1|  3-oxoacyl-[acyl-carrier-protein] reductase, ...  94.7    4e-20   
ref|WP_007686277.1|  gluconate 5-dehydrogenase                        92.4    4e-20   
ref|WP_043390303.1|  2-deoxy-D-gluconate 3-dehydrogenase              94.4    4e-20   
ref|WP_010868772.1|  3-oxoacyl-ACP reductase                          94.0    5e-20   
ref|WP_008511915.1|  dehydrogenase of unknown specificity             94.4    5e-20   
ref|WP_015475975.1|  Short-chain dehydrogenase/reductase SDR          94.0    5e-20   
ref|WP_010755635.1|  hypothetical protein                             94.0    6e-20   
ref|WP_042703793.1|  2-deoxy-D-gluconate 3-dehydrogenase              94.0    6e-20   
emb|CEA12535.1|  hypothetical protein DSM1535_0170                    94.0    6e-20   
ref|WP_017194787.1|  short-chain dehydrogenase                        94.0    7e-20   
ref|WP_004069951.1|  3-oxoacyl-ACP reductase                          93.6    7e-20   
gb|EKD87242.1|  3-oxoacyl-(acyl-carrier protein) reductase            93.6    8e-20   
ref|WP_019669375.1|  hypothetical protein                             93.6    9e-20   
ref|WP_008729966.1|  short-chain dehydrogenase                        93.6    9e-20   
gb|AEI30451.1|  short-chain dehydrogenase/reductase SDR               92.8    9e-20   
ref|WP_008518514.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase    93.2    1e-19   
ref|WP_038586158.1|  short-chain dehydrogenase                        93.2    1e-19   
ref|WP_028398980.1|  3-oxoacyl-ACP reductase                          92.8    1e-19   
ref|WP_042698363.1|  3-oxoacyl-ACP reductase                          92.8    1e-19   
ref|WP_041322365.1|  short-chain dehydrogenase                        92.8    1e-19   
ref|WP_003448266.1|  3-oxoacyl-acyl-carrier protein reductase         92.8    1e-19   
ref|WP_041386398.1|  2-deoxy-D-gluconate 3-dehydrogenase              92.8    2e-19   
ref|WP_015324746.1|  dehydrogenase of unknown specificity, short-...  92.8    2e-19   
ref|WP_035150039.1|  short-chain dehydrogenase                        92.8    2e-19   
ref|WP_034521212.1|  hypothetical protein                             92.0    2e-19   
dbj|BAI96705.1|  gluconate 5-dehydrogenase                            92.8    2e-19   
ref|WP_017151236.1|  3-ketoacyl-ACP reductase                         92.4    2e-19   
ref|WP_034635730.1|  3-oxoacyl-ACP reductase                          92.4    2e-19   
ref|WP_035456433.1|  short-chain dehydrogenase                        92.4    2e-19   
ref|WP_008083837.1|  3-oxoacyl-ACP reductase                          92.4    2e-19   
ref|WP_012997382.1|  3-oxoacyl-ACP reductase                          92.4    2e-19   
ref|WP_000911789.1|  3-ketoacyl-ACP reductase                         92.4    2e-19   
ref|WP_013748401.1|  3-oxoacyl-ACP reductase                          92.0    3e-19   
ref|WP_018392315.1|  3-ketoacyl-ACP reductase                         92.0    3e-19   
ref|WP_029639446.1|  short-chain dehydrogenase                        92.0    3e-19   
ref|WP_037011110.1|  2-deoxy-D-gluconate 3-dehydrogenase              92.0    3e-19   
ref|WP_038803250.1|  2-deoxy-D-gluconate 3-dehydrogenase              92.0    3e-19   
ref|WP_013106046.1|  putative Short-chain dehydrogenase/reductase...  92.0    3e-19   
ref|WP_013123285.1|  short-chain dehydrogenase                        92.0    3e-19   
ref|WP_014265275.1|  3-ketoacyl-ACP reductase                         91.7    3e-19   
emb|CDW95922.1|  Gluconate 5-dehydrogenase                            92.0    3e-19   
ref|WP_004030223.1|  short-chain dehydrogenase                        92.0    3e-19   
ref|WP_016201081.1|  3-ketoacyl-(acyl-carrier-protein) reductase      91.7    4e-19   
ref|WP_042577127.1|  short-chain dehydrogenase                        91.7    4e-19   
ref|WP_044337426.1|  3-oxoacyl-ACP reductase                          91.7    4e-19   
ref|WP_010806061.1|  short chain dehydrogenase                        91.7    4e-19   
ref|WP_033672120.1|  3-oxoacyl-ACP reductase                          91.3    4e-19   
ref|WP_011334166.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase    91.7    4e-19   
ref|WP_002111388.1|  3-ketoacyl-ACP reductase                         91.3    4e-19   
ref|WP_027865407.1|  MULTISPECIES: short-chain dehydrogenase          91.7    5e-19   
ref|WP_013273319.1|  short-chain dehydrogenase [                      91.7    5e-19   
ref|WP_039834109.1|  short-chain dehydrogenase                        91.3    5e-19   
ref|WP_039768484.1|  2-deoxy-D-gluconate 3-dehydrogenase              91.3    5e-19   
ref|WP_015052632.1|  short-chain dehydrogenase                        91.3    5e-19   
ref|WP_013540776.1|  short-chain dehydrogenase                        91.3    5e-19   
ref|WP_007911087.1|  2-deoxy-D-gluconate 3-dehydrogenase              91.3    5e-19   
ref|WP_034285576.1|  3-oxoacyl-ACP reductase                          91.3    5e-19   
ref|WP_019393420.1|  hypothetical protein                             90.9    6e-19   
gb|KFC75759.1|  Gluconate 5-dehydrogenase Gno                         91.3    6e-19   
ref|WP_035857197.1|  short-chain dehydrogenase                        90.9    7e-19   
ref|WP_012094945.1|  3-ketoacyl-ACP reductase                         90.9    7e-19   
ref|WP_016718306.1|  3-ketoacyl-ACP reductase                         90.9    7e-19   
gb|EFE96322.1|  oxidoreductase, short chain dehydrogenase/reducta...  89.7    8e-19   
ref|WP_037542026.1|  2-deoxy-D-gluconate 3-dehydrogenase              90.9    8e-19   
gb|EFH82991.1|  short-chain dehydrogenase/reductase SDR               90.9    8e-19   
ref|WP_016096226.1|  3-oxoacyl-[acyl-carrier-protein] reductase       90.5    8e-19   
ref|WP_002137946.1|  3-ketoacyl-ACP reductase                         90.5    8e-19   
ref|WP_043818185.1|  short-chain dehydrogenase                        90.9    8e-19   
ref|WP_010105999.1|  short-chain dehydrogenase                        90.9    8e-19   
ref|WP_035034113.1|  short-chain dehydrogenase                        90.9    8e-19   
ref|WP_002014514.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           90.5    8e-19   
ref|WP_037029863.1|  short-chain dehydrogenase                        90.9    9e-19   
ref|WP_006514312.1|  dehydrogenase of unknown specificity             90.5    9e-19   
ref|WP_002165156.1|  3-ketoacyl-ACP reductase                         90.5    9e-19   
ref|WP_042116489.1|  short-chain dehydrogenase                        90.5    9e-19   
ref|WP_040327281.1|  short-chain dehydrogenase                        90.5    9e-19   
ref|WP_002146085.1|  3-ketoacyl-ACP reductase                         90.5    9e-19   
ref|WP_011196426.1|  2-deoxy-D-gluconate 3-dehydrogenase              90.5    1e-18   
ref|WP_039629897.1|  short-chain dehydrogenase                        90.5    1e-18   
ref|WP_027288859.1|  2-deoxy-D-gluconate 3-dehydrogenase              90.5    1e-18   
ref|WP_036151163.1|  3-oxoacyl-ACP reductase                          90.1    1e-18   
ref|WP_036245901.1|  short-chain dehydrogenase                        90.5    1e-18   
ref|WP_026590300.1|  3-oxoacyl-ACP reductase                          90.1    1e-18   
ref|WP_011565720.1|  short-chain dehydrogenase/reductase SDR          90.1    1e-18   
ref|WP_016092226.1|  3-oxoacyl-[acyl-carrier-protein] reductase       90.1    1e-18   
ref|WP_034221259.1|  3-oxoacyl-ACP reductase                          90.1    1e-18   
gb|EIZ03706.1|  short chain dehydrogenase                             90.5    1e-18   
ref|WP_035489207.1|  2-deoxy-D-gluconate 3-dehydrogenase              90.1    1e-18   
ref|WP_036778616.1|  3-oxoacyl-ACP reductase                          90.1    1e-18   
ref|WP_016135247.1|  3-oxoacyl-[acyl-carrier-protein] reductase       89.7    2e-18   
ref|WP_016086597.1|  3-oxoacyl-[acyl-carrier-protein] reductase       89.7    2e-18   
ref|WP_007879787.1|  oxidoreductase                                   89.7    2e-18   
ref|WP_001980554.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           89.7    2e-18   
ref|WP_040058092.1|  oxidoreductase                                   89.7    2e-18   
ref|WP_017233311.1|  short-chain dehydrogenase                        89.7    2e-18   
ref|WP_008083174.1|  3-oxoacyl-ACP reductase                          89.7    2e-18   
emb|CDX91138.1|  BnaC02g04590D                                        88.2    2e-18   
ref|WP_041099924.1|  3-oxoacyl-ACP reductase                          89.7    2e-18   
ref|WP_034200318.1|  2-deoxy-D-gluconate 3-dehydrogenase              89.7    2e-18   
ref|WP_039374134.1|  short-chain dehydrogenase                        89.7    2e-18   
emb|CDX69242.1|  BnaC01g02110D                                        89.7    2e-18   
ref|WP_007834461.1|  short-chain dehydrogenase                        89.7    2e-18   
ref|WP_034488491.1|  short-chain dehydrogenase                        90.1    2e-18   
ref|WP_025645171.1|  short-chain dehydrogenase                        89.7    2e-18   
ref|WP_013084812.1|  3-ketoacyl-ACP reductase                         89.7    2e-18   
ref|WP_002173110.1|  3-ketoacyl-ACP reductase                         89.7    2e-18   
ref|WP_002160731.1|  3-ketoacyl-ACP reductase                         89.7    2e-18   
ref|WP_043878380.1|  short-chain dehydrogenase                        89.4    2e-18   
ref|WP_034755715.1|  3-oxoacyl-ACP reductase                          89.7    2e-18   
ref|WP_022095948.1|  hypothetical protein                             89.7    2e-18   
ref|WP_016106004.1|  3-oxoacyl-[acyl-carrier-protein] reductase       89.4    2e-18   
gb|EAS47322.1|  Short-chain dehydrogenase/reductase SDR               89.7    2e-18   
ref|WP_023595499.1|  MULTISPECIES: short-chain dehydrogenase          89.7    2e-18   
ref|WP_015283717.1|  dehydrogenase of unknown specificity, short-...  89.4    2e-18   
gb|EDT47591.1|  oxidoreductase, short chain dehydrogenase/reducta...  89.4    2e-18   
ref|WP_003462994.1|  3-oxoacyl-ACP reductase                          89.4    2e-18   
ref|WP_007742503.1|  dehydrogenase/ reductase 6                       89.4    2e-18   
ref|WP_016115974.1|  MULTISPECIES: 3-oxoacyl-[acyl-carrier-protei...  89.4    2e-18   
ref|WP_020606445.1|  hypothetical protein                             89.4    2e-18   
ref|WP_036650969.1|  3-oxoacyl-ACP reductase                          89.4    2e-18   
ref|WP_025909019.1|  3-oxoacyl-ACP reductase                          89.4    2e-18   
ref|WP_003259662.1|  3-oxoacyl-ACP reductase                          87.8    2e-18   
ref|WP_025703908.1|  short-chain dehydrogenase                        89.4    2e-18   
ref|WP_031514713.1|  short-chain dehydrogenase                        89.4    2e-18   
ref|WP_026081584.1|  short-chain dehydrogenase                        89.4    2e-18   
ref|WP_035594398.1|  2-deoxy-D-gluconate 3-dehydrogenase              89.4    2e-18   
ref|WP_044004907.1|  3-ketoacyl-ACP reductase                         89.4    3e-18   
ref|WP_034986566.1|  short-chain dehydrogenase                        89.4    3e-18   
ref|WP_042625060.1|  3-oxoacyl-ACP reductase                          89.4    3e-18   
ref|WP_000911770.1|  3-ketoacyl-ACP reductase                         89.4    3e-18   
ref|WP_000911769.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           89.4    3e-18   
gb|ADO35343.1|  hypothetical protein ELI_0324                         89.4    3e-18   
ref|WP_044293521.1|  short-chain dehydrogenase                        89.4    3e-18   
ref|WP_041689800.1|  short-chain dehydrogenase                        89.4    3e-18   
ref|WP_038351904.1|  short-chain dehydrogenase                        89.4    3e-18   
ref|WP_000911768.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           89.0    3e-18   
ref|WP_044402016.1|  short-chain dehydrogenase                        89.4    3e-18   
ref|WP_013697747.1|  short-chain dehydrogenase                        89.4    3e-18   
ref|WP_042218909.1|  short-chain dehydrogenase                        89.0    3e-18   
ref|WP_042361348.1|  3-ketoacyl-ACP reductase                         89.0    3e-18   
ref|WP_035412773.1|  3-oxoacyl-ACP reductase                          89.0    3e-18   
ref|WP_009795394.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           89.0    3e-18   
ref|WP_004133514.1|  clavaldehyde dehydrogenase                       89.0    3e-18   
ref|WP_035340522.1|  3-oxoacyl-ACP reductase                          89.0    3e-18   
ref|WP_011901860.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase    89.0    3e-18   
ref|WP_025698365.1|  peptide synthetase                               92.8    4e-18   
ref|WP_039967386.1|  2-deoxy-D-gluconate 3-dehydrogenase              89.0    4e-18   
ref|WP_024030208.1|  3-ketoacyl-(acyl-carrier-protein) reductase      89.0    4e-18   
ref|WP_013841011.1|  short-chain dehydrogenase                        89.0    4e-18   
ref|WP_044737556.1|  3-oxoacyl-ACP reductase                          88.6    4e-18   
ref|WP_012998869.1|  gluconate 5-dehydrogenase                        89.0    4e-18   
ref|WP_000911788.1|  hypothetical protein                             88.6    4e-18   
ref|WP_038098197.1|  2-deoxy-D-gluconate 3-dehydrogenase              88.6    4e-18   
ref|WP_036181655.1|  3-oxoacyl-ACP reductase                          88.6    4e-18   
ref|WP_033184449.1|  hypothetical protein                             87.8    4e-18   
ref|WP_013260315.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase    88.6    4e-18   
ref|WP_000911777.1|  3-ketoacyl-ACP reductase                         88.6    4e-18   
ref|WP_000911778.1|  3-ketoacyl-ACP reductase                         88.6    4e-18   
ref|WP_000911780.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           88.6    4e-18   
ref|WP_008906244.1|  short-chain dehydrogenase                        89.0    4e-18   
ref|WP_033043596.1|  2-deoxy-D-gluconate 3-dehydrogenase              88.6    4e-18   
ref|WP_000911779.1|  3-ketoacyl-ACP reductase                         88.6    4e-18   
ref|WP_025098705.1|  MULTISPECIES: short-chain dehydrogenase          88.6    4e-18   
ref|WP_011195581.1|  3-ketoacyl-ACP reductase                         88.6    4e-18   
ref|WP_000911790.1|  3-ketoacyl-ACP reductase                         88.6    4e-18   
ref|WP_000911781.1|  3-ketoacyl-ACP reductase                         88.6    5e-18   
ref|WP_039696817.1|  short-chain dehydrogenase                        88.6    5e-18   
ref|WP_017332560.1|  short-chain dehydrogenase                        88.6    5e-18   
ref|WP_000911785.1|  3-ketoacyl-ACP reductase                         88.6    5e-18   
ref|WP_040070591.1|  glucose dehydrogenase                            88.6    5e-18   
ref|WP_000911784.1|  3-ketoacyl-ACP reductase                         88.6    5e-18   
ref|WP_033162614.1|  hypothetical protein                             88.6    5e-18   
ref|WP_015876147.1|  short-chain dehydrogenase                        88.6    5e-18   
ref|WP_013058906.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           88.6    5e-18   
ref|WP_042979429.1|  3-oxoacyl-ACP reductase                          88.6    5e-18   
ref|WP_019651975.1|  short-chain dehydrogenase                        88.6    5e-18   
ref|WP_026435146.1|  short-chain dehydrogenase                        88.6    5e-18   
ref|WP_020797733.1|  Short-chain dehydrogenase/reductase SDR          88.6    5e-18   
ref|WP_037126379.1|  oxidoreductase                                   88.6    5e-18   
ref|WP_016080521.1|  MULTISPECIES: 3-oxoacyl-[acyl-carrier-protei...  88.6    5e-18   
ref|WP_000911766.1|  3-ketoacyl-ACP reductase                         88.6    5e-18   
ref|WP_015014335.1|  short-chain dehydrogenase                        88.6    5e-18   
ref|WP_000911775.1|  3-ketoacyl-ACP reductase                         88.2    5e-18   
ref|WP_006011566.1|  3-oxoacyl-[acyl-carrier-protein] reductase       88.6    5e-18   
ref|WP_044456160.1|  short-chain dehydrogenase                        88.6    5e-18   
ref|WP_042140758.1|  short-chain dehydrogenase                        88.6    5e-18   
ref|WP_000911774.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           88.2    5e-18   
ref|WP_039411923.1|  short-chain dehydrogenase                        88.6    5e-18   
ref|WP_014809844.1|  2-deoxy-D-gluconate 3-dehydrogenase              88.6    5e-18   
ref|WP_042424543.1|  short-chain dehydrogenase                        88.6    6e-18   
ref|WP_036581052.1|  3-oxoacyl-ACP reductase                          88.6    6e-18   
ref|WP_019365713.1|  oxidoreductase                                   88.2    6e-18   
ref|WP_005794672.1|  short-chain dehydrogenase                        88.6    6e-18   
ref|WP_028394590.1|  3-oxoacyl-ACP reductase                          88.2    6e-18   
ref|WP_039397683.1|  short-chain dehydrogenase                        88.6    6e-18   
ref|WP_010798271.1|  hypothetical protein                             88.2    6e-18   
ref|WP_000911773.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           88.2    6e-18   
ref|WP_010465470.1|  short-chain dehydrogenase                        88.6    6e-18   
ref|WP_000911771.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           88.2    6e-18   
ref|WP_000911767.1|  3-ketoacyl-ACP reductase                         88.2    6e-18   
ref|WP_011465294.1|  short-chain dehydrogenase                        88.2    6e-18   
ref|WP_000911772.1|  3-ketoacyl-ACP reductase                         88.2    6e-18   
ref|WP_007650114.1|  3-oxoacyl-[acyl-carrier protein] reductase       88.2    6e-18   
ref|WP_016485843.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase    88.2    6e-18   
ref|WP_000911782.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           88.2    6e-18   
ref|WP_038908829.1|  short-chain dehydrogenase                        88.2    6e-18   
ref|WP_000911776.1|  3-ketoacyl-ACP reductase                         88.2    7e-18   
ref|WP_042209191.1|  peptide synthetase                               92.0    7e-18   
ref|WP_015155292.1|  short-chain dehydrogenase/reductase SDR          88.2    7e-18   
ref|WP_042875443.1|  3-oxoacyl-ACP reductase                          88.2    7e-18   
ref|WP_007672895.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase    88.2    7e-18   
ref|WP_009550255.1|  short-chain dehydrogenase                        88.2    7e-18   
ref|WP_038905378.1|  short-chain dehydrogenase                        88.2    7e-18   
ref|WP_000911783.1|  3-ketoacyl-ACP reductase                         88.2    7e-18   
ref|WP_012748386.1|  short-chain dehydrogenase                        88.2    7e-18   
ref|WP_043285323.1|  2-deoxy-D-gluconate 3-dehydrogenase              88.2    7e-18   
ref|WP_010649671.1|  oxidoreductase                                   87.8    7e-18   
ref|WP_001984793.1|  3-ketoacyl-ACP reductase                         87.8    7e-18   
ref|WP_036592069.1|  peptide synthetase                               92.0    8e-18   
ref|WP_002121805.1|  3-ketoacyl-ACP reductase                         87.8    8e-18   
ref|WP_013467102.1|  3-oxoacyl-ACP reductase                          87.8    8e-18   
ref|WP_039162335.1|  oxidoreductase                                   87.8    8e-18   
ref|WP_036991523.1|  2-deoxy-D-gluconate 3-dehydrogenase              87.8    8e-18   



>ref|XP_009588398.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Nicotiana tomentosiformis]
Length=288

 Score =   244 bits (622),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 152/178 (85%), Gaps = 7/178 (4%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME+  KVA  LEPWRELTGKV M+TGASSGIGRE  L+L+++GCR+IAAARRVDRLKSLC
Sbjct  1    MENHAKVACQLEPWRELTGKVVMITGASSGIGREFCLNLSRSGCRIIAAARRVDRLKSLC  60

Query  189  DEINGVGSGT-------PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRG  347
            DEING  S +        +RAVAIELDVSA+GP IEAAVQ+AWDAFGRIDAL+NNAGVRG
Sbjct  61   DEINGFSSNSNESSLTQEVRAVAIELDVSANGPIIEAAVQKAWDAFGRIDALVNNAGVRG  120

Query  348  RVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             VH+PLDL+EEEW+++ +TNL G WLVSKYVC+RM +A  GGS++NISSI+GLNRGQL
Sbjct  121  SVHSPLDLSEEEWDNIYRTNLKGAWLVSKYVCIRMRDANQGGSVINISSIAGLNRGQL  178



>gb|EYU20812.1| hypothetical protein MIMGU_mgv1a011359mg [Erythranthe guttata]
Length=284

 Score =   241 bits (614),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 144/174 (83%), Gaps = 3/174 (2%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME R +VA  LEPWR L  KV +VTGASSG GRE  LDLAKAGCRV+AAARR DRL+SLC
Sbjct  1    MEGRSQVASELEPWRRLENKVVLVTGASSGFGREFCLDLAKAGCRVVAAARRTDRLQSLC  60

Query  189  DEINGVGSGTP---LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHT  359
            DEING G G+P    RA A+ELDVSA GP IEA+VQ+AW AFGRIDALINNAG+RG++HT
Sbjct  61   DEINGAGIGSPEHQPRAAAVELDVSASGPTIEASVQKAWAAFGRIDALINNAGIRGKIHT  120

Query  360  PLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            PLDLTEEEW+   +TNLTGTWLVSKYVC RM +AK  GS+V+ISSI+GL RGQL
Sbjct  121  PLDLTEEEWDITMRTNLTGTWLVSKYVCTRMRDAKISGSLVSISSIAGLERGQL  174



>emb|CDP06201.1| unnamed protein product [Coffea canephora]
Length=285

 Score =   240 bits (612),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 151/172 (88%), Gaps = 6/172 (3%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +VA  LEPW EL GKV MVTGASSG+G++  LDLAKAGC++IAAARR+DRL++LCDEIN 
Sbjct  4    EVASRLEPWHELRGKVVMVTGASSGLGKDFCLDLAKAGCKIIAAARRIDRLETLCDEINR  63

Query  204  VG-----SGTP-LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPL  365
            +      SGT  LRAV IELDVS++GPAIEAAVQ+AWDAFGRIDAL+NNAGVRGR+HTPL
Sbjct  64   MSFNSDESGTSELRAVPIELDVSSNGPAIEAAVQKAWDAFGRIDALVNNAGVRGRLHTPL  123

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            DL+EEEWN++ KTNLTGTWLVSKYVC+RM +AK GG ++NISSISGLNRGQL
Sbjct  124  DLSEEEWNNIIKTNLTGTWLVSKYVCIRMRDAKQGGCVINISSISGLNRGQL  175



>emb|CDP20582.1| unnamed protein product [Coffea canephora]
Length=285

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 148/172 (86%), Gaps = 6/172 (3%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +VA  L+PW+EL GKV MVTGASSG+G+E  LDLAKAGC++IAAARR+DRL++LCDEIN 
Sbjct  4    QVASRLKPWQELRGKVVMVTGASSGLGKEFCLDLAKAGCKIIAAARRIDRLETLCDEINR  63

Query  204  VGSGT------PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPL  365
            +   +       LRA+ I+LDVSADGPAIEA VQ+AWDAFGRIDAL+NNAGVRGRVHTPL
Sbjct  64   MSFNSDESKTSELRAMPIKLDVSADGPAIEADVQKAWDAFGRIDALVNNAGVRGRVHTPL  123

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            DL+EEEWN++ KT+LTGTWLVSKYVC+ M +AK GG ++NISSI+GL+RGQL
Sbjct  124  DLSEEEWNNIIKTDLTGTWLVSKYVCIHMRDAKQGGCVINISSIAGLDRGQL  175



>ref|XP_006339259.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Solanum tuberosum]
Length=290

 Score =   228 bits (582),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 144/180 (80%), Gaps = 9/180 (5%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME+  +V R LEPW EL GKV ++TGASSGIGRE  LDL+KAGCR+IAAARR+DRLKSLC
Sbjct  1    MENHAEVGRQLEPWGELAGKVVLITGASSGIGREFCLDLSKAGCRIIAAARRIDRLKSLC  60

Query  189  DEINGVGSGTP---------LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGV  341
            DEING+ S +          LRAVAIELDVSA+G AIEAAVQ+AW+AFGRID L+NNAG+
Sbjct  61   DEINGISSNSSIESTISSQELRAVAIELDVSANGAAIEAAVQKAWNAFGRIDVLVNNAGI  120

Query  342  RGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            RG VH+PL+L+EEEW  +  TNL G WLV+KYVC+ M  A  GGS++NISS +GLNRG+L
Sbjct  121  RGSVHSPLNLSEEEWEKIYNTNLRGAWLVTKYVCIHMRAANQGGSVINISSTAGLNRGKL  180



>ref|XP_011079072.1| PREDICTED: estradiol 17-beta-dehydrogenase 8-like isoform X1 
[Sesamum indicum]
Length=299

 Score =   228 bits (580),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 5/175 (3%)
 Frame = +3

Query  12   ESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCD  191
            ESR +VA  LEPW EL  K+ MVTGASSG GRE  LDLA+AGC+V+AAARRVDRL+ LCD
Sbjct  3    ESRGQVASSLEPWLELKNKIVMVTGASSGRGREFCLDLAEAGCKVVAAARRVDRLRLLCD  62

Query  192  EIN-GVGSGTP----LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVH  356
            EIN G+GS  P     RAVA+ELDV+A GP I AAV++AW AFGRIDALINNAGVRG VH
Sbjct  63   EINNGIGSNKPGPDRARAVAVELDVNASGPIINAAVEKAWGAFGRIDALINNAGVRGSVH  122

Query  357  TPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            +PLDL+E+EWND+ +TNLTGTWLVSKYVC RM  A+ GGS++NISS +GLNRGQL
Sbjct  123  SPLDLSEDEWNDIIRTNLTGTWLVSKYVCSRMRYAQQGGSVINISSTAGLNRGQL  177



>ref|XP_011079073.1| PREDICTED: estradiol 17-beta-dehydrogenase 8-like isoform X2 
[Sesamum indicum]
Length=284

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 5/175 (3%)
 Frame = +3

Query  12   ESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCD  191
            ESR +VA  LEPW EL  K+ MVTGASSG GRE  LDLA+AGC+V+AAARRVDRL+ LCD
Sbjct  3    ESRGQVASSLEPWLELKNKIVMVTGASSGRGREFCLDLAEAGCKVVAAARRVDRLRLLCD  62

Query  192  EIN-GVGSGTP----LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVH  356
            EIN G+GS  P     RAVA+ELDV+A GP I AAV++AW AFGRIDALINNAGVRG VH
Sbjct  63   EINNGIGSNKPGPDRARAVAVELDVNASGPIINAAVEKAWGAFGRIDALINNAGVRGSVH  122

Query  357  TPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            +PLDL+E+EWND+ +TNLTGTWLVSKYVC RM  A+ GGS++NISS +GLNRGQL
Sbjct  123  SPLDLSEDEWNDIIRTNLTGTWLVSKYVCSRMRYAQQGGSVINISSTAGLNRGQL  177



>ref|XP_010653621.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
[Vitis vinifera]
Length=286

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 147/173 (85%), Gaps = 7/173 (4%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +VA HLEPW++L GKV MVTGASSG+G E  L+LAKAGC+++AAARRVDRLKSLCDEIN 
Sbjct  4    QVANHLEPWQDLEGKVVMVTGASSGLGSEFCLNLAKAGCKIVAAARRVDRLKSLCDEINN  63

Query  204  V-------GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTP  362
            +        +  PLRAVA+ELDV++DG +I A+VQ+AW+AFGRIDAL+NNAG+RG V++P
Sbjct  64   LTHSNLPPNADPPLRAVAVELDVTSDGSSIGASVQKAWEAFGRIDALLNNAGIRGNVNSP  123

Query  363  LDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LD++EEEWN+  KTNLTG+WLVSKYV +RM +AK GGSI+NISSI+ LNRGQL
Sbjct  124  LDISEEEWNNTLKTNLTGSWLVSKYVGMRMRDAKNGGSIINISSIAALNRGQL  176



>emb|CAN64848.1| hypothetical protein VITISV_036158 [Vitis vinifera]
Length=286

 Score =   225 bits (574),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 146/173 (84%), Gaps = 7/173 (4%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +VA HLEPW++L GKV MVTGASSG+G E  L+LAKAGC+++AAARRVDRLKSLCDEIN 
Sbjct  4    QVANHLEPWQDLEGKVVMVTGASSGLGSEFCLNLAKAGCKIVAAARRVDRLKSLCDEINN  63

Query  204  VGSGT-------PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTP  362
            +           PLRAVA+ELDV++DG +I A+VQ+AW+AFGRIDAL+NNAG+RG V++P
Sbjct  64   LTHSNLPPNDDPPLRAVAVELDVTSDGSSIGASVQKAWEAFGRIDALLNNAGIRGNVNSP  123

Query  363  LDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LD++EEEWN+  KTNLTG+WLVSKYV LRM +AK GGSI+NISSI+ LNRGQL
Sbjct  124  LDISEEEWNNTLKTNLTGSWLVSKYVGLRMRDAKNGGSIINISSIAALNRGQL  176



>ref|XP_011075453.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=312

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 144/178 (81%), Gaps = 8/178 (4%)
 Frame = +3

Query  12   ESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCD  191
            ESR +V   LEPW EL  KV MVTGASSG+GR   LDLAKAGCR+IAAARR+DRL SLC+
Sbjct  25   ESRTEVGNSLEPWFELNDKVVMVTGASSGLGRGFCLDLAKAGCRIIAAARRIDRLHSLCE  84

Query  192  EIN----GVGSGTPL----RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRG  347
            EIN       S  P     RA+A+ELDV+A GP IEA+VQ+AWDAFGRIDALINNAGVRG
Sbjct  85   EINNRSGSASSSVPTQIQPRALAVELDVTASGPIIEASVQKAWDAFGRIDALINNAGVRG  144

Query  348  RVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             VHTPLDLTE+EWND+ +TNLTGTWLVSK+VC  M +AK GGS++NISSI+GL+RGQL
Sbjct  145  SVHTPLDLTEDEWNDIIRTNLTGTWLVSKHVCRLMRDAKRGGSVINISSIAGLDRGQL  202



>ref|XP_011075452.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=313

 Score =   226 bits (575),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 144/178 (81%), Gaps = 8/178 (4%)
 Frame = +3

Query  12   ESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCD  191
            ESR +V   LEPW EL  KV MVTGASSG+GR   LDLAKAGCR+IAAARR+DRL SLC+
Sbjct  25   ESRTEVGNSLEPWFELNDKVVMVTGASSGLGRGFCLDLAKAGCRIIAAARRIDRLHSLCE  84

Query  192  EIN----GVGSGTPL----RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRG  347
            EIN       S  P     RA+A+ELDV+A GP IEA+VQ+AWDAFGRIDALINNAGVRG
Sbjct  85   EINNRSGSASSSVPTQIQPRALAVELDVTASGPIIEASVQKAWDAFGRIDALINNAGVRG  144

Query  348  RVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             VHTPLDLTE+EWND+ +TNLTGTWLVSK+VC  M +AK GGS++NISSI+GL+RGQL
Sbjct  145  SVHTPLDLTEDEWNDIIRTNLTGTWLVSKHVCRLMRDAKRGGSVINISSIAGLDRGQL  202



>ref|XP_006430532.1| hypothetical protein CICLE_v10012408mg [Citrus clementina]
 gb|ESR43772.1| hypothetical protein CICLE_v10012408mg [Citrus clementina]
Length=204

 Score =   220 bits (561),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 140/169 (83%), Gaps = 3/169 (2%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V+ HLEPW +L  KV MVTGASSG+GRE  LDLAKAGCR++AAARRVDRLKSLCDEIN 
Sbjct  4    QVSDHLEPWHDLNEKVVMVTGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINK  63

Query  204  ---VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
               VGS   +RAVA+ELDV AD   IE +VQ+AW+AFGR+DAL+NNAG+RG V +PL+++
Sbjct  64   PGMVGSPDSVRAVAVELDVCADAATIEISVQKAWEAFGRVDALVNNAGIRGSVKSPLEMS  123

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEWN + KTNLTG WLV+KYVC+RM +AK GGS++NISS  GLNRG L
Sbjct  124  EEEWNRVMKTNLTGCWLVAKYVCIRMRDAKQGGSVINISSTGGLNRGHL  172



>ref|XP_004249318.1| PREDICTED: D-erythrulose reductase-like [Solanum lycopersicum]
Length=290

 Score =   223 bits (568),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 143/180 (79%), Gaps = 9/180 (5%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME+  +V R LEPW EL GKV MVTGASSGIGREI +DL+KAGCR+IAAARR+DRL SLC
Sbjct  1    MENHAEVRRQLEPWGELAGKVVMVTGASSGIGREICVDLSKAGCRIIAAARRIDRLNSLC  60

Query  189  DEINGVGSGTP---------LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGV  341
            DEING+ S +          ++AVAIELDVSA+  AIEAAVQ+AW+AFGRID L+NNAG+
Sbjct  61   DEINGISSNSSNESTISSQEIQAVAIELDVSANDAAIEAAVQKAWNAFGRIDVLVNNAGI  120

Query  342  RGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            RG VH+PL+L+EEEW  +  TNL G WLV+KYVC+ M  A  GGS++NISS +GLNRG+L
Sbjct  121  RGSVHSPLNLSEEEWEKIYNTNLRGAWLVTKYVCIHMRAANQGGSVINISSTAGLNRGKL  180



>ref|XP_006482062.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Citrus sinensis]
Length=282

 Score =   223 bits (567),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V+ HLEPW +L  KV MVTGASSG+GRE  LDLAKAGCR++AAARRVDRLKSLCDEIN 
Sbjct  4    QVSDHLEPWHDLNEKVVMVTGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINK  63

Query  204  ---VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
               VGS   +RAVA+ELDV ADG  IE +VQ+AW+AFGR+DAL+NNAG+RG V +PL+++
Sbjct  64   PGTVGSPDSVRAVAVELDVCADGATIEISVQKAWEAFGRVDALVNNAGIRGNVKSPLEMS  123

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEWN + KTNLTG WLV+KYVC+RM +AK GGS++NISS  GLNRG L
Sbjct  124  EEEWNRVVKTNLTGCWLVAKYVCIRMRDAKQGGSVINISSTGGLNRGHL  172



>gb|AAN32641.1|AF416732_1 putative short-chain type alcohol dehydrogenase [Solanum tuberosum]
Length=290

 Score =   223 bits (567),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 140/180 (78%), Gaps = 9/180 (5%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME   K  R LEPW EL GKV MVTGASSGIGR+   DL+KAGCR+IAAARR+DRLKSLC
Sbjct  1    MEKHAKSVRQLEPWGELAGKVVMVTGASSGIGRDFCSDLSKAGCRIIAAARRIDRLKSLC  60

Query  189  DEINGVG---------SGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGV  341
            DEING+          S   LRAVAIELDVSA+G +IEAAVQ+AW+AFGRID L+NNAG+
Sbjct  61   DEINGIKLEFLIESTISSQELRAVAIELDVSANGASIEAAVQKAWNAFGRIDVLVNNAGI  120

Query  342  RGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            RG VH+PL+L+EEEW  +  TNL G WLV+KYVC+ M  A  GG+++NISS +GLNRG+L
Sbjct  121  RGSVHSPLNLSEEEWEKIYNTNLRGAWLVTKYVCIHMRAANQGGTVINISSTAGLNRGKL  180



>gb|EYU18609.1| hypothetical protein MIMGU_mgv1a011131mg [Erythranthe guttata]
Length=291

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 143/179 (80%), Gaps = 9/179 (5%)
 Frame = +3

Query  12   ESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCD  191
            ESR  V+  LEPW EL  KV MVTGASSG+GR+  LDLAKAGCR+IAAARR+DRL+SLCD
Sbjct  3    ESRNHVSSSLEPWLELRNKVVMVTGASSGLGRDFCLDLAKAGCRIIAAARRIDRLQSLCD  62

Query  192  EINGVGSGT---------PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVR  344
            EIN   +G+           RAVA+ELDVSA G  IEA+VQ+AWDAFGRIDALINNAGVR
Sbjct  63   EINNGAAGSTRSNEPSRVQPRAVAVELDVSAGGATIEASVQKAWDAFGRIDALINNAGVR  122

Query  345  GRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            G VHTPL+L E+EWN++ +TN TG WLVSKYVC  M +AK GGS+VNISSI+GLNRGQL
Sbjct  123  GSVHTPLNLREDEWNEIVRTNQTGAWLVSKYVCSHMRDAKQGGSVVNISSIAGLNRGQL  181



>gb|KDO53624.1| hypothetical protein CISIN_1g023555mg [Citrus sinensis]
Length=280

 Score =   222 bits (565),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M S+V     LEPW +L  KV MVTGASSG+GRE  LDLAKAGCR++AAARRVDRLKSLC
Sbjct  1    MASQVSDCLDLEPWCQLDNKVVMVTGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
            DEIN   SG+ +RA+A+ELDVSA+G AIE +VQ+AW+AFGRIDAL+NNAGV G V +PLD
Sbjct  61   DEINK-QSGSSVRAMAVELDVSANGAAIENSVQKAWEAFGRIDALVNNAGVSGAVKSPLD  119

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LTEEEWN + KTNLTG+WLVSKYVC+RM +A   GS++NISSI+  +RGQL
Sbjct  120  LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQL  170



>ref|XP_010055797.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Eucalyptus grandis]
 gb|KCW90025.1| hypothetical protein EUGRSUZ_A02228 [Eucalyptus grandis]
Length=282

 Score =   222 bits (565),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 141/167 (84%), Gaps = 3/167 (2%)
 Frame = +3

Query  30   ARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVG  209
            A HLEPWR+L  KV MVTGASSG+GRE  LDLA+AGCRV+AAARRVDRL+SLC EI+G+G
Sbjct  6    AGHLEPWRDLRDKVVMVTGASSGLGREFCLDLARAGCRVVAAARRVDRLQSLCGEIDGIG  65

Query  210  SGTPL---RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEE  380
            S  P    RAVA+ELD++A G AIE +V  AWDAFGRIDALINNAGVRG V +PL+L+EE
Sbjct  66   SPAPTGGRRAVAVELDIAAGGAAIERSVGSAWDAFGRIDALINNAGVRGSVKSPLELSEE  125

Query  381  EWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EWN   KTNLTG+WLVSKYVC+RM +A  GGSIVNISSI+GLNRGQL
Sbjct  126  EWNHTFKTNLTGSWLVSKYVCIRMRDAHQGGSIVNISSIAGLNRGQL  172



>ref|XP_006430531.1| hypothetical protein CICLE_v10012408mg [Citrus clementina]
 gb|ESR43771.1| hypothetical protein CICLE_v10012408mg [Citrus clementina]
Length=282

 Score =   220 bits (561),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 140/169 (83%), Gaps = 3/169 (2%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V+ HLEPW +L  KV MVTGASSG+GRE  LDLAKAGCR++AAARRVDRLKSLCDEIN 
Sbjct  4    QVSDHLEPWHDLNEKVVMVTGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINK  63

Query  204  ---VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
               VGS   +RAVA+ELDV AD   IE +VQ+AW+AFGR+DAL+NNAG+RG V +PL+++
Sbjct  64   PGMVGSPDSVRAVAVELDVCADAATIEISVQKAWEAFGRVDALVNNAGIRGSVKSPLEMS  123

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEWN + KTNLTG WLV+KYVC+RM +AK GGS++NISS  GLNRG L
Sbjct  124  EEEWNRVMKTNLTGCWLVAKYVCIRMRDAKQGGSVINISSTGGLNRGHL  172



>ref|XP_006482064.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Citrus sinensis]
Length=296

 Score =   220 bits (561),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 142/172 (83%), Gaps = 1/172 (1%)
 Frame = +3

Query  6    EMESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSL  185
            +M S+V     LEPW +L  KV MVTGASSG+GRE  LDLAKAGCR++AAARRVDRLKSL
Sbjct  16   QMASQVLDCLDLEPWCQLDNKVVMVTGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSL  75

Query  186  CDEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPL  365
            CDEIN   SG+ +RA+A+ELDVSA+G AIE +VQ AW+AFGRIDAL+NNAGV G V +PL
Sbjct  76   CDEINK-QSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPL  134

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            DLTEEEWN + KTNLTG+WLVSKYVC+RM +A   GS++NISSI+  +RGQL
Sbjct  135  DLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQL  186



>ref|XP_004249319.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Solanum lycopersicum]
Length=287

 Score =   219 bits (559),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 139/177 (79%), Gaps = 6/177 (3%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME+  K  R LEPW EL GKV MVTGASSGIGR+   DL+KAGCR+IAAARR+DRL+SLC
Sbjct  1    METHAKSVRQLEPWGELAGKVVMVTGASSGIGRDFCSDLSKAGCRIIAAARRIDRLQSLC  60

Query  189  DEING------VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR  350
            DEIN         S   LRAVAIELDVSA+G AIEAAVQ+AWDAFGRID L+NNAG RG 
Sbjct  61   DEINSNSSNGSTKSSQDLRAVAIELDVSANGSAIEAAVQKAWDAFGRIDGLVNNAGFRGS  120

Query  351  VHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            V +PL+L+EEEW  + KTNL G WLV+KYVC+ M  A  GGSI+NISSI+G+NRGQL
Sbjct  121  VLSPLELSEEEWEKIHKTNLRGAWLVTKYVCMHMRAANQGGSIINISSIAGINRGQL  177



>ref|XP_002517315.1| 2,4-dienoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF45108.1| 2,4-dienoyl-CoA reductase, putative [Ricinus communis]
Length=285

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 143/172 (83%), Gaps = 2/172 (1%)
 Frame = +3

Query  12   ESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCD  191
            +S+ +V   LEPW +L  KV +VTGAS+G+GRE  LDLAKAGC+++AAARR+DRLKSLCD
Sbjct  4    QSQSQVQTQLEPWCDLDNKVVLVTGASAGLGREFCLDLAKAGCKILAAARRIDRLKSLCD  63

Query  192  EINGVGS--GTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPL  365
            EIN + +  G   RAVAIELDV ADGP I+ +VQ AWDAFGRIDAL+NNAGVRG V TPL
Sbjct  64   EINQLPNTPGAGPRAVAIELDVCADGPTIDKSVQIAWDAFGRIDALVNNAGVRGNVKTPL  123

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            DL+EEEW  + KTNL G+W+VSKYVC+RM +AK GGSIVNISSI+GLNRGQL
Sbjct  124  DLSEEEWELVVKTNLKGSWIVSKYVCIRMRDAKLGGSIVNISSIAGLNRGQL  175



>ref|XP_006430535.1| hypothetical protein CICLE_v10012421mg [Citrus clementina]
 gb|ESR43775.1| hypothetical protein CICLE_v10012421mg [Citrus clementina]
Length=280

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M S+V     LEPW +L  KV MVTGASSG+GRE  LDLAKAGCR++AAARRVDRLKSLC
Sbjct  1    MASQVSDCLDLEPWCQLDNKVVMVTGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
            DEIN   SG+ +RA+A+ELDVSA+G AI  +VQ+AW+AFGRIDAL+NNAGV G V +PLD
Sbjct  61   DEINK-QSGSSVRAMAVELDVSANGAAIGNSVQKAWEAFGRIDALVNNAGVSGAVKSPLD  119

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LTEEEWN + KTNLTG+WLVSKYVC+RM +A   GS++NISSI+  +RGQL
Sbjct  120  LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQL  170



>ref|XP_007145484.1| hypothetical protein PHAVU_007G242900g [Phaseolus vulgaris]
 gb|ESW17478.1| hypothetical protein PHAVU_007G242900g [Phaseolus vulgaris]
Length=286

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 142/173 (82%), Gaps = 7/173 (4%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +++ HLEPWR L GKV MVTGAS+G+GR+  LDLA+AGCRV+ AARRVDRL+SLCDEING
Sbjct  4    QLSDHLEPWRTLAGKVVMVTGASAGLGRDFCLDLARAGCRVVLAARRVDRLRSLCDEING  63

Query  204  VGS-------GTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTP  362
            +         G  LRAVA+ELD++ADGP +++ VQ+AWDAFG +DALINNAG+RG V +P
Sbjct  64   MAPPAALADGGGSLRAVAVELDIAADGPVVDSYVQKAWDAFGHVDALINNAGIRGTVKSP  123

Query  363  LDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            L+L+EEEWN   +TNLTGTWLVSK VC RM +A+  GSI+NI+SI+GLNRGQL
Sbjct  124  LELSEEEWNHSFRTNLTGTWLVSKSVCKRMRDAQRKGSIINIASIAGLNRGQL  176



>ref|XP_011079077.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Sesamum indicum]
Length=285

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 147/175 (84%), Gaps = 4/175 (2%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            MESR +VA  LEPW  L  KV MVTGASSG+GR+  LDLAKAGCRVIAAARR+DRL+SLC
Sbjct  1    MESRSQVASELEPWLRLDNKVVMVTGASSGLGRDFCLDLAKAGCRVIAAARRMDRLRSLC  60

Query  189  DEIN-GVGSGTPL---RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVH  356
            DEIN G+G+G      RAVA+ELDVSA   +IEA+VQ+AW AFGRIDALINNAG+RGRVH
Sbjct  61   DEINSGIGNGPSQDQPRAVALELDVSASAASIEASVQKAWAAFGRIDALINNAGIRGRVH  120

Query  357  TPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            +PLDL+EEEWND  KTNLTGTWLVSKYVC+RM + + GGS+VNISSI+GL RG L
Sbjct  121  SPLDLSEEEWNDNIKTNLTGTWLVSKYVCMRMRDGRHGGSVVNISSIAGLERGHL  175



>ref|XP_008340560.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Malus domestica]
Length=295

 Score =   218 bits (554),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 145/185 (78%), Gaps = 14/185 (8%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME+  +V+ HLEPWR L GKV MVTGASSG+GRE+ LDLAKAGCR++AAARR+DRL+S+C
Sbjct  1    MENPHRVSDHLEPWRHLHGKVVMVTGASSGLGREVCLDLAKAGCRIVAAARRIDRLQSVC  60

Query  189  DEINGVGSGTPL--------------RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALI  326
            DEIN +    P               RAVA+ELDVSADGPAIE +V +AWDAFG IDAL+
Sbjct  61   DEINQLSITAPSSSSSVADNGTEGGPRAVAVELDVSADGPAIEKSVNKAWDAFGLIDALV  120

Query  327  NNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgL  506
            NNAG+RG V + LDL+EEEWN + +TNLTG+WLVSK+V +RM +A  GGSIVNISSI+GL
Sbjct  121  NNAGIRGNVSSALDLSEEEWNHVFRTNLTGSWLVSKFVAIRMRDADQGGSIVNISSIAGL  180

Query  507  NRGQL  521
            NRG L
Sbjct  181  NRGYL  185



>gb|KDO53625.1| hypothetical protein CISIN_1g023885mg [Citrus sinensis]
Length=276

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 140/171 (82%), Gaps = 5/171 (3%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M SRV     LEPWRE+  KV MVTGASSG+GRE  LDLA+AGC ++AAARR DRLKSLC
Sbjct  1    MASRVPT--ELEPWREINDKVVMVTGASSGLGREFCLDLARAGCLIVAAARRCDRLKSLC  58

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
            DEIN   S   +RAVA+ELDV ADG AIE++VQ+AW+AFGRID LINNAGVRG V +PLD
Sbjct  59   DEINKPSS---IRAVAVELDVCADGAAIESSVQKAWEAFGRIDVLINNAGVRGSVKSPLD  115

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             TEEEW+   KTNLTG+WLVSKYVC+RM +A  GGSI+NISSI+G+NRGQL
Sbjct  116  WTEEEWDHNIKTNLTGSWLVSKYVCIRMRDANLGGSIINISSIAGINRGQL  166



>ref|XP_009417296.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=287

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 136/163 (83%), Gaps = 2/163 (1%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            L PWR L GKV MVTGASSGIGR++ LDLAKAGCRVIAAARR DRL+SLC+EING G+  
Sbjct  15   LMPWRSLEGKVVMVTGASSGIGRDLCLDLAKAGCRVIAAARRTDRLRSLCEEINGSGASE  74

Query  219  P--LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWND  392
            P  +R+VA+ELDVSAD PAI A+VQRAWDAFGRID L+NNAGVRG VH+PLD +EEEW+ 
Sbjct  75   PSAVRSVAVELDVSADEPAIAASVQRAWDAFGRIDGLVNNAGVRGDVHSPLDWSEEEWSS  134

Query  393  LTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
              +TNLTG WLVSK+VC  M +AK  GS++NISSI G+ RGQL
Sbjct  135  NIRTNLTGLWLVSKHVCKHMRDAKQKGSVINISSIGGIERGQL  177



>ref|XP_008240678.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Prunus mume]
Length=264

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 143/177 (81%), Gaps = 11/177 (6%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +VA HLEPWR+L GKV MVTGASSG+GRE  LDLAKAGCR++AAARR+DRL+S+CDEIN 
Sbjct  4    QVADHLEPWRDLHGKVVMVTGASSGLGREFCLDLAKAGCRIVAAARRIDRLQSVCDEINQ  63

Query  204  V-----------GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR  350
            +                 RAVA+ELD+SADGPAIE +V +AWDAFGRIDAL+NNAGVRG 
Sbjct  64   LTITASSSSSSVNGPGSSRAVAVELDISADGPAIEKSVNKAWDAFGRIDALVNNAGVRGN  123

Query  351  VHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            V + L+L+EEEWN++ KTNLTG+WLVSKYV +RM +A  GGSI+N+SSI+GL+RG L
Sbjct  124  VSSVLELSEEEWNNVFKTNLTGSWLVSKYVSIRMRDADQGGSIINVSSIAGLHRGYL  180



>ref|XP_006482063.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Citrus sinensis]
Length=276

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 140/171 (82%), Gaps = 5/171 (3%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M SRV     LEPWRE+  KV MVTGASSG+GRE  LDLA+AGC ++AAARR DRLKSLC
Sbjct  1    MASRVPT--ELEPWREINDKVVMVTGASSGLGREFCLDLARAGCLIVAAARRCDRLKSLC  58

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
            DEIN   S   +RAVA+ELD+ ADG AIE++VQ+AW+AFGRID LINNAGVRG V +PLD
Sbjct  59   DEINKPSS---IRAVAVELDICADGAAIESSVQKAWEAFGRIDVLINNAGVRGSVKSPLD  115

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             TEEEW+   KTNLTG+WLVSKYVC+RM +A  GGSI+NISSI+G+NRGQL
Sbjct  116  WTEEEWDHNIKTNLTGSWLVSKYVCIRMRDANLGGSIINISSIAGINRGQL  166



>ref|XP_008386836.1| PREDICTED: probable L-xylulose reductase [Malus domestica]
Length=296

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 147/187 (79%), Gaps = 17/187 (9%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME+  +V+ HLEPWR L GKV MVTGASSG+GR+  LDLAKAGCR++AAARR+DRL+S+C
Sbjct  1    MENSHQVSDHLEPWRHLHGKVVMVTGASSGLGRDFCLDLAKAGCRIVAAARRIDRLQSVC  60

Query  189  DEIN----------------GVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDA  320
            D+IN                 +  G P RAVA+ELDVSADGPAIE +V +AWDAFGRIDA
Sbjct  61   DQINQLSITAPSFSSSAVADNIPGGXP-RAVAVELDVSADGPAIEKSVNKAWDAFGRIDA  119

Query  321  LINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissis  500
            L+NNAG+RG V++ L+L+EEEWN + +TNLTG+WLVSK+V +RM +A  GGSIVNISSI+
Sbjct  120  LVNNAGIRGNVNSALELSEEEWNHVFRTNLTGSWLVSKFVAIRMRDADQGGSIVNISSIA  179

Query  501  gLNRGQL  521
            G+NRG L
Sbjct  180  GINRGHL  186



>ref|XP_010112844.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Morus notabilis]
 gb|EXC34967.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Morus notabilis]
Length=283

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 136/169 (80%), Gaps = 6/169 (4%)
 Frame = +3

Query  33   RHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV--  206
            + LEPW +L+G+V MVTGASSG+G E  LDLAK GC VIAAARRVDRLKSLCD+IN V  
Sbjct  5    QQLEPWHDLSGRVVMVTGASSGLGHEFCLDLAKVGCHVIAAARRVDRLKSLCDQINNVVL  64

Query  207  ----GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
                 S T LRAVA+ELDV ADGP IE +VQ+AW+AFGRIDALINNAG RG V +PLDL+
Sbjct  65   PTQSSSSTDLRAVAVELDVCADGPTIEKSVQKAWEAFGRIDALINNAGFRGNVKSPLDLS  124

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            E+EW+ +  TNL GTWLVSKYVC  M +A  GGS++NISSISGLNRGQL
Sbjct  125  EDEWDTVFNTNLKGTWLVSKYVCRLMRDAGRGGSVINISSISGLNRGQL  173



>ref|XP_002282735.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
[Vitis vinifera]
Length=286

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 141/172 (82%), Gaps = 7/172 (4%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +VA HLEPW++L GKV +VTGASSG+G E  L+LAKAGC+++AAARRVDRLKSLCDEIN 
Sbjct  4    QVADHLEPWQDLEGKVVLVTGASSGLGSEFCLNLAKAGCKIVAAARRVDRLKSLCDEINN  63

Query  204  VGSGT-------PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTP  362
            +           P+RAV +ELDV++ G +I A+VQ+AW+AFGRID L+NNAG+RG V++P
Sbjct  64   LTHSNLPPNADRPVRAVVVELDVTSGGSSISASVQKAWEAFGRIDVLLNNAGIRGNVNSP  123

Query  363  LDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQ  518
            LD++EEEWN+  KTNLTG+WLVSKYV +RM +AK GGSI+NISSI  LNRGQ
Sbjct  124  LDISEEEWNNTLKTNLTGSWLVSKYVGMRMRDAKNGGSIINISSIVSLNRGQ  175



>emb|CBI32789.3| unnamed protein product [Vitis vinifera]
Length=271

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 141/172 (82%), Gaps = 7/172 (4%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +VA HLEPW++L GKV +VTGASSG+G E  L+LAKAGC+++AAARRVDRLKSLCDEIN 
Sbjct  4    QVADHLEPWQDLEGKVVLVTGASSGLGSEFCLNLAKAGCKIVAAARRVDRLKSLCDEINN  63

Query  204  VGSGT-------PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTP  362
            +           P+RAV +ELDV++ G +I A+VQ+AW+AFGRID L+NNAG+RG V++P
Sbjct  64   LTHSNLPPNADRPVRAVVVELDVTSGGSSISASVQKAWEAFGRIDVLLNNAGIRGNVNSP  123

Query  363  LDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQ  518
            LD++EEEWN+  KTNLTG+WLVSKYV +RM +AK GGSI+NISSI  LNRGQ
Sbjct  124  LDISEEEWNNTLKTNLTGSWLVSKYVGMRMRDAKNGGSIINISSIVSLNRGQ  175



>ref|NP_001274762.1| putative short-chain type alcohol dehydrogenase [Solanum tuberosum]
 gb|AAK29646.1|AF349916_1 putative short-chain type alcohol dehydrogenase [Solanum tuberosum]
Length=283

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 136/173 (79%), Gaps = 2/173 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME   K  R LEPW EL GKV MVTGASSGIGR+   DL+KAGCR+IAAARR+DRL+SLC
Sbjct  1    MEKHAKSVRQLEPWGELAGKVVMVTGASSGIGRDFCSDLSKAGCRIIAAARRIDRLQSLC  60

Query  189  DEINGVGSGTP--LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTP  362
            DEIN   S +   LRAVAIELDVSA+G AIEAAVQ+AWD FGRID L+NNAG+RG VH+P
Sbjct  61   DEINSNSSNSSQDLRAVAIELDVSANGSAIEAAVQKAWDVFGRIDGLVNNAGIRGSVHSP  120

Query  363  LDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LDL+EEEW    KTNL G WLV+K+VC  M  A   GS++NISSI+GLN GQL
Sbjct  121  LDLSEEEWEKTYKTNLRGAWLVTKFVCKHMRAANQEGSVINISSIAGLNPGQL  173



>gb|AFK48641.1| unknown [Medicago truncatula]
 gb|KEH30025.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
 gb|KEH30027.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=273

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            + + LEPW  L GKV +VTGAS+GIGR+  LDLA+AGC VIAAARRVDRL+SLCDEING 
Sbjct  1    MPKQLEPWHHLAGKVVLVTGASAGIGRDFCLDLARAGCFVIAAARRVDRLQSLCDEING-  59

Query  207  GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEW  386
                 LRAVA+ELDV+ADG AIE  VQ+AW+AFG IDALINNAGVRG V +PL+LTEEEW
Sbjct  60   -KDGRLRAVAVELDVAADGGAIEKYVQKAWEAFGHIDALINNAGVRGNVSSPLELTEEEW  118

Query  387  NDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            N++ KTN+TGTWLVSKYVC  M ++K  GSI+NISSI+GL RGQL
Sbjct  119  NNVFKTNITGTWLVSKYVCKLMRDSKRKGSIINISSIAGLERGQL  163



>ref|XP_003518977.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
isoform X1 [Glycine max]
 ref|XP_006575129.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
isoform X2 [Glycine max]
Length=282

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 138/169 (82%), Gaps = 3/169 (2%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +++  LEPW  L GKV MVTGASSG+GR+  LDL +AGCRV+ AARRVDRL+SLCDEIN 
Sbjct  4    QLSDRLEPWHTLAGKVVMVTGASSGLGRDFCLDLGRAGCRVVVAARRVDRLESLCDEINS  63

Query  204  VGSGT---PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
            + +G      RAVA+ELDV+AD PA++  VQ+AW+AFG IDALINNAGVRG V +PL+L+
Sbjct  64   MAAGDGGRSRRAVAVELDVAADDPAVDKYVQKAWEAFGHIDALINNAGVRGNVKSPLELS  123

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEWN   +TNLTGTWLVSKYVC RM +A+  GSI+NI+SI+GLNRGQL
Sbjct  124  EEEWNHAFRTNLTGTWLVSKYVCKRMRDAQRKGSIINIASIAGLNRGQL  172



>ref|XP_004294537.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=282

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = +3

Query  15   SRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDE  194
            ++ +V+ HLEPW +L  KV MVTGASSG+G +  LDLAKAGCR++AAARRVDRL S+CD 
Sbjct  2    AKTQVSDHLEPWHDLPDKVVMVTGASSGLGHDFCLDLAKAGCRIVAAARRVDRLHSICDA  61

Query  195  INGVGSGTP--LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
            IN + +  P   RA A+ELDVSADG AI+ +VQ+AWDAFGRIDALINNAGVRG V + L+
Sbjct  62   INKLSTTAPPQTRAFAVELDVSADGSAIQKSVQKAWDAFGRIDALINNAGVRGTVASALE  121

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            L+EEEWN+  KTNLTGTWLVSKYV L M NA  GGSI+NISSI+GLNRG L
Sbjct  122  LSEEEWNNTLKTNLTGTWLVSKYVSLCMRNADKGGSIINISSIAGLNRGYL  172



>emb|CAN59905.1| hypothetical protein VITISV_033145 [Vitis vinifera]
Length=316

 Score =   213 bits (542),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 141/172 (82%), Gaps = 7/172 (4%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +VA HLEPW++L GKV +VTGASSG+G E  L+LAKAGC+++AAARRVDRLKSLCDEIN 
Sbjct  4    QVADHLEPWQDLEGKVVLVTGASSGLGSEFCLNLAKAGCKIVAAARRVDRLKSLCDEINN  63

Query  204  VGSGT-------PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTP  362
            +           P+RAV +ELDV++ G +I A+VQ+AW+AFGRID L+NNAG+RG V++P
Sbjct  64   LTHSNLPPNADRPVRAVVVELDVTSGGSSISASVQKAWEAFGRIDVLLNNAGIRGNVNSP  123

Query  363  LDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQ  518
            LD++EEEWN+  KTNLTG+WLVSKYV +RM +AK GGSI+NISSI  LNRGQ
Sbjct  124  LDISEEEWNNTLKTNLTGSWLVSKYVGMRMRDAKNGGSIINISSIVSLNRGQ  175



>gb|KJB54602.1| hypothetical protein B456_009G041000 [Gossypium raimondii]
Length=230

 Score =   210 bits (535),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 137/170 (81%), Gaps = 8/170 (5%)
 Frame = +3

Query  33   RHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEIN----  200
            + LEPW +L+GKV MVTGASSG+GR+  LDL+K GCR++AAARRVDRLKSLCDEIN    
Sbjct  5    QQLEPWTDLSGKVVMVTGASSGLGRDFCLDLSKGGCRIVAAARRVDRLKSLCDEINHLTF  64

Query  201  ---GVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDL  371
               G     P RA A+ELDV ADG  I+++V+ AWDAFGRIDALINNAGVRG V  PL+L
Sbjct  65   PFSGPQPSGP-RAFAVELDVCADGSTIQSSVKAAWDAFGRIDALINNAGVRGNVKDPLEL  123

Query  372  TEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            TEEEWN   +TNLTG+WLVSKYVC+ M +AK GGS++NISSI+GLNRGQL
Sbjct  124  TEEEWNQNIRTNLTGSWLVSKYVCMLMRDAKQGGSVINISSIAGLNRGQL  173



>gb|KHG26617.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Gossypium arboreum]
Length=283

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 140/169 (83%), Gaps = 6/169 (4%)
 Frame = +3

Query  33   RHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVG-  209
            + LEPW +L+GKV MVTGASSG+GR+  LDL+KAGCR++AAARRVDRLKSLCDEIN +  
Sbjct  5    QQLEPWADLSGKVVMVTGASSGLGRDFCLDLSKAGCRIVAAARRVDRLKSLCDEINHLSF  64

Query  210  --SGTPL---RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
              SGT     RA A+ELD+ ADG  I+++V+ AWDAFGRIDALINNAGVRG V  PL+LT
Sbjct  65   PFSGTQPSGPRAFAVELDICADGSTIQSSVKAAWDAFGRIDALINNAGVRGNVKDPLELT  124

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEW+   +TNLTG+WLVSKYVC+ M +AK GGS++NISSI+GLNRGQL
Sbjct  125  EEEWDQNIRTNLTGSWLVSKYVCMLMRDAKQGGSVINISSIAGLNRGQL  173



>ref|XP_009371362.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Pyrus x bretschneideri]
Length=295

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 145/185 (78%), Gaps = 14/185 (8%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME+  +V+ HLEPWR L GKV MVTGASSG+G ++ LDLAKAGC+++AAARR+DRL+S+C
Sbjct  1    MENPHRVSDHLEPWRHLHGKVVMVTGASSGLGCDLCLDLAKAGCKIVAAARRIDRLQSVC  60

Query  189  DEINGV--------------GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALI  326
            D+IN +              G G   RAVA+ELDVSADGPAIE +V +AWDAFG IDAL+
Sbjct  61   DQINQLSITALSSSSSVADNGPGGGPRAVAVELDVSADGPAIEKSVNKAWDAFGHIDALV  120

Query  327  NNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgL  506
            NNAG+RG V + L+L+EEEWN + +TNLTGTWLVSK+V +RM +A  GGSIVNISSI+GL
Sbjct  121  NNAGIRGNVSSALELSEEEWNHVFRTNLTGTWLVSKFVAIRMRDADQGGSIVNISSIAGL  180

Query  507  NRGQL  521
            NRG L
Sbjct  181  NRGYL  185



>ref|XP_009631508.1| PREDICTED: probable L-xylulose reductase [Nicotiana tomentosiformis]
Length=275

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 118/142 (83%), Gaps = 2/142 (1%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW++L+GKV MVTGASSGIGRE  LDLAKAGC +IAAARR++RLKSLCD+IN   S  
Sbjct  6    MEPWKDLSGKVVMVTGASSGIGREFCLDLAKAGCSIIAAARRINRLKSLCDQINN--SED  63

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              RA+A++LDV+ADG  IEAAVQRAWDAFGRIDAL+NNAG+RG VH+ L L EEEWN   
Sbjct  64   TQRAIAVQLDVTADGSTIEAAVQRAWDAFGRIDALVNNAGLRGNVHSSLKLPEEEWNHTF  123

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
            KTNL G WLVSKY+C RM +AK
Sbjct  124  KTNLRGAWLVSKYICRRMRDAK  145



>gb|KJB54601.1| hypothetical protein B456_009G041000 [Gossypium raimondii]
Length=283

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 137/170 (81%), Gaps = 8/170 (5%)
 Frame = +3

Query  33   RHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEIN----  200
            + LEPW +L+GKV MVTGASSG+GR+  LDL+K GCR++AAARRVDRLKSLCDEIN    
Sbjct  5    QQLEPWTDLSGKVVMVTGASSGLGRDFCLDLSKGGCRIVAAARRVDRLKSLCDEINHLTF  64

Query  201  ---GVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDL  371
               G     P RA A+ELDV ADG  I+++V+ AWDAFGRIDALINNAGVRG V  PL+L
Sbjct  65   PFSGPQPSGP-RAFAVELDVCADGSTIQSSVKAAWDAFGRIDALINNAGVRGNVKDPLEL  123

Query  372  TEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            TEEEWN   +TNLTG+WLVSKYVC+ M +AK GGS++NISSI+GLNRGQL
Sbjct  124  TEEEWNQNIRTNLTGSWLVSKYVCMLMRDAKQGGSVINISSIAGLNRGQL  173



>ref|XP_007028287.1| 2,4-dienoyl-CoA reductase isoform 2 [Theobroma cacao]
 gb|EOY08789.1| 2,4-dienoyl-CoA reductase isoform 2 [Theobroma cacao]
Length=282

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 135/169 (80%), Gaps = 6/169 (4%)
 Frame = +3

Query  33   RHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEIN--GV  206
            + LEPW  L+GKV MVTGASSG+GRE  LDL KAGCR++AAARRVDRLKSLCDEIN    
Sbjct  4    QQLEPWAYLSGKVVMVTGASSGLGREFCLDLGKAGCRIVAAARRVDRLKSLCDEINCLTF  63

Query  207  GSGTPL----RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
             S  P     RAVA+ELDV A G  I+++V+ AWDAFGRID+LINNAG+RG V  P++L+
Sbjct  64   PSSKPQPSGPRAVAVELDVCAKGATIQSSVKTAWDAFGRIDSLINNAGIRGNVKNPMELS  123

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEWN   KTNLTG+WLVSKYVC+ M +A  GGSI+NISSI+GLNRGQL
Sbjct  124  EEEWNQTIKTNLTGSWLVSKYVCMHMLDANQGGSIINISSIAGLNRGQL  172



>gb|ACJ85419.1| unknown [Medicago truncatula]
Length=204

 Score =   207 bits (528),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 136/165 (82%), Gaps = 2/165 (1%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            + + LEPW  L GKV +VTGAS+GIGR+  LDLA+AGC VIAAARRVDRL+SLCDEING 
Sbjct  1    MPKQLEPWHHLAGKVVLVTGASAGIGRDFCLDLARAGCFVIAAARRVDRLQSLCDEING-  59

Query  207  GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEW  386
                 LRAVA+ELDV+ADG AIE  VQ+AW+AFG IDALINNAGVRG V +PL+LTEEEW
Sbjct  60   -KDGRLRAVAVELDVAADGGAIEKYVQKAWEAFGHIDALINNAGVRGNVSSPLELTEEEW  118

Query  387  NDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            N++ KTN+TGTWLVSKYVC  M ++K  GSI+NISSI+GL RG +
Sbjct  119  NNVFKTNITGTWLVSKYVCKLMRDSKRKGSIINISSIAGLERGAI  163



>ref|XP_009383217.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=280

 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +3

Query  42   EPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTP  221
            +PWR L  KV MVTGASSGIGR++ LDLA+AGCRV+AAARR D L+SLCDEINGVG+ + 
Sbjct  11   QPWRRLDDKVVMVTGASSGIGRDLCLDLARAGCRVVAAARRTDLLRSLCDEINGVGACSV  70

Query  222  LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTK  401
            +R+VA+ELDVSA    I AAVQ AWDAFGRIDAL+NNAG+RG V++PLD +EEEW++  +
Sbjct  71   VRSVAVELDVSAQEAVIAAAVQTAWDAFGRIDALVNNAGIRGAVNSPLDWSEEEWSNNIR  130

Query  402  TNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            TNLTGTWLVSK+VC RMC+AK  G ++NISSI G++RG L
Sbjct  131  TNLTGTWLVSKHVCKRMCDAKQKGCVINISSIGGIDRGHL  170



>ref|XP_009371244.1| PREDICTED: LOW QUALITY PROTEIN: estradiol 17-beta-dehydrogenase 
8-like [Pyrus x bretschneideri]
Length=295

 Score =   210 bits (535),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 129/167 (77%), Gaps = 17/167 (10%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME+  +V+ HLEPWR L GKV MVTGASSG+GR+  LDLAKAGCR++AAARR+DRL+S+C
Sbjct  1    MENSHQVSDHLEPWRHLHGKVVMVTGASSGLGRDFCLDLAKAGCRIVAAARRIDRLQSVC  60

Query  189  DEIN----------------GVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDA  320
            D+IN                 +  G P RAVA+ELDVSADGPAIE +V +AWDAFGRIDA
Sbjct  61   DQINQLSITAPSFSSSAAADNIPRGGP-RAVAVELDVSADGPAIEKSVNKAWDAFGRIDA  119

Query  321  LINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNA  461
            L+NNAG+RG V + L L+EEEWN++ +TNLTG+WLVSK+V +RM +A
Sbjct  120  LVNNAGIRGNVKSALXLSEEEWNNVFRTNLTGSWLVSKFVAIRMRDA  166



>gb|KEH30024.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=273

 Score =   209 bits (531),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            +A+ LEPW +L GKV +VTGAS+G+GR+  LDLA AGC VIAAARRVDRL+SLCDEING 
Sbjct  1    MAKQLEPWHDLAGKVVLVTGASAGLGRDFCLDLAGAGCNVIAAARRVDRLQSLCDEING-  59

Query  207  GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEW  386
                 LRAVA+ELDV+ADG AIE  VQ+AW+AFG IDALINNAGVRG V +PL+LTEEEW
Sbjct  60   -KDGRLRAVAVELDVAADGGAIEKYVQKAWEAFGHIDALINNAGVRGNVSSPLELTEEEW  118

Query  387  NDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            N++ +TN+TG WLVSKYVC  M ++K  GSI+NISSI+GL RGQ+
Sbjct  119  NNVFRTNITGAWLVSKYVCKLMRDSKRKGSIINISSIAGLERGQV  163



>ref|XP_006430533.1| hypothetical protein CICLE_v10012432mg [Citrus clementina]
 gb|ESR43773.1| hypothetical protein CICLE_v10012432mg [Citrus clementina]
Length=200

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 137/171 (80%), Gaps = 5/171 (3%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M SRV     LEPWRE+  KV MVTGA SG+GRE  LDLA+AGC ++AAAR  DRLKSLC
Sbjct  1    MASRVPT--ELEPWREINDKVVMVTGAPSGLGREFCLDLARAGCLIVAAARPGDRLKSLC  58

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
            DEIN   S   +RAVA+ELDV ADG AIE++VQ+AW+AF RID LINNAGVRG V +PLD
Sbjct  59   DEINKPSS---IRAVAVELDVCADGAAIESSVQKAWEAFWRIDVLINNAGVRGSVKSPLD  115

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             TEEEW+   KTNLTG+WLVSKYVC+RM +A  GGSI+NISSI+G+NRGQL
Sbjct  116  WTEEEWDHNIKTNLTGSWLVSKYVCIRMRDANLGGSIINISSIAGINRGQL  166



>ref|XP_009786105.1| PREDICTED: D-erythrulose reductase-like [Nicotiana sylvestris]
Length=251

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 115/142 (81%), Gaps = 3/142 (2%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW++L GKV MVTGASSGIGRE+ LDLAK GC +IAAARRVDRLKSLCDEIN      
Sbjct  1    MEPWKDLRGKVVMVTGASSGIGRELCLDLAKVGCSIIAAARRVDRLKSLCDEIN---LQV  57

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
            P +A A+E D++ADG  IEAAVQRAWDAFGRIDAL+NNAGVRG + + L L+E+EWN   
Sbjct  58   PRQAFAVEFDITADGSTIEAAVQRAWDAFGRIDALVNNAGVRGNIGSSLKLSEDEWNHTF  117

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL GTWLVSKYVC RM +AK
Sbjct  118  NTNLKGTWLVSKYVCSRMRDAK  139



>gb|KEH41456.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=281

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 134/164 (82%), Gaps = 3/164 (2%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEIN---GVG  209
            LEPW++L  KV +VTGASSG+G +  LDLAKAGCR++AAARR+DRL SLC +IN   G G
Sbjct  8    LEPWQKLDDKVVLVTGASSGLGYDFCLDLAKAGCRIVAAARRLDRLHSLCHQINNLYGNG  67

Query  210  SGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWN  389
            +   LRAVA+ELDVSADG +I+ +V +AWDAFG ID LINNAGVRG V +PLDL+E+EWN
Sbjct  68   NLLNLRAVAVELDVSADGASIDKSVHKAWDAFGHIDTLINNAGVRGSVKSPLDLSEDEWN  127

Query  390  DLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             + KTNLTG+WLVSKYVC R+C+A   GSI+NISS SGLNRG L
Sbjct  128  HVFKTNLTGSWLVSKYVCKRICDAHRKGSIINISSTSGLNRGNL  171



>ref|XP_009773767.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana sylvestris]
Length=285

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 123/153 (80%), Gaps = 2/153 (1%)
 Frame = +3

Query  12   ESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCD  191
            + +  +A HLEPWR+L GKV  VTGAS+G+GRE  LDLA+AGC+V+AAARR DRLKSLCD
Sbjct  4    QKKSNMADHLEPWRQLQGKVVFVTGASAGLGREFCLDLARAGCKVVAAARRADRLKSLCD  63

Query  192  EINGVGSGTP--LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPL  365
            EIN + S     +RAVAIELDV+ADGP IEA+V++AWDAFG IDALINNAGVRG + + +
Sbjct  64   EINIMASSNTNLVRAVAIELDVTADGPTIEASVKKAWDAFGYIDALINNAGVRGGIKSAV  123

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            D++EEEW    +TNLTG+WLVSKYV  RM  AK
Sbjct  124  DISEEEWRSTLETNLTGSWLVSKYVGRRMKAAK  156



>ref|XP_007028286.1| 2,4-dienoyl-CoA reductase, putative isoform 1 [Theobroma cacao]
 gb|EOY08788.1| 2,4-dienoyl-CoA reductase, putative isoform 1 [Theobroma cacao]
Length=364

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 136/169 (80%), Gaps = 6/169 (4%)
 Frame = +3

Query  33   RHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV--  206
            + LEPW  L+GKV MVTGASSG+GRE  LDL KAGCR++AAARRVDRLKSLCDEIN +  
Sbjct  22   QQLEPWAYLSGKVVMVTGASSGLGREFCLDLGKAGCRIVAAARRVDRLKSLCDEINCLTF  81

Query  207  GSGTPL----RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
             S  P     RAVA+ELDV A G  I+++V+ AWDAFGRID+LINNAG+RG V  P++L+
Sbjct  82   PSSKPQPSGPRAVAVELDVCAKGATIQSSVKTAWDAFGRIDSLINNAGIRGNVKNPMELS  141

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEWN   KTNLTG+WLVSKYVC+ M +A  GGSI+NISSI+GLNRGQL
Sbjct  142  EEEWNQTIKTNLTGSWLVSKYVCMHMLDANQGGSIINISSIAGLNRGQL  190



>ref|XP_006430534.1| hypothetical protein CICLE_v10012432mg [Citrus clementina]
 gb|ESR43774.1| hypothetical protein CICLE_v10012432mg [Citrus clementina]
Length=276

 Score =   207 bits (527),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 137/171 (80%), Gaps = 5/171 (3%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M SRV     LEPWRE+  KV MVTGA SG+GRE  LDLA+AGC ++AAAR  DRLKSLC
Sbjct  1    MASRVPT--ELEPWREINDKVVMVTGAPSGLGREFCLDLARAGCLIVAAARPGDRLKSLC  58

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
            DEIN   S   +RAVA+ELDV ADG AIE++VQ+AW+AF RID LINNAGVRG V +PLD
Sbjct  59   DEINKPSS---IRAVAVELDVCADGAAIESSVQKAWEAFWRIDVLINNAGVRGSVKSPLD  115

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             TEEEW+   KTNLTG+WLVSKYVC+RM +A  GGSI+NISSI+G+NRGQL
Sbjct  116  WTEEEWDHNIKTNLTGSWLVSKYVCIRMRDANLGGSIINISSIAGINRGQL  166



>ref|XP_008339342.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Malus domestica]
 ref|XP_008352851.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Malus domestica]
Length=295

 Score =   207 bits (528),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 144/183 (79%), Gaps = 14/183 (8%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME+  +V+ HLEPW  L GKV MVTGASSG+GRE+ LDLAKAGCR++A+ARR+DRL+S+C
Sbjct  1    MENPHRVSDHLEPWGHLHGKVVMVTGASSGLGRELCLDLAKAGCRIVASARRIDRLQSVC  60

Query  189  DEINGV--------------GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALI  326
             +IN +              G G   RAVA+ELDVSADG AIE +V +AWDAFG IDAL+
Sbjct  61   XQINQLSITAPSSPSSVADNGPGGGPRAVAVELDVSADGXAIEKSVNKAWDAFGLIDALV  120

Query  327  NNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgL  506
            NNAG+RG V +PL+L+EEEWN++ +TNLTG+WLVSK+V +RM +A  GGSIVNISSI+GL
Sbjct  121  NNAGIRGNVSSPLELSEEEWNNVFRTNLTGSWLVSKFVAIRMRDADQGGSIVNISSITGL  180

Query  507  NRG  515
            NRG
Sbjct  181  NRG  183



>gb|ABK93994.1| unknown [Populus trichocarpa]
Length=290

 Score =   207 bits (528),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 138/177 (78%), Gaps = 11/177 (6%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            KVA  LEPW +L  KV +VTGASSG+G++  LDLAKAGCR++AAARRVDRLKSLCDEIN 
Sbjct  4    KVATQLEPWCDLRNKVVLVTGASSGLGKDFCLDLAKAGCRILAAARRVDRLKSLCDEINQ  63

Query  204  VGSGTPL-----------RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR  350
            +    P            RAVA+ELDVSADG  I+  VQ+AWDAFG IDAL+NNAGVRG 
Sbjct  64   MSLSFPTSSSTAEVDIQPRAVAVELDVSADGNTIDKCVQKAWDAFGGIDALVNNAGVRGT  123

Query  351  VHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            V  PL+L+EEEWN + +TN TGTWLVSK VC+RM ++K GGS++NI+SI+GLNRGQL
Sbjct  124  VRDPLELSEEEWNHVIRTNTTGTWLVSKAVCIRMRDSKRGGSVINIASIAGLNRGQL  180



>ref|XP_003518969.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
[Glycine max]
Length=282

 Score =   207 bits (526),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 135/166 (81%), Gaps = 8/166 (5%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEIN-----G  203
            LEPW +L  KV +VTGASSG+GR+  +DLAKAGC V+AAARR+DRL SLC EIN      
Sbjct  10   LEPWHKLDDKVVLVTGASSGLGRDFCIDLAKAGCCVVAAARRLDRLTSLCHEINHRWPSN  69

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
            VG     RAVA+ELDV+ADGPAI+ AVQ+AWDAFGR+D+LINNAGVRG V +PL L+EEE
Sbjct  70   VGIH---RAVAVELDVAADGPAIDRAVQKAWDAFGRVDSLINNAGVRGSVKSPLKLSEEE  126

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            W+ + KTNLTG WLVSKYVC RMC+ +  GSI+NISS+SGLNRGQL
Sbjct  127  WDHVFKTNLTGCWLVSKYVCKRMCDIQLKGSIINISSVSGLNRGQL  172



>ref|XP_008340561.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Malus domestica]
Length=295

 Score =   207 bits (527),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 144/183 (79%), Gaps = 14/183 (8%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME+  +V+ HLEPW  L GKV MVTGASSG+GRE+ LDLAKAGCR++A+ARR+DRL+S+C
Sbjct  1    MENPHRVSDHLEPWGHLHGKVVMVTGASSGLGRELCLDLAKAGCRIVASARRIDRLQSVC  60

Query  189  DEINGV--------------GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALI  326
             +IN +              G G   RAVA+ELDVSADG AIE +V +AWDAFG IDAL+
Sbjct  61   XQINQLSITAPSSPSSVADNGPGGGPRAVAVELDVSADGXAIEKSVNKAWDAFGLIDALV  120

Query  327  NNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgL  506
            NNAG+RG V +PL+L+EEEWN++ +TNLTG+WLVSK+V +RM +A  GGSIVNISSI+GL
Sbjct  121  NNAGIRGNVSSPLELSEEEWNNVFRTNLTGSWLVSKFVAIRMRDADQGGSIVNISSITGL  180

Query  507  NRG  515
            NRG
Sbjct  181  NRG  183



>ref|XP_010913911.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Elaeis guineensis]
Length=281

 Score =   207 bits (526),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 135/169 (80%), Gaps = 9/169 (5%)
 Frame = +3

Query  42   EPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVG----  209
            +PWR L GKV MVTGASSGIGRE+SLDLA+AGC+++AAARR DRLKSLCDEIN  G    
Sbjct  3    QPWRRLEGKVVMVTGASSGIGRELSLDLARAGCKIVAAARRTDRLKSLCDEINSFGPLSL  62

Query  210  -SGTP----LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
             S  P    ++AVAI+LDVSA    IEA+VQ+AWDAFGRIDAL+NNAG+RG +++PL+  
Sbjct  63   SSFNPEPSVVQAVAIQLDVSAQSSVIEASVQKAWDAFGRIDALVNNAGIRGGIYSPLEWP  122

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEWN L  TNLTG WLVSK+VC RM + K  GS++NISSI+GL RGQL
Sbjct  123  EEEWNALMATNLTGLWLVSKHVCKRMRDTKQKGSVINISSINGLERGQL  171



>ref|XP_006366156.1| PREDICTED: probable L-xylulose reductase-like, partial [Solanum 
tuberosum]
Length=300

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            ++PW++LTGKV MVTGASSGIG E  LDLAKAGCR+IAAARRVD+LKSLCD+IN    G+
Sbjct  30   MDPWKDLTGKVVMVTGASSGIGLEFCLDLAKAGCRIIAAARRVDKLKSLCDQINSNSEGS  89

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
            P  A+AIELDV+ADG  IE++VQ AW+AFGRIDAL+NNAGVRG V + ++LTEEEWN+  
Sbjct  90   P-GAIAIELDVAADGATIESSVQIAWNAFGRIDALVNNAGVRGSVSSSVELTEEEWNNTY  148

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G W+VSKYVC  M +AK
Sbjct  149  NTNLRGAWMVSKYVCKHMIDAK  170



>ref|XP_008805478.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Phoenix dactylifera]
Length=286

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 134/169 (79%), Gaps = 9/169 (5%)
 Frame = +3

Query  42   EPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVG----  209
            +PWR L GKV MVTGASSGIGRE+SLDLA+AGC ++AAARR  RLKSLCDEIN  G    
Sbjct  8    QPWRRLEGKVVMVTGASSGIGRELSLDLARAGCNIVAAARRTGRLKSLCDEINSFGSLSL  67

Query  210  -----SGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
                   + +RAVA+ELDVSA   AIEA+VQ+AWDAFGRIDALINNAG+RG +++PL+  
Sbjct  68   SSSGPEASAVRAVAVELDVSARSSAIEASVQKAWDAFGRIDALINNAGIRGGIYSPLEWP  127

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEWNDL  TNLTG WLVSK+VC RM + K  GS++N+SSI+GL RGQL
Sbjct  128  EEEWNDLMATNLTGLWLVSKHVCKRMRDTKQKGSVINVSSINGLERGQL  176



>ref|XP_010314314.1| PREDICTED: probable L-xylulose reductase [Solanum lycopersicum]
Length=271

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW++L+GKV MVTGASSGIG E  ++LAKAGC++IAAARRVDRLKSLCD+IN   +G 
Sbjct  1    MEPWQDLSGKVVMVTGASSGIGLEFCINLAKAGCKIIAAARRVDRLKSLCDQINSKSNG-  59

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
            P RA+A+ELDVSAD   I++AVQ AWDAFGRID LINNAGVRG V + +++TEEEWN+  
Sbjct  60   PQRAIAVELDVSADSTTIDSAVQIAWDAFGRIDVLINNAGVRGSVSSSVEITEEEWNNTY  119

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G W+VSKYVC RM +AK
Sbjct  120  NTNLRGAWMVSKYVCKRMIDAK  141



>gb|KDP23890.1| hypothetical protein JCGZ_26632 [Jatropha curcas]
Length=285

 Score =   205 bits (521),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 138/172 (80%), Gaps = 6/172 (3%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V   LEPW +L  KV ++TGASSGIGR++ L +AK+GCR++ AARRVDRLKSLC+EIN 
Sbjct  4    QVPAQLEPWCDLNNKVVLITGASSGIGRDMCLGIAKSGCRILTAARRVDRLKSLCEEINQ  63

Query  204  VGSG------TPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPL  365
            + S       T  RAVA+ELD+SADG  I+ +VQ AWDAFGRIDAL+NNAGVRG V TPL
Sbjct  64   LPSSANVEPSTAPRAVAVELDISADGVTIDKSVQTAWDAFGRIDALVNNAGVRGTVKTPL  123

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            DL+EEEWN + +TNLTGTWLVSK VC RM + K GGSI+NISSI+GL+RGQL
Sbjct  124  DLSEEEWNQVHRTNLTGTWLVSKSVCKRMRDGKQGGSIINISSIAGLDRGQL  175



>ref|XP_004252379.1| PREDICTED: probable L-xylulose reductase [Solanum lycopersicum]
Length=271

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            ++PW++LTGKV MVTGASSGIG E  +DLAKAGCR+IAAARRVD+LKSLCD+IN     T
Sbjct  1    MDPWKDLTGKVVMVTGASSGIGLEFCIDLAKAGCRIIAAARRVDKLKSLCDQINSNSEET  60

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
            P RA+AIELDV+AD   IE+AV+ AW+AFGRIDAL+NNAGVRG V + ++LTEEEWN+  
Sbjct  61   P-RAIAIELDVAADSATIESAVKIAWEAFGRIDALVNNAGVRGSVSSSVELTEEEWNNTY  119

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G W+VSKYVC RM +AK
Sbjct  120  NTNLRGAWMVSKYVCKRMIDAK  141



>ref|XP_002323240.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEF05001.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=290

 Score =   204 bits (520),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 137/177 (77%), Gaps = 11/177 (6%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            K A  LEPW +L  KV +VTGASSG+G++  LDLAKAGCR++AAARRVDRLKSLCDEIN 
Sbjct  4    KGATQLEPWCDLRNKVVLVTGASSGLGKDFCLDLAKAGCRILAAARRVDRLKSLCDEINQ  63

Query  204  VGSGTPL-----------RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR  350
            +    P            RAVA+ELDVSADG  I+  VQ+AWDAFG IDAL+NNAGVRG 
Sbjct  64   MSLSFPTSSSTAEVDIQPRAVAVELDVSADGNTIDKCVQKAWDAFGGIDALVNNAGVRGT  123

Query  351  VHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            V  PL+L+EEEWN + +TN TGTWLVSK VC+RM ++K GGS++NI+SI+GLNRGQL
Sbjct  124  VRDPLELSEEEWNHVIRTNTTGTWLVSKAVCIRMRDSKRGGSVINIASIAGLNRGQL  180



>ref|XP_009394522.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=246

 Score =   203 bits (516),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 133/170 (78%), Gaps = 11/170 (6%)
 Frame = +3

Query  45   PWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPL  224
            PWR L GKV MVTGASSGIGREI LDLA AGCRV+A ARR+DRL+SLCDEI+G GS  P 
Sbjct  5    PWRRLEGKVVMVTGASSGIGREICLDLAAAGCRVVATARRIDRLRSLCDEIDGPGSPLPP  64

Query  225  RA-----------VAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDL  371
             +           VA+ELDVSA G  IEAAVQRAWDAFGRIDALINNAGVRG V++PLD 
Sbjct  65   PSSSFSARSAARSVAVELDVSAGGSVIEAAVQRAWDAFGRIDALINNAGVRGGVYSPLDW  124

Query  372  TEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             EE+WN    TNLTG WLVSKYVC +M NAK  G+++NISSISGLNRG+L
Sbjct  125  PEEDWNATFATNLTGLWLVSKYVCKQMVNAKLKGTVINISSISGLNRGKL  174



>ref|XP_010529958.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X2 [Tarenaya 
hassleriana]
Length=280

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M  +VKV+  LEPW EL  KV +VTGASSG+GRE  LDL +AGCR+IAAARR DRL SLC
Sbjct  1    MNKQVKVSSQLEPWCELGDKVVLVTGASSGLGREFCLDLGRAGCRIIAAARRADRLNSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
            DEIN +GS  P RAVA+ELDV AD   I+A+V++AWD FGRID LINNAG+RG V T LD
Sbjct  61   DEINTLGSAEP-RAVALELDVCADAATIKASVKKAWDMFGRIDVLINNAGIRGTVKTSLD  119

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            L+EEEW+ + +TNLTG WLVSKYVC  +  AK GGS++NISSI+G+ RG L
Sbjct  120  LSEEEWDRVFRTNLTGPWLVSKYVCRLIREAKRGGSVINISSIAGIQRGML  170



>ref|XP_009150759.1| PREDICTED: probable L-xylulose reductase isoform X1 [Brassica 
rapa]
Length=279

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 118/149 (79%), Gaps = 4/149 (3%)
 Frame = +3

Query  18   RVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEI  197
            + +V++ LEPW EL  KV +VTGASSGIGREI LDLAKAGC++IAAARRVDRLKSLC EI
Sbjct  5    QTQVSQQLEPWFELKDKVVLVTGASSGIGREICLDLAKAGCKIIAAARRVDRLKSLCSEI  64

Query  198  NGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTE  377
            N  G    ++A A+ELDVS+D   I+ AV+ AW  FG+IDAL+NNAG+RG V + LDL+E
Sbjct  65   NTTG----VQAAALELDVSSDAATIQQAVKEAWKVFGKIDALVNNAGIRGTVKSSLDLSE  120

Query  378  EEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
             EW+ + KTNL G WLVSKYVC+ MC+AK
Sbjct  121  NEWDKVFKTNLMGAWLVSKYVCILMCDAK  149



>ref|XP_006361353.1| PREDICTED: probable L-xylulose reductase-like, partial [Solanum 
tuberosum]
Length=276

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW++L+GKV MVTGASSGIG E  LDLAKAGC +IAAARRVDRLKSLC++IN    G 
Sbjct  6    MEPWKDLSGKVVMVTGASSGIGLEFCLDLAKAGCNIIAAARRVDRLKSLCNQINSNSKGP  65

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
            P RA+AI+LDV++DG  IE+AVQ AWDAFG IDAL+NNAG+ G VH+ L+L E+EW+++ 
Sbjct  66   P-RAIAIQLDVTSDGATIESAVQIAWDAFGHIDALVNNAGITGNVHSSLELPEKEWDNVF  124

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G WLVSKYVC RM +AK
Sbjct  125  NTNLKGAWLVSKYVCRRMRDAK  146



>ref|XP_009607267.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=285

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 120/153 (78%), Gaps = 2/153 (1%)
 Frame = +3

Query  12   ESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCD  191
              +  +A HLEPWR+L GKV  VTGAS+G+GRE  LDLA+AGC V+AAARRVDRL+SLC 
Sbjct  4    HKKSNMADHLEPWRQLQGKVVFVTGASAGLGREFCLDLARAGCSVVAAARRVDRLESLCH  63

Query  192  EINGVGSGTP--LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPL  365
            EIN + S     +RAV IELDV+ADGP IEA+V++AWDAFG IDALINNAGVRG + + +
Sbjct  64   EINTMASSNTQLVRAVVIELDVTADGPTIEASVKKAWDAFGYIDALINNAGVRGGIKSAV  123

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            DL+EEEW +  +TNLTG+WLVSKYV   M  AK
Sbjct  124  DLSEEEWRNTLQTNLTGSWLVSKYVGRHMKAAK  156



>ref|XP_007202394.1| hypothetical protein PRUPE_ppa009414mg [Prunus persica]
 gb|EMJ03593.1| hypothetical protein PRUPE_ppa009414mg [Prunus persica]
Length=293

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 144/180 (80%), Gaps = 14/180 (8%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +VA HLEPWR L GKV MVTGASSG+GRE+ LDLAKAGCR++AAARR+DRL+S+CDEIN 
Sbjct  4    QVADHLEPWRHLHGKVVMVTGASSGLGRELCLDLAKAGCRIVAAARRIDRLQSVCDEINQ  63

Query  204  VGSGTPL--------------RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGV  341
            +    P               RAVA+ELD+SADGPAIE +V +AWDAFGRIDAL+NNAGV
Sbjct  64   LPVTAPSSSSSSSSVNGPGSSRAVAVELDISADGPAIEKSVNKAWDAFGRIDALVNNAGV  123

Query  342  RGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            RG V + L+L+EEEWN++ KTNLTG+WLVSKYV +RM +A  GGSI+N+SSI+GL+RG L
Sbjct  124  RGNVSSSLELSEEEWNNVFKTNLTGSWLVSKYVSIRMRDADQGGSIINVSSIAGLHRGYL  183



>ref|XP_009778773.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana sylvestris]
Length=285

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 121/153 (79%), Gaps = 2/153 (1%)
 Frame = +3

Query  12   ESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCD  191
            E +   A HLEPWR+L GKV  VTGAS+G+GRE  LDLA+AGC+V+ AARR DRLKSLCD
Sbjct  4    EKKSNAADHLEPWRQLEGKVVFVTGASAGLGREYCLDLARAGCKVVVAARRADRLKSLCD  63

Query  192  EINGVGSGTP--LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPL  365
            EIN + +     +RAVAIEL+V+ADGP IEA++Q+AWDAFG ID LINNAGVRG + + +
Sbjct  64   EINAMANSNIQIVRAVAIELNVTADGPLIEASIQKAWDAFGHIDVLINNAGVRGGLKSAV  123

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            D++EEEW++  +TNLTG+WLVSKYV   M  AK
Sbjct  124  DISEEEWHNTLRTNLTGSWLVSKYVGKHMQAAK  156



>ref|XP_009150760.1| PREDICTED: probable L-xylulose reductase isoform X2 [Brassica 
rapa]
Length=278

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 118/152 (78%), Gaps = 4/152 (3%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V++ LEPW EL  KV +VTGASSGIGREI LDLAKAGC++IAAARRVDRLKSLC
Sbjct  1    MSNLQTVSQQLEPWFELKDKVVLVTGASSGIGREICLDLAKAGCKIIAAARRVDRLKSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
             EIN  G    ++A A+ELDVS+D   I+ AV+ AW  FG+IDAL+NNAG+RG V + LD
Sbjct  61   SEINTTG----VQAAALELDVSSDAATIQQAVKEAWKVFGKIDALVNNAGIRGTVKSSLD  116

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            L+E EW+ + KTNL G WLVSKYVC+ MC+AK
Sbjct  117  LSENEWDKVFKTNLMGAWLVSKYVCILMCDAK  148



>ref|XP_011000407.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Populus euphratica]
 ref|XP_011015779.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Populus euphratica]
Length=290

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 136/177 (77%), Gaps = 11/177 (6%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            KVA   EPW +L  KV +VTGASSG+G++  LDLAKAGCR++AAARRVDRLKSLCDEIN 
Sbjct  4    KVATQFEPWCDLRNKVVLVTGASSGLGKDFCLDLAKAGCRILAAARRVDRLKSLCDEINQ  63

Query  204  VGSGTPL-----------RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR  350
            +    P            RAVA+ELDVSAD   I+  VQ+AWDAFG IDAL+NNAGVRG 
Sbjct  64   MSLSFPTPPSTTEVDIQPRAVAVELDVSADENTIDKCVQKAWDAFGGIDALVNNAGVRGT  123

Query  351  VHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            V  PL+L+EEEWN + +TN TGTWLVSK VC+RM ++K GGS++NI+SI+GLNRGQL
Sbjct  124  VRDPLELSEEEWNHVIRTNTTGTWLVSKAVCIRMRDSKRGGSVINIASIAGLNRGQL  180



>ref|XP_007145483.1| hypothetical protein PHAVU_007G242800g [Phaseolus vulgaris]
 gb|ESW17477.1| hypothetical protein PHAVU_007G242800g [Phaseolus vulgaris]
Length=282

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 136/169 (80%), Gaps = 2/169 (1%)
 Frame = +3

Query  21   VKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEIN  200
            ++  + LEPW +L  KV +VTGASSGIGR++ +DLAKAG  V+AAARR+DRL SLC+EIN
Sbjct  4    IEAEQVLEPWHKLEDKVVLVTGASSGIGRDLCIDLAKAGSYVVAAARRLDRLTSLCNEIN  63

Query  201  GV--GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
             +        RAVA+ELDV+ADG  I+ AVQ+AWDAFGRID+LINNAGVRG V +PL+L+
Sbjct  64   RLWPSPAGNCRAVAVELDVAADGSTIDKAVQKAWDAFGRIDSLINNAGVRGSVKSPLNLS  123

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEW+ + KTN+ G WLVSKYVC RMC+A   GSI+NISS++GLNRGQL
Sbjct  124  EEEWDQVFKTNVRGCWLVSKYVCKRMCDAPMKGSIINISSVAGLNRGQL  172



>ref|XP_009593495.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=285

 Score =   202 bits (513),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 122/153 (80%), Gaps = 2/153 (1%)
 Frame = +3

Query  12   ESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCD  191
            + +   A HLEPWR+L GKV  VTGAS+G+GRE  LDLA++GC+V+AAARR DRLKSLCD
Sbjct  4    QKKSNAADHLEPWRQLEGKVVFVTGASAGLGREYCLDLARSGCKVVAAARRADRLKSLCD  63

Query  192  EINGVGSGTP--LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPL  365
            EIN + S     +RAVA+EL+V+ADGP IEA+VQ+AWDAFG ID LINNAGVRG + + +
Sbjct  64   EINAMASSNVEIVRAVAVELNVTADGPLIEASVQKAWDAFGHIDVLINNAGVRGGLKSAV  123

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            D++E+EW++  +TNLTG+WLVSKYV   M  AK
Sbjct  124  DISEKEWHNTLRTNLTGSWLVSKYVGKHMQAAK  156



>gb|KFK34764.1| hypothetical protein AALP_AA5G190600 [Arabis alpina]
Length=281

 Score =   201 bits (512),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V + LEPW E+  KV +VTGASSGIGREI LDL KAGC++IAAARRVDRLKSLC
Sbjct  1    MSNHQTVLKQLEPWFEVKDKVVLVTGASSGIGREICLDLGKAGCKIIAAARRVDRLKSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
             EIN  GS +   A A+ELDVS+D   I+ AV+ AW  FGRID LINNAG+RG V + LD
Sbjct  61   SEINSFGSNSIKLASALELDVSSDAATIQKAVKEAWAVFGRIDVLINNAGIRGNVKSSLD  120

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            L+E+EW+++ +TNLTG WLVSKYVC+ M +AK GGS++N+SSI+GL+RG L
Sbjct  121  LSEDEWDNVFRTNLTGPWLVSKYVCILMRDAKRGGSVINVSSIAGLHRGML  171



>ref|XP_008455729.1| PREDICTED: uncharacterized oxidoreductase C922.06-like [Cucumis 
melo]
Length=284

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 138/174 (79%), Gaps = 3/174 (2%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME R     HLEPW  L GKV MVTGASSG+GRE  LDLAKAGCRVIAAARR+DRL+SLC
Sbjct  1    MEDRRSSPTHLEPWNCLHGKVVMVTGASSGLGREFCLDLAKAGCRVIAAARRIDRLQSLC  60

Query  189  DEIN--GVGSGTPL-RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHT  359
            DEIN   V S + L RA+A+ELD+SADG +IE +V+ AW++FG IDAL+NNAG RG V T
Sbjct  61   DEINCLNVSSSSSLPRAIAVELDISADGKSIEKSVKNAWESFGFIDALVNNAGFRGTVKT  120

Query  360  PLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             L+L+EEEW+ +  TNL G+WLVSKYVC  M ++K GGS+++ISSISG+ RGQL
Sbjct  121  CLELSEEEWDQVMGTNLKGSWLVSKYVCGHMRDSKRGGSVISISSISGIERGQL  174



>gb|KFK34763.1| hypothetical protein AALP_AA5G190600 [Arabis alpina]
Length=282

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = +3

Query  18   RVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEI  197
            + +V + LEPW E+  KV +VTGASSGIGREI LDL KAGC++IAAARRVDRLKSLC EI
Sbjct  5    QTQVLKQLEPWFEVKDKVVLVTGASSGIGREICLDLGKAGCKIIAAARRVDRLKSLCSEI  64

Query  198  NGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTE  377
            N  GS +   A A+ELDVS+D   I+ AV+ AW  FGRID LINNAG+RG V + LDL+E
Sbjct  65   NSFGSNSIKLASALELDVSSDAATIQKAVKEAWAVFGRIDVLINNAGIRGNVKSSLDLSE  124

Query  378  EEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            +EW+++ +TNLTG WLVSKYVC+ M +AK GGS++N+SSI+GL+RG L
Sbjct  125  DEWDNVFRTNLTGPWLVSKYVCILMRDAKRGGSVINVSSIAGLHRGML  172



>ref|XP_010112832.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Morus notabilis]
 gb|EXC34955.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Morus notabilis]
Length=488

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 136/186 (73%), Gaps = 22/186 (12%)
 Frame = +3

Query  30   ARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEIN---  200
            +  LEPW+ L GKV MVTGASSG+GRE  LDLA AGC VIAAARRVDRLKSLCD+IN   
Sbjct  3    SEQLEPWQNLNGKVVMVTGASSGLGREFCLDLANAGCHVIAAARRVDRLKSLCDQINHDI  62

Query  201  -------------------GVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDAL  323
                               G    + +RAVA+ELDV  DGP IE +V +AWDAFGRIDAL
Sbjct  63   LSPQLSSSSSSSDANIDDDGSRIRSAIRAVAVELDVCGDGPTIEKSVHKAWDAFGRIDAL  122

Query  324  INNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisg  503
            +NNAG+RG V +PLDL+EEEWN + +TNLTGTWLVSK+VC RM +A  GGS++NISSI+G
Sbjct  123  VNNAGIRGNVRSPLDLSEEEWNRVLRTNLTGTWLVSKFVCKRMRDAGRGGSVINISSIAG  182

Query  504  LNRGQL  521
            +NRG L
Sbjct  183  VNRGHL  188


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  339  VRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQ  518
            V G V +PLDL+EEEWN + +TNLTGTWLVSK+VC RM +A  GGS++NISSI+G+NRG 
Sbjct  297  VLGNVRSPLDLSEEEWNRVLRTNLTGTWLVSKFVCKRMRDAGRGGSVINISSIAGVNRGH  356

Query  519  L  521
            L
Sbjct  357  L  357



>ref|XP_004515513.1| PREDICTED: glucose 1-dehydrogenase-like [Cicer arietinum]
Length=284

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 135/174 (78%), Gaps = 7/174 (4%)
 Frame = +3

Query  21   VKVARH---LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCD  191
            ++V+ H   LEPW  L GKV +VTGAS+GIGR   LDLA+AGCRVIAAARRVDRL SLCD
Sbjct  1    MQVSNHHHDLEPWHNLAGKVVLVTGASAGIGRVFCLDLARAGCRVIAAARRVDRLASLCD  60

Query  192  EING----VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHT  359
            EIN     V     LRAVA+E+DV+ADG  IE  V++AW+ FG ID +INNAG RG V +
Sbjct  61   EINQGVQLVDQERSLRAVAVEIDVAADGSVIENYVKKAWEVFGHIDVVINNAGFRGNVSS  120

Query  360  PLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            PL+L+EEEWN + +TN+TGTWLVSKYVC  M +AK  GSI+NISSI+GL+RGQL
Sbjct  121  PLELSEEEWNKVFRTNITGTWLVSKYVCKLMRDAKIKGSIINISSIAGLDRGQL  174



>ref|XP_002876294.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH52553.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=280

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 118/149 (79%), Gaps = 1/149 (1%)
 Frame = +3

Query  18   RVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEI  197
            + +V + LEPW EL  KV +VTGASSGIGREI LDLAKAGC++IAAARRVDRL SLC EI
Sbjct  5    QTQVLKQLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCKIIAAARRVDRLNSLCSEI  64

Query  198  NGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTE  377
            N   S T ++A A ELDVS+D   I+ AV+ AWD FG+IDALINNAG+RG V + LDL+E
Sbjct  65   NSSNS-TGIQAAAFELDVSSDAATIQKAVREAWDIFGKIDALINNAGIRGNVKSSLDLSE  123

Query  378  EEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            +EWN + KTNLTG WLVSKYVC+ M +AK
Sbjct  124  DEWNKVFKTNLTGPWLVSKYVCVLMRDAK  152



>ref|XP_009631506.1| PREDICTED: probable L-xylulose reductase isoform X1 [Nicotiana 
tomentosiformis]
Length=269

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 115/142 (81%), Gaps = 3/142 (2%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW++L+G V MVTGASSGIGRE+ LDLAKA C +IAAARRVD LKSLCDEIN  G+  
Sbjct  1    MEPWKDLSGIVVMVTGASSGIGRELCLDLAKASCSIIAAARRVDSLKSLCDEINSDGT--  58

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              RA A+ELD++A+G  IEAAVQRAWDAFGRIDAL+NNAG+RG + + L L+E+EWN   
Sbjct  59   -RRAFAVELDINANGATIEAAVQRAWDAFGRIDALVNNAGIRGSISSSLKLSEDEWNHTF  117

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G WLVSKYVC RM +AK
Sbjct  118  NTNLRGAWLVSKYVCRRMPDAK  139



>gb|EMT14873.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Aegilops tauschii]
Length=283

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 134/173 (77%), Gaps = 2/173 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M S +     + PW  L G+V +VTGASSGIGR+  LDLA+AGCRV+AAARR DRL+SLC
Sbjct  1    MASSLPEKAGVPPWSRLEGQVVLVTGASSGIGRDFCLDLARAGCRVVAAARRTDRLRSLC  60

Query  189  DEINGVG--SGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTP  362
            DEIN     + +  RAVA+ELDV+A G A+EAAVQRAWDAFGRID LINNAG+RG VH+ 
Sbjct  61   DEINASADAAASHPRAVAVELDVAAGGSAVEAAVQRAWDAFGRIDVLINNAGLRGGVHSS  120

Query  363  LDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LD  E+EW+ L KTNLTG WLV+K+VC  M +AK  GS++NISS++GLNRG L
Sbjct  121  LDWPEDEWDKLIKTNLTGLWLVAKHVCRHMRDAKIKGSVINISSVAGLNRGNL  173



>gb|EPS63859.1| hypothetical protein M569_10924, partial [Genlisea aurea]
Length=269

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 133/160 (83%), Gaps = 6/160 (4%)
 Frame = +3

Query  57   LTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING----VGSGTPL  224
            LT KV MVTGASSGIGR++ LDLAKAGCRVI AARR+DRL SLCDEIN      G+  P 
Sbjct  1    LTDKVVMVTGASSGIGRDLCLDLAKAGCRVIPAARRIDRLASLCDEINAGFNKTGTDEP-  59

Query  225  RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKT  404
            RA  +ELD+SA GPAIEAAV++AW AFGRIDALINNAG+RG VHTPLDL+E+EWN +  T
Sbjct  60   RARPVELDISAAGPAIEAAVEKAWAAFGRIDALINNAGIRGSVHTPLDLSEDEWNQIVTT  119

Query  405  NLTGTWLVSKYVCLRMCNAKF-ggsivnissisgLNRGQL  521
            N+ GTWLVSK+VC RM +AK  GGS++NISSI+GL+RGQL
Sbjct  120  NMKGTWLVSKHVCTRMRDAKQGGGSVINISSIAGLDRGQL  159



>ref|XP_008808086.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Phoenix dactylifera]
Length=294

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 135/169 (80%), Gaps = 10/169 (6%)
 Frame = +3

Query  45   PWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSG---  215
            PW  L GKV MVTGASSGIGR++ ++LAKAGCR++AAARR DRL+SLC+EING       
Sbjct  16   PWSGLEGKVVMVTGASSGIGRDLCVNLAKAGCRIVAAARRTDRLRSLCEEINGGSGSSSS  75

Query  216  -------TPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
                   + +RAVA+ELDVSA G AIEA+VQRAW+AFGRIDAL+NNAG+RG V++PLD +
Sbjct  76   ASSHRVPSFVRAVAVELDVSAGGAAIEASVQRAWEAFGRIDALVNNAGIRGGVYSPLDWS  135

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEWN +  TNLTG WLVSKYVC +M +AK  GS++NISSI G+NRGQL
Sbjct  136  EEEWNHVITTNLTGLWLVSKYVCRQMRDAKQKGSVINISSIGGINRGQL  184



>ref|XP_010427297.1| PREDICTED: probable L-xylulose reductase isoform X2 [Camelina 
sativa]
Length=280

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V+R LEPW EL  KV +VTGASSGIGREI LDLAKAGC++IAAARRVDRL SLC
Sbjct  1    MSNHQTVSRQLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCKIIAAARRVDRLNSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
             EIN   S T ++A A+ELDVS+D   I+ AV+ AW+ FG+ID LINNAG+RG V T LD
Sbjct  61   SEINSYNS-TGIQAAALELDVSSDAATIQKAVKEAWEIFGKIDVLINNAGIRGEVKTSLD  119

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            ++E+EW  + +TNLTG WLVSKYVCL M +AK GGS++NISSI+GL+RG L
Sbjct  120  VSEDEWEKVFRTNLTGPWLVSKYVCLMMRDAKRGGSVINISSIAGLHRGLL  170



>ref|XP_006365803.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Solanum tuberosum]
Length=272

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +E W++LTGKV MVTGASSGIG E  LDLAKAGCR+IA+ARRVDRLK+LC++IN    G 
Sbjct  1    MEQWKDLTGKVVMVTGASSGIGLEFCLDLAKAGCRIIASARRVDRLKTLCNQININSEGL  60

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              R++A++LD++AD   IEAAVQ AWDAFGRID LINNAG+RG V+  LDL EEEW  + 
Sbjct  61   ARRSIAVQLDITADSATIEAAVQIAWDAFGRIDVLINNAGLRGNVYNSLDLPEEEWEHIY  120

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
            KTNL GTWLVSKYVC  M ++K
Sbjct  121  KTNLRGTWLVSKYVCRHMRDSK  142



>ref|XP_010530115.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X4 [Tarenaya 
hassleriana]
Length=279

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 134/169 (79%), Gaps = 1/169 (1%)
 Frame = +3

Query  15   SRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDE  194
            ++ KV+  LEPW EL  KV +VTGASSG+GRE  LDL +AGCR+IAAARR DRL SLCDE
Sbjct  2    NKQKVSSQLEPWCELGDKVVLVTGASSGLGREFCLDLGRAGCRIIAAARRADRLNSLCDE  61

Query  195  INGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
            IN +GS  P RAVA+ELDV AD   I+A+V++AWD FGRID LINNAG+RG V T LDL+
Sbjct  62   INTLGSAEP-RAVALELDVCADAATIKASVKKAWDMFGRIDVLINNAGIRGTVKTSLDLS  120

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEW+ + +TNLTG WLVSKYVC  +  AK GGS++NISSI+G+ RG L
Sbjct  121  EEEWDRVFRTNLTGPWLVSKYVCRLIREAKRGGSVINISSIAGIQRGML  169



>ref|XP_010427295.1| PREDICTED: probable L-xylulose reductase isoform X1 [Camelina 
sativa]
 ref|XP_010427296.1| PREDICTED: probable L-xylulose reductase isoform X1 [Camelina 
sativa]
Length=281

 Score =   200 bits (508),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +3

Query  18   RVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEI  197
            + +V+R LEPW EL  KV +VTGASSGIGREI LDLAKAGC++IAAARRVDRL SLC EI
Sbjct  5    QTQVSRQLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCKIIAAARRVDRLNSLCSEI  64

Query  198  NGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTE  377
            N   S T ++A A+ELDVS+D   I+ AV+ AW+ FG+ID LINNAG+RG V T LD++E
Sbjct  65   NSYNS-TGIQAAALELDVSSDAATIQKAVKEAWEIFGKIDVLINNAGIRGEVKTSLDVSE  123

Query  378  EEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            +EW  + +TNLTG WLVSKYVCL M +AK GGS++NISSI+GL+RG L
Sbjct  124  DEWEKVFRTNLTGPWLVSKYVCLMMRDAKRGGSVINISSIAGLHRGLL  171



>ref|XP_010529885.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X1 [Tarenaya 
hassleriana]
Length=284

 Score =   199 bits (507),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            KV+  LEPW EL  KV +VTGASSG+GRE  LDL +AGCR+IAAARR DRL SLCDEIN 
Sbjct  10   KVSSQLEPWCELGDKVVLVTGASSGLGREFCLDLGRAGCRIIAAARRADRLNSLCDEINT  69

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
            +GS  P RAVA+ELDV AD   I+A+V++AWD FGRID LINNAG+RG V T LDL+EEE
Sbjct  70   LGSAEP-RAVALELDVCADAATIKASVKKAWDMFGRIDVLINNAGIRGTVKTSLDLSEEE  128

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            W+ + +TNLTG WLVSKYVC  +  AK GGS++NISSI+G+ RG L
Sbjct  129  WDRVFRTNLTGPWLVSKYVCRLIREAKRGGSVINISSIAGIQRGML  174



>ref|XP_010943529.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Elaeis guineensis]
Length=295

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 134/168 (80%), Gaps = 9/168 (5%)
 Frame = +3

Query  45   PWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSG---  215
            PW +L G+V MVTGASSGIGR+  ++LAKAGCR++AAARR DRL+SLC+EING       
Sbjct  18   PWSDLEGRVVMVTGASSGIGRDFCVNLAKAGCRIVAAARRTDRLRSLCEEINGGSGSSSA  77

Query  216  ------TPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTE  377
                  + +RAVA+ELDVSA   AIEA+VQ+AW+AFGRIDAL+NNAGVRG V++PLD +E
Sbjct  78   SLARLPSSVRAVAVELDVSAGSAAIEASVQKAWEAFGRIDALVNNAGVRGGVYSPLDWSE  137

Query  378  EEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEWN +  TNLTG WLVSKYVC +M +AK  GS++NISSI G+NRGQL
Sbjct  138  EEWNHIITTNLTGLWLVSKYVCRQMRDAKQKGSVINISSIGGINRGQL  185



>ref|XP_010530193.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X5 [Tarenaya 
hassleriana]
Length=278

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V+  LEPW EL  KV +VTGASSG+GRE  LDL +AGCR+IAAARR DRL SLCDEIN 
Sbjct  4    QVSSQLEPWCELGDKVVLVTGASSGLGREFCLDLGRAGCRIIAAARRADRLNSLCDEINT  63

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
            +GS  P RAVA+ELDV AD   I+A+V++AWD FGRID LINNAG+RG V T LDL+EEE
Sbjct  64   LGSAEP-RAVALELDVCADAATIKASVKKAWDMFGRIDVLINNAGIRGTVKTSLDLSEEE  122

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            W+ + +TNLTG WLVSKYVC  +  AK GGS++NISSI+G+ RG L
Sbjct  123  WDRVFRTNLTGPWLVSKYVCRLIREAKRGGSVINISSIAGIQRGML  168



>ref|XP_009394521.1| PREDICTED: hydroxysteroid dehydrogenase-like protein 2 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=549

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 133/171 (78%), Gaps = 11/171 (6%)
 Frame = +3

Query  42   EPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTP  221
             PWR L GKV MVTGASSGIGREI LDLA AGCRV+A ARR+DRL+SLCDEI+G GS  P
Sbjct  4    PPWRRLEGKVVMVTGASSGIGREICLDLAAAGCRVVATARRIDRLRSLCDEIDGPGSPLP  63

Query  222  LRA-----------VAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
              +           VA+ELDVSA G  IEAAVQRAWDAFGRIDALINNAGVRG V++PLD
Sbjct  64   PPSSSFSARSAARSVAVELDVSAGGSVIEAAVQRAWDAFGRIDALINNAGVRGGVYSPLD  123

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
              EE+WN    TNLTG WLVSKYVC +M NAK  G+++NISSISGLNRG+L
Sbjct  124  WPEEDWNATFATNLTGLWLVSKYVCKQMVNAKLKGTVINISSISGLNRGKL  174



>ref|XP_009124575.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
[Brassica rapa]
Length=296

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 120/153 (78%), Gaps = 4/153 (3%)
 Frame = +3

Query  6    EMESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSL  185
            +M +   V++  EPW EL  KV +VTGASSGIGREI LDLAKAGC++IAAARRVDRLKSL
Sbjct  18   KMSNLQTVSKQQEPWCELKDKVVLVTGASSGIGREICLDLAKAGCKIIAAARRVDRLKSL  77

Query  186  CDEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPL  365
            C EIN  G    ++A A+ELDVS+D   I+ AV+ AW+AFG+IDAL+NNAG+RG V + L
Sbjct  78   CSEINTTG----VQAAALELDVSSDAATIQQAVKEAWEAFGKIDALVNNAGIRGTVKSSL  133

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            DL+E EW+ + KTNLTG WLVSKYVC+ M +AK
Sbjct  134  DLSENEWDKVFKTNLTGAWLVSKYVCILMRDAK  166



>ref|XP_010530038.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X3 [Tarenaya 
hassleriana]
Length=279

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            V+  LEPW EL  KV +VTGASSG+GRE  LDL +AGCR+IAAARR DRL SLCDEIN +
Sbjct  6    VSSQLEPWCELGDKVVLVTGASSGLGREFCLDLGRAGCRIIAAARRADRLNSLCDEINTL  65

Query  207  GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEW  386
            GS  P RAVA+ELDV AD   I+A+V++AWD FGRID LINNAG+RG V T LDL+EEEW
Sbjct  66   GSAEP-RAVALELDVCADAATIKASVKKAWDMFGRIDVLINNAGIRGTVKTSLDLSEEEW  124

Query  387  NDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            + + +TNLTG WLVSKYVC  +  AK GGS++NISSI+G+ RG L
Sbjct  125  DRVFRTNLTGPWLVSKYVCRLIREAKRGGSVINISSIAGIQRGML  169



>ref|XP_009390649.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=283

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 135/175 (77%), Gaps = 5/175 (3%)
 Frame = +3

Query  3    SEMESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKS  182
            +E E+R      L PWR L GKV MVTGASSGIGR++ LDLA+AGC VIAAARR DRL+S
Sbjct  2    AEAETRTP---GLAPWRNLEGKVVMVTGASSGIGRDLCLDLARAGCLVIAAARRTDRLRS  58

Query  183  LCDEINGVGSG--TPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVH  356
            LC+EING G    + +R+VAI LDVSAD P+I A+VQRA DAFGRID L+NNAGVRG VH
Sbjct  59   LCEEINGSGPSQRSAVRSVAIALDVSADEPSIAASVQRACDAFGRIDGLVNNAGVRGSVH  118

Query  357  TPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            +PLD +EE+W+   +TNLTG WLVSK+VC  M +AK  GS++NISSI G  RG L
Sbjct  119  SPLDWSEEDWSSNIRTNLTGLWLVSKHVCKHMRDAKQKGSVINISSIGGTERGHL  173



>emb|CDY29203.1| BnaA06g25540D [Brassica napus]
Length=278

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 119/152 (78%), Gaps = 4/152 (3%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V++  EPW EL  KV +VTGASSGIGREI LDLAKAGC++IAAARRVDRLKSLC
Sbjct  1    MSNLQTVSKQQEPWCELKDKVVLVTGASSGIGREICLDLAKAGCKIIAAARRVDRLKSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
             EIN  G    ++A A+ELDVS+D   I+ AV+ AW+AFG+IDAL+NNAG+RG V + LD
Sbjct  61   SEINTTG----VQAAALELDVSSDAATIQQAVKEAWEAFGKIDALVNNAGIRGTVKSSLD  116

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            L+E EW+ + KTNLTG WLVSKYVC+ M +AK
Sbjct  117  LSENEWDKVFKTNLTGAWLVSKYVCILMRDAK  148



>ref|XP_006403473.1| hypothetical protein EUTSA_v10010610mg [Eutrema salsugineum]
 gb|ESQ44926.1| hypothetical protein EUTSA_v10010610mg [Eutrema salsugineum]
Length=281

 Score =   197 bits (502),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 129/170 (76%), Gaps = 0/170 (0%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V + LEPW EL  KV +VTGASSGIGREI LDL KAGC+VIAAARRVDRLKSLC
Sbjct  1    MSNHQTVLKQLEPWCELKDKVVLVTGASSGIGREICLDLGKAGCKVIAAARRVDRLKSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
             EIN   S     A  +ELDVS+D   I+ AV+ AW  FG+IDALINNAG RG V + L+
Sbjct  61   SEINSFSSTGIQLAAPLELDVSSDAATIQKAVKEAWQVFGKIDALINNAGFRGNVKSSLE  120

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQ  518
            L+EEEWN + +TNLTG WLVSKYVCL M +A  GGS++NISSISGL+RG+
Sbjct  121  LSEEEWNKVFRTNLTGPWLVSKYVCLLMKDANIGGSVINISSISGLHRGK  170



>ref|XP_010418256.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
[Camelina sativa]
Length=280

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 134/171 (78%), Gaps = 1/171 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V R LEPW EL  KV +VTGASSGIGREI LDL KAGC++IAAARRVDRL SLC
Sbjct  1    MNNHQTVLRQLEPWCELKDKVVLVTGASSGIGREICLDLGKAGCKIIAAARRVDRLNSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
             EIN  GS T ++A A+ELDVS+DG  I+ AV+ AW+ FG ID LINNAG+RG V + LD
Sbjct  61   SEINSFGS-TGIQAAALELDVSSDGATIQKAVKEAWEIFGNIDVLINNAGIRGNVKSSLD  119

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             +EEEW+ + +TNLTG+WLVSK+VC+ M +AK GGS +NISSISGL+RG L
Sbjct  120  WSEEEWDKVFRTNLTGSWLVSKHVCVLMRDAKRGGSEINISSISGLHRGLL  170



>ref|XP_010257447.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nelumbo nucifera]
Length=290

 Score =   197 bits (501),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 133/172 (77%), Gaps = 11/172 (6%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVG---  209
            LEPW  L  KV MVTGASSG+GR+  LDLAKAGC+V+AAARR DRLKSLCDEIN +G   
Sbjct  9    LEPWHRLDRKVVMVTGASSGLGRDFCLDLAKAGCKVVAAARRKDRLKSLCDEINQLGSTS  68

Query  210  ------SGTP-LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVR-GRVHTPL  365
                  S  P LRAVA++LD++A GP IEA+VQ+AWDAFGRIDALINNAGVR G V + L
Sbjct  69   SSSENDSNPPSLRAVAVDLDLNAKGPVIEASVQKAWDAFGRIDALINNAGVRGGAVTSLL  128

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            D  E+EWN++  TNLTGTWLVSKY+   M N    GSI+N++SI+GLNRGQL
Sbjct  129  DFPEDEWNNIVTTNLTGTWLVSKYIGRCMSNTNQKGSIINVTSIAGLNRGQL  180



>ref|XP_006291426.1| hypothetical protein CARUB_v10017563mg, partial [Capsella rubella]
 gb|EOA24324.1| hypothetical protein CARUB_v10017563mg, partial [Capsella rubella]
Length=345

 Score =   199 bits (505),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 134/167 (80%), Gaps = 0/167 (0%)
 Frame = +3

Query  21   VKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEIN  200
            V+V + LEPW EL  KV +VTGASSGIGREI LDLAKAGC +IAAARRVDRL SLC EIN
Sbjct  69   VQVLKQLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCNIIAAARRVDRLNSLCSEIN  128

Query  201  GVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEE  380
               + T L+A A+ELDVS+D   I+ AV+ AW+ FG+ID LINNAG+RG V + LD++E+
Sbjct  129  SYNNATGLQAAALELDVSSDAATIQKAVKVAWEIFGKIDVLINNAGIRGEVKSSLDVSED  188

Query  381  EWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EW+ + +TNLTG WLVSKYVC+ M +AK GGS++NISSI+GL+RG L
Sbjct  189  EWDKVFRTNLTGPWLVSKYVCILMRDAKRGGSVINISSIAGLHRGLL  235



>ref|XP_004252861.2| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1-like isoform X2 [Solanum lycopersicum]
Length=613

 Score =   205 bits (521),  Expect = 5e-59, Method: Composition-based stats.
 Identities = 96/142 (68%), Positives = 114/142 (80%), Gaps = 1/142 (1%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW++LTGKV MVTGASSGIG E  LDLAKAGCR+IA+ARRVDRLK+LC++IN    G 
Sbjct  1    MEPWKDLTGKVVMVTGASSGIGLEFCLDLAKAGCRIIASARRVDRLKTLCNKINN-SDGL  59

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              RA+A++LD++AD   I+AAVQ AWDAFGRIDALINNAG+RG V+  LDL EEEW    
Sbjct  60   ARRAIAVQLDITADSATIQAAVQIAWDAFGRIDALINNAGLRGNVYDSLDLPEEEWEHTY  119

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
            KTNL G WLVSKYVC  M ++K
Sbjct  120  KTNLRGAWLVSKYVCRHMRDSK  141



>ref|XP_010314672.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1-like isoform X1 [Solanum lycopersicum]
Length=614

 Score =   205 bits (521),  Expect = 5e-59, Method: Composition-based stats.
 Identities = 96/142 (68%), Positives = 114/142 (80%), Gaps = 1/142 (1%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW++LTGKV MVTGASSGIG E  LDLAKAGCR+IA+ARRVDRLK+LC++IN    G 
Sbjct  1    MEPWKDLTGKVVMVTGASSGIGLEFCLDLAKAGCRIIASARRVDRLKTLCNKINN-SDGL  59

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              RA+A++LD++AD   I+AAVQ AWDAFGRIDALINNAG+RG V+  LDL EEEW    
Sbjct  60   ARRAIAVQLDITADSATIQAAVQIAWDAFGRIDALINNAGLRGNVYDSLDLPEEEWEHTY  119

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
            KTNL G WLVSKYVC  M ++K
Sbjct  120  KTNLRGAWLVSKYVCRHMRDSK  141



>ref|XP_010473483.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
[Camelina sativa]
Length=280

 Score =   196 bits (499),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 133/171 (78%), Gaps = 1/171 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V R LEPW EL  KV +VTGASSGIGREI LDL KAGC++IAAARRV RL SLC
Sbjct  1    MNNHQTVLRQLEPWCELKDKVVLVTGASSGIGREICLDLGKAGCKIIAAARRVVRLNSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
             EIN  GS T ++A A+ELDVS+DG  I+ AV+ AW+ FG ID LINNAG+RG V + LD
Sbjct  61   SEINSCGS-TGIQAAALELDVSSDGATIQKAVKEAWEIFGNIDVLINNAGIRGNVKSSLD  119

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             +EEEW+ + +TNLTG+WLVSKYVCL M  AK GGS++NISSISGL+RG L
Sbjct  120  WSEEEWDKVFRTNLTGSWLVSKYVCLLMREAKRGGSVINISSISGLHRGLL  170



>ref|XP_010504386.1| PREDICTED: probable L-xylulose reductase isoform X2 [Camelina 
sativa]
Length=280

 Score =   196 bits (499),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 133/171 (78%), Gaps = 1/171 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V R LEPW EL  KV +VTGASSGIGREI LDLAKAGC++IAAARRVDRL SLC
Sbjct  1    MSNHQTVLRQLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCKIIAAARRVDRLNSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
             EIN   S T ++A A+ELDVS+D   I+ AV+ AW+ F +ID LINNAG+RG V T LD
Sbjct  61   SEINSYNS-TGIQAAAVELDVSSDAATIQKAVKEAWEIFEKIDVLINNAGIRGEVKTSLD  119

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            ++E+EW  + +TNLTG WLVSKYVCL M +AK GGS++NISSI+GL+RG L
Sbjct  120  VSEDEWEKVFRTNLTGPWLVSKYVCLMMRDAKRGGSVINISSIAGLHRGLL  170



>ref|XP_010504384.1| PREDICTED: probable L-xylulose reductase isoform X1 [Camelina 
sativa]
 ref|XP_010504385.1| PREDICTED: probable L-xylulose reductase isoform X1 [Camelina 
sativa]
Length=281

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +3

Query  18   RVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEI  197
            + +V R LEPW EL  KV +VTGASSGIGREI LDLAKAGC++IAAARRVDRL SLC EI
Sbjct  5    QTQVLRQLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCKIIAAARRVDRLNSLCSEI  64

Query  198  NGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTE  377
            N   S T ++A A+ELDVS+D   I+ AV+ AW+ F +ID LINNAG+RG V T LD++E
Sbjct  65   NSYNS-TGIQAAAVELDVSSDAATIQKAVKEAWEIFEKIDVLINNAGIRGEVKTSLDVSE  123

Query  378  EEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            +EW  + +TNLTG WLVSKYVCL M +AK GGS++NISSI+GL+RG L
Sbjct  124  DEWEKVFRTNLTGPWLVSKYVCLMMRDAKRGGSVINISSIAGLHRGLL  171



>ref|NP_974441.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE79366.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=279

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V + LEPW EL  KV +VTGASSGIGREI LDLAKAGC+VIAAARRVDRL SLC
Sbjct  1    MSNHQTVLKLLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
             EIN   S T ++A A+ELDVS+D   I+ AV+ AWD FG+IDALINNAG+RG V + LD
Sbjct  61   SEINSFSS-TGIQAAALELDVSSDAATIQKAVREAWDIFGKIDALINNAGIRGNVKSSLD  119

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            L+E+EW+++ KTNL G WLVSK+VC+ M +AK
Sbjct  120  LSEDEWDNVFKTNLKGPWLVSKHVCMLMRDAK  151



>ref|XP_010516097.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
isoform X2 [Camelina sativa]
Length=280

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 133/171 (78%), Gaps = 1/171 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V R LEPW EL  KV +VTGASSGIGREI LDLAKAGC++IAAARRVDRL SLC
Sbjct  1    MSNHQTVLRQLEPWCELEDKVVLVTGASSGIGREICLDLAKAGCKIIAAARRVDRLNSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
             +IN   S T  +A A+ELDVS+D   I+ AV+ AW+ FG+ID LINNAG+RG V T LD
Sbjct  61   SQINSYNS-TGTQAAALELDVSSDALTIQKAVKEAWEIFGKIDVLINNAGIRGEVKTSLD  119

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            ++E+EW  + +TNLTG WLVSKYVCL M +AK GGS++NISSI+GL+RG L
Sbjct  120  VSEDEWEKVFRTNLTGPWLVSKYVCLLMRDAKRGGSVINISSIAGLHRGLL  170



>ref|XP_004249129.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Solanum lycopersicum]
Length=291

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 118/148 (80%), Gaps = 2/148 (1%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            VA HLEPW +L GKV  VTGAS+G+GRE  LDLA++GCRV+A ARR DRLKSLCDEIN +
Sbjct  15   VANHLEPWLQLEGKVVFVTGASAGLGREFCLDLARSGCRVVAGARRADRLKSLCDEINTM  74

Query  207  GSGTP--LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEE  380
             S     +RA+AIELDV+ADG  IEA+V++AWDAFG IDALINNAGVRG + + +D++ E
Sbjct  75   SSSNSHLVRAMAIELDVTADGTTIEASVKKAWDAFGHIDALINNAGVRGGIKSSVDISWE  134

Query  381  EWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            EW +  +TNLTG+WLVSKYV  +M  +K
Sbjct  135  EWENTLRTNLTGSWLVSKYVGRQMQASK  162



>ref|XP_006301634.1| hypothetical protein CARUB_v10022077mg, partial [Capsella rubella]
 gb|EOA34532.1| hypothetical protein CARUB_v10022077mg, partial [Capsella rubella]
Length=274

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            V R LEPW EL  KV +VTGASSGIGREI LDL KAGC++IAAARRVDRL SLC E N  
Sbjct  1    VLRQLEPWCELKDKVVLVTGASSGIGREICLDLGKAGCKIIAAARRVDRLNSLCSEFNSF  60

Query  207  GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEW  386
            G+ T + A A+ELDVS+DG  I+ AVQ AW+ FG ID LINNAG+RG V + LD +EEEW
Sbjct  61   GT-TGVHAAALELDVSSDGATIKRAVQEAWEIFGNIDVLINNAGIRGNVKSSLDWSEEEW  119

Query  387  NDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            + + +TNLTG+WLVSKYVC+ M +AK GGS++NISSISGL+RG L
Sbjct  120  DKVFRTNLTGSWLVSKYVCVLMRDAKRGGSVINISSISGLHRGLL  164



>ref|XP_006361361.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Solanum tuberosum]
Length=297

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW++L+GKV MVTGASSGIG E  LDLAKAGC++IAAARRV+RLKSLCD+IN    G 
Sbjct  28   MEPWKDLSGKVVMVTGASSGIGLEFCLDLAKAGCKIIAAARRVERLKSLCDQINSNSEGL  87

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              RA+ ++LDV+ADG  IE+AVQ AWD FGRID L+NNAGV G+ H+ L+L+EEEW+++ 
Sbjct  88   Q-RAIVVQLDVTADGATIESAVQIAWDTFGRIDVLVNNAGVTGK-HSSLELSEEEWDNMF  145

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G WLVSKYVC RM +AK
Sbjct  146  NTNLKGAWLVSKYVCRRMRDAK  167



>ref|NP_001185300.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE34093.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=215

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V + LEPW EL  KV +VTGASSGIGREI LDL KAGC+++AAARRVDRL SLC EIN 
Sbjct  8    QVLKQLEPWCELKDKVVLVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLCSEINS  67

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
             G+   ++AVA+ELDVS++   I  AV+ AW+ FG+ID LINNAG+RG V + LDL+EEE
Sbjct  68   FGA-IGVQAVALELDVSSEADTIRKAVKEAWETFGKIDVLINNAGIRGNVKSSLDLSEEE  126

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            W+ + +TNLTG+WL+SKYVCL M +A+ GGS++N+SSISGL+RG L
Sbjct  127  WDKVFRTNLTGSWLISKYVCLLMRDAERGGSVINVSSISGLHRGLL  172



>ref|NP_567019.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAK76629.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AAL85073.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AEE79365.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=280

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = +3

Query  18   RVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEI  197
            + +V + LEPW EL  KV +VTGASSGIGREI LDLAKAGC+VIAAARRVDRL SLC EI
Sbjct  5    QTQVLKLLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEI  64

Query  198  NGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTE  377
            N   S T ++A A+ELDVS+D   I+ AV+ AWD FG+IDALINNAG+RG V + LDL+E
Sbjct  65   NSFSS-TGIQAAALELDVSSDAATIQKAVREAWDIFGKIDALINNAGIRGNVKSSLDLSE  123

Query  378  EEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            +EW+++ KTNL G WLVSK+VC+ M +AK
Sbjct  124  DEWDNVFKTNLKGPWLVSKHVCMLMRDAK  152



>ref|XP_010516096.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
isoform X1 [Camelina sativa]
Length=281

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +3

Query  18   RVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEI  197
            + +V R LEPW EL  KV +VTGASSGIGREI LDLAKAGC++IAAARRVDRL SLC +I
Sbjct  5    QTQVLRQLEPWCELEDKVVLVTGASSGIGREICLDLAKAGCKIIAAARRVDRLNSLCSQI  64

Query  198  NGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTE  377
            N   S T  +A A+ELDVS+D   I+ AV+ AW+ FG+ID LINNAG+RG V T LD++E
Sbjct  65   NSYNS-TGTQAAALELDVSSDALTIQKAVKEAWEIFGKIDVLINNAGIRGEVKTSLDVSE  123

Query  378  EEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            +EW  + +TNLTG WLVSKYVCL M +AK GGS++NISSI+GL+RG L
Sbjct  124  DEWEKVFRTNLTGPWLVSKYVCLLMRDAKRGGSVINISSIAGLHRGLL  171



>ref|NP_191091.2| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAD44022.1| beta-ketoacyl-ACP reductase - like protein [Arabidopsis thaliana]
 gb|AEE79367.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=279

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V + LEPW EL  KV +VTGASSGIGREI LDLAKAGC+VIAAARRVDRL SLC
Sbjct  1    MSNHQTVLKQLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
             EIN   S T ++A A+ELDVS+D   I+ AV+ AWD FG+IDALINNAG+RG V   LD
Sbjct  61   SEINSFSS-TGIQAAALELDVSSDAATIQKAVREAWDIFGKIDALINNAGIRGNVKLSLD  119

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            L+E+EW+++  TNL G WLV+KYVC+ M +AK
Sbjct  120  LSEDEWDNVFNTNLKGPWLVAKYVCVLMRDAK  151



>ref|XP_006291425.1| hypothetical protein CARUB_v10017563mg, partial [Capsella rubella]
 gb|EOA24323.1| hypothetical protein CARUB_v10017563mg, partial [Capsella rubella]
Length=344

 Score =   196 bits (499),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            V + LEPW EL  KV +VTGASSGIGREI LDLAKAGC +IAAARRVDRL SLC EIN  
Sbjct  70   VLKQLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCNIIAAARRVDRLNSLCSEINSY  129

Query  207  GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEW  386
             + T L+A A+ELDVS+D   I+ AV+ AW+ FG+ID LINNAG+RG V + LD++E+EW
Sbjct  130  NNATGLQAAALELDVSSDAATIQKAVKVAWEIFGKIDVLINNAGIRGEVKSSLDVSEDEW  189

Query  387  NDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            + + +TNLTG WLVSKYVC+ M +AK GGS++NISSI+GL+RG L
Sbjct  190  DKVFRTNLTGPWLVSKYVCILMRDAKRGGSVINISSIAGLHRGLL  234



>emb|CAB75763.1| oxidoreductase-like protein [Arabidopsis thaliana]
Length=273

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            V + LEPW EL  KV +VTGASSGIGREI LDLAKAGC+VIAAARRVDRL SLC EIN  
Sbjct  1    VLKLLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEINSF  60

Query  207  GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEW  386
             S T ++A A+ELDVS+D   I+ AV+ AWD FG+IDALINNAG+RG V + LDL+E+EW
Sbjct  61   SS-TGIQAAALELDVSSDAATIQKAVREAWDIFGKIDALINNAGIRGNVKSSLDLSEDEW  119

Query  387  NDLTKTNLTGTWLVSKYVCLRMCNAK  464
            +++ KTNL G WLVSK+VC+ M +AK
Sbjct  120  DNVFKTNLKGPWLVSKHVCMLMRDAK  145



>ref|XP_009139176.1| PREDICTED: probable L-xylulose reductase isoform X1 [Brassica 
rapa]
Length=283

 Score =   194 bits (493),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            ++ + LEPW EL  KV ++TGASSGIGRE+ LDL KAGC++IAAARRVDRL+SLC EIN 
Sbjct  8    QMLKQLEPWCELKDKVVLLTGASSGIGREVCLDLGKAGCKIIAAARRVDRLESLCSEINS  67

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
            + S     A  IELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDLTE+E
Sbjct  68   LSSTGIQLAAPIELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTSLDLTEDE  127

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            WN + +TNL+G WLVSKYVC  M +AK GGS++N+SSI+GL+RG L
Sbjct  128  WNTVFRTNLSGPWLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLL  173



>ref|NP_176527.4| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE34092.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=282

 Score =   194 bits (492),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V + LEPW EL  KV +VTGASSGIGREI LDL KAGC+++AAARRVDRL SLC
Sbjct  1    MSNHQTVLKQLEPWCELKDKVVLVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
             EIN  G+   ++AVA+ELDVS++   I  AV+ AW+ FG+ID LINNAG+RG V + LD
Sbjct  61   SEINSFGA-IGVQAVALELDVSSEADTIRKAVKEAWETFGKIDVLINNAGIRGNVKSSLD  119

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            L+EEEW+ + +TNLTG+WL+SKYVCL M +A+ GGS++N+SSISGL+RG L
Sbjct  120  LSEEEWDKVFRTNLTGSWLISKYVCLLMRDAERGGSVINVSSISGLHRGLL  170



>ref|XP_009139177.1| PREDICTED: probable L-xylulose reductase isoform X2 [Brassica 
rapa]
Length=282

 Score =   194 bits (492),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 129/163 (79%), Gaps = 0/163 (0%)
 Frame = +3

Query  33   RHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGS  212
            + LEPW EL  KV ++TGASSGIGRE+ LDL KAGC++IAAARRVDRL+SLC EIN + S
Sbjct  10   KQLEPWCELKDKVVLLTGASSGIGREVCLDLGKAGCKIIAAARRVDRLESLCSEINSLSS  69

Query  213  GTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWND  392
                 A  IELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDLTE+EWN 
Sbjct  70   TGIQLAAPIELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTSLDLTEDEWNT  129

Query  393  LTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            + +TNL+G WLVSKYVC  M +AK GGS++N+SSI+GL+RG L
Sbjct  130  VFRTNLSGPWLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLL  172



>ref|XP_009139180.1| PREDICTED: probable L-xylulose reductase isoform X4 [Brassica 
rapa]
Length=275

 Score =   193 bits (491),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 129/163 (79%), Gaps = 0/163 (0%)
 Frame = +3

Query  33   RHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGS  212
            + LEPW EL  KV ++TGASSGIGRE+ LDL KAGC++IAAARRVDRL+SLC EIN + S
Sbjct  3    KQLEPWCELKDKVVLLTGASSGIGREVCLDLGKAGCKIIAAARRVDRLESLCSEINSLSS  62

Query  213  GTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWND  392
                 A  IELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDLTE+EWN 
Sbjct  63   TGIQLAAPIELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTSLDLTEDEWNT  122

Query  393  LTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            + +TNL+G WLVSKYVC  M +AK GGS++N+SSI+GL+RG L
Sbjct  123  VFRTNLSGPWLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLL  165



>ref|XP_004170137.1| PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[acyl-carrier-protein] 
reductase FabG-like [Cucumis sativus]
Length=286

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 134/176 (76%), Gaps = 5/176 (3%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M  R     HLEPW  L GKV MVTGASSG+GRE  LDLAKAGC+VIAAARR+DRL+SLC
Sbjct  1    MGERQSSPTHLEPWNSLHGKVVMVTGASSGLGREFCLDLAKAGCKVIAAARRIDRLQSLC  60

Query  189  DEINGVGSGTPLR-----AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRV  353
            DEIN +   +        A+A+ELD+SADG +IE +V+ AW++FG IDAL+NNAG RG V
Sbjct  61   DEINRLNLSSSSSLPTPTAIAVELDISADGKSIEKSVKNAWESFGFIDALVNNAGFRGNV  120

Query  354  HTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             T L+L+EEEW+ +  TNL G+WLVSKYVC  M ++K GGS+++ISSISG+ RGQL
Sbjct  121  KTCLELSEEEWDQVMGTNLKGSWLVSKYVCSHMRDSKRGGSVISISSISGIERGQL  176



>ref|XP_004144326.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
 gb|KGN54691.1| hypothetical protein Csa_4G427270 [Cucumis sativus]
Length=286

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 134/176 (76%), Gaps = 5/176 (3%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M  R     HLEPW  L GKV MVTGASSG+GRE  LDLAKAGC+VIAAARR+DRL+SLC
Sbjct  1    MGERQSSPTHLEPWNSLHGKVVMVTGASSGLGREFCLDLAKAGCKVIAAARRIDRLQSLC  60

Query  189  DEINGVGSGTPLR-----AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRV  353
            DEIN +   +        A+A+ELD+SADG +IE +V+ AW++FG IDAL+NNAG RG V
Sbjct  61   DEINRLNLSSSSSLPTPTAIAVELDISADGKSIEKSVKNAWESFGFIDALVNNAGFRGNV  120

Query  354  HTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             T L+L+EEEW+ +  TNL G+WLVSKYVC  M ++K GGS+++ISSISG+ RGQL
Sbjct  121  KTCLELSEEEWDQVMGTNLKGSWLVSKYVCSHMRDSKRGGSVISISSISGIERGQL  176



>emb|CDX76107.1| BnaA04g03710D [Brassica napus]
Length=280

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 131/169 (78%), Gaps = 0/169 (0%)
 Frame = +3

Query  15   SRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDE  194
            S  +  + LEPW EL  KV ++TGASSGIGRE+ LDL KAGC++IAAARRVDRL+SLC E
Sbjct  2    SNHQTTKQLEPWCELKDKVVLLTGASSGIGREVCLDLGKAGCKIIAAARRVDRLESLCSE  61

Query  195  INGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
            IN + S     A  +ELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDLT
Sbjct  62   INSLSSTGIQLAAPLELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTSLDLT  121

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            E+EWN + +TNL+G WLVSKYVC  M +AK GGS++N+SSI+GL+RG L
Sbjct  122  EDEWNTVFRTNLSGPWLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLL  170



>emb|CAB75765.1| beta-ketoacyl-ACP reductase-like protein [Arabidopsis thaliana]
Length=298

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 115/146 (79%), Gaps = 1/146 (1%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            V + LEPW EL  KV +VTGASSGIGREI LDLAKAGC+VIAAARRVDRL SLC EIN  
Sbjct  26   VLKQLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEINSF  85

Query  207  GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEW  386
             S T ++A A+ELDVS+D   I+ AV+ AWD FG+IDALINNAG+RG V   LDL+E+EW
Sbjct  86   SS-TGIQAAALELDVSSDAATIQKAVREAWDIFGKIDALINNAGIRGNVKLSLDLSEDEW  144

Query  387  NDLTKTNLTGTWLVSKYVCLRMCNAK  464
            +++  TNL G WLV+KYVC+ M +AK
Sbjct  145  DNVFNTNLKGPWLVAKYVCVLMRDAK  170



>gb|AAF19703.1|AC008047_10 F2K11.24 [Arabidopsis thaliana]
Length=287

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V + LEPW EL  KV +VTGASSGIGREI LDL KAGC+++AAARRVDRL SLC EIN 
Sbjct  11   QVLKQLEPWCELKDKVVLVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLCSEINS  70

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
             G+   ++AVA+ELDVS++   I  AV+ AW+ FG+ID LINNAG+RG V + LDL+EEE
Sbjct  71   FGA-IGVQAVALELDVSSEADTIRKAVKEAWETFGKIDVLINNAGIRGNVKSSLDLSEEE  129

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            W+ + +TNLTG+WL+SKYVCL M +A+ GGS++N+SSISGL+RG L
Sbjct  130  WDKVFRTNLTGSWLISKYVCLLMRDAERGGSVINVSSISGLHRGLL  175



>ref|XP_006403474.1| hypothetical protein EUTSA_v10010605mg [Eutrema salsugineum]
 gb|ESQ44927.1| hypothetical protein EUTSA_v10010605mg [Eutrema salsugineum]
Length=285

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 116/149 (78%), Gaps = 1/149 (1%)
 Frame = +3

Query  18   RVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEI  197
            + +V + +EPW EL  KV +VTGASSGIGREI LDL KAGC++IAAARR+DRLKSLC EI
Sbjct  5    QTQVLKQIEPWCELKDKVVLVTGASSGIGREICLDLGKAGCKIIAAARRIDRLKSLCSEI  64

Query  198  NGVGS-GTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
            N   S GT   A  +ELDVS+D   I+ AV++AW  FG+IDALINNAG+RG V T L+L+
Sbjct  65   NSFNSTGTNQLAAPLELDVSSDAATIQKAVKKAWQVFGKIDALINNAGIRGNVKTSLELS  124

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNA  461
            E+EW+ + +TNLTG WLVSKYVC+ M +A
Sbjct  125  EQEWDKVLRTNLTGPWLVSKYVCILMRDA  153



>gb|KFK40341.1| hypothetical protein AALP_AA3G361500 [Arabis alpina]
Length=284

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = +3

Query  15   SRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDE  194
            S+ +V + LEPW EL  KV ++TGASSGIGR+I LDL K+GC++IAAARRVDRL SLC E
Sbjct  7    SKKQVVKQLEPWCELKDKVVLLTGASSGIGRDICLDLGKSGCKIIAAARRVDRLNSLCSE  66

Query  195  INGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
            IN  GS T ++A  +ELDV++D   I+ AV+ AW+ FG+ID LINNAG+RG V + LDL+
Sbjct  67   INSFGS-TGIQAAPLELDVTSDAATIQNAVKEAWEIFGKIDVLINNAGIRGTVKSSLDLS  125

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            +EEW+ + +TNLTG WLVSKYV + MC+AK GGS++NISS++GL RG+L
Sbjct  126  KEEWDKVFRTNLTGPWLVSKYVGVLMCDAKRGGSVINISSVAGLRRGEL  174



>ref|XP_009391879.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = +3

Query  54   ELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLRAV  233
             L GKV MVTGAS+GIGREI LDLA AGC+++AAARRVDRLKSLCDEING  S   ++AV
Sbjct  12   SLKGKVVMVTGASAGIGREICLDLAAAGCKIVAAARRVDRLKSLCDEING--SSNTVQAV  69

Query  234  AIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLT  413
            A+ELDVS   PAIEAAV  AW+AFGRIDAL+NNAGVRG V++ +D +EEEW+ +  TNLT
Sbjct  70   AVELDVSRKSPAIEAAVHDAWNAFGRIDALVNNAGVRGGVYSAVDWSEEEWHRIMTTNLT  129

Query  414  GTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            G WLVSK+VC+RM +A   G+++NISSI+G+ RGQL
Sbjct  130  GLWLVSKHVCIRMRDATQKGAVINISSIAGVARGQL  165



>ref|XP_009139179.1| PREDICTED: probable L-xylulose reductase isoform X3 [Brassica 
rapa]
Length=279

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +3

Query  36   HLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSG  215
             LEPW EL  KV ++TGASSGIGRE+ LDL KAGC++IAAARRVDRL+SLC EIN + S 
Sbjct  8    QLEPWCELKDKVVLLTGASSGIGREVCLDLGKAGCKIIAAARRVDRLESLCSEINSLSST  67

Query  216  TPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDL  395
                A  IELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDLTE+EWN +
Sbjct  68   GIQLAAPIELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTSLDLTEDEWNTV  127

Query  396  TKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             +TNL+G WLVSKYVC  M +AK GGS++N+SSI+GL+RG L
Sbjct  128  FRTNLSGPWLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLL  169



>emb|CDY07814.1| BnaC03g48080D [Brassica napus]
Length=278

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 118/152 (78%), Gaps = 4/152 (3%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V++  EPW EL   V +VTGASSGIGREI LDLAKAGC++IAAARRVDRLKSLC
Sbjct  1    MSNLQTVSKQQEPWCELKDIVVLVTGASSGIGREICLDLAKAGCKIIAAARRVDRLKSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
             EIN  G    +++ A+ELDVS+D   I+ AV+ AW+ FG+IDAL+NNAG+RG V + LD
Sbjct  61   SEINTTG----VQSAALELDVSSDAATIQKAVKEAWEVFGKIDALVNNAGIRGTVKSSLD  116

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            L+E+EW+ + KTNLTG WLVSKYVC+ M +AK
Sbjct  117  LSEKEWDKVFKTNLTGAWLVSKYVCILMRDAK  148



>emb|CDY65313.1| BnaCnng46610D [Brassica napus]
Length=282

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = +3

Query  18   RVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEI  197
            +  V + LEPW EL GKV ++TGASSGIG E+ LDL KAGC++IAAARRV RL+SLC EI
Sbjct  5    QTTVLKQLEPWCELNGKVVLLTGASSGIGSEVCLDLGKAGCKIIAAARRVHRLESLCSEI  64

Query  198  NGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTE  377
            N + S     A  +ELDVS+D   I+ AV++AWD +G+ID LINNAG+RG V T LDLTE
Sbjct  65   NSLSSTGIQLAAPLELDVSSDAATIQKAVKQAWDIYGKIDVLINNAGIRGNVKTSLDLTE  124

Query  378  EEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            +EWN + +TNLTG WLVSKYVC  M +AK GGS++N+SSI+GL+RG L
Sbjct  125  DEWNTVFRTNLTGPWLVSKYVCSLMRDAKGGGSVINVSSIAGLHRGLL  172



>emb|CDP21456.1| unnamed protein product [Coffea canephora]
Length=288

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 134/182 (74%), Gaps = 15/182 (8%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME RV+     EPW  L GK+  VTGASSG+GRE  LDLAKAGC+V+AAARR++RLKSLC
Sbjct  1    MEDRVQ----FEPWSHLDGKIVFVTGASSGLGREFCLDLAKAGCKVVAAARRLERLKSLC  56

Query  189  DEINGV----GSGTPL-------RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNA  335
            DEIN +     + +P+       RAVA+ELDV+AD   IE +VQRAW+AFG IDA++NNA
Sbjct  57   DEINQLFPSPSTSSPVELDPNSTRAVAVELDVTADASTIETSVQRAWNAFGHIDAVVNNA  116

Query  336  GVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRG  515
            GVRG + + LDLTE EWN   +TNLTG WLVSKYV  +M  A  GG IVN+SSISGLNR 
Sbjct  117  GVRGSISSSLDLTENEWNSTMRTNLTGAWLVSKYVGRQMREACTGGCIVNVSSISGLNRA  176

Query  516  QL  521
            Q+
Sbjct  177  QM  178



>emb|CDY48725.1| BnaA09g10000D [Brassica napus]
Length=287

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            KV   LEPWR+L  KV +VTGASSGIG+EI LDL KAGC++IAAARRVDRL SLC +IN 
Sbjct  13   KVLTKLEPWRDLKDKVVLVTGASSGIGKEICLDLGKAGCKIIAAARRVDRLNSLCSDINS  72

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
             GS T  +A  +ELDV++D   I  AV +AW+ FG+ID LINNAG+RG V + LDL+E+E
Sbjct  73   FGS-TGTQAAVLELDVASDAATIRKAVNKAWEVFGKIDVLINNAGIRGNVKSSLDLSEDE  131

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            W+ + +TNLTG WLVSKYVC+ M +AK GGS++NISS++G++RG L
Sbjct  132  WDKVFRTNLTGPWLVSKYVCILMRDAKQGGSVINISSMAGVHRGML  177



>ref|NP_974072.1| putative ketoacyl-ACP reductase [Arabidopsis thaliana]
 gb|AEE33984.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=276

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = +3

Query  21   VKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEIN  200
            ++V + LEPW EL  KV +VTGASSGIGREI LDL KAGC+++AAARRVDRL SLC EIN
Sbjct  1    MQVLKQLEPWCELKDKVVLVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLCSEIN  60

Query  201  GVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEE  380
              G+   ++A A+ELDVS+D   I  AV+ AW+ FG ID LINNAG+RG V + LDL++E
Sbjct  61   SFGA-IGVQAAALELDVSSDADTIRKAVKEAWEIFGTIDVLINNAGIRGNVKSSLDLSKE  119

Query  381  EWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EW+ + +TNLTG+WL+SKYVCL M +AK GGS++N+SSISGL+RG L
Sbjct  120  EWDKVFRTNLTGSWLISKYVCLLMRDAKRGGSVINVSSISGLHRGLL  166



>emb|CDY44938.1| BnaA02g04430D [Brassica napus]
Length=284

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V + LEPW EL  KV ++TGASSGIGRE+ LDL KAGC++IAAARRVDRL+SLC EIN 
Sbjct  9    QVLKQLEPWCELKDKVVLLTGASSGIGREVCLDLGKAGCKIIAAARRVDRLESLCSEINS  68

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
            + S   + A  +ELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDL+E+E
Sbjct  69   LSSTGIILAAPLELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTCLDLSEDE  128

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNR  512
            W+ + +TNLTG WLVSKYVC  M +AK GGS++N+SSI+GLNR
Sbjct  129  WDRVFRTNLTGVWLVSKYVCSLMRDAKRGGSVINVSSIAGLNR  171



>ref|NP_001031220.1| putative ketoacyl-ACP reductase [Arabidopsis thaliana]
 gb|AAV74220.1| At1g62610 [Arabidopsis thaliana]
 gb|AAW78588.1| At1g62610 [Arabidopsis thaliana]
 gb|AEE33985.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=278

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V + LEPW EL  KV +VTGASSGIGREI LDL KAGC+++AAARRVDRL SLC EIN 
Sbjct  4    QVLKQLEPWCELKDKVVLVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLCSEINS  63

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
             G+   ++A A+ELDVS+D   I  AV+ AW+ FG ID LINNAG+RG V + LDL++EE
Sbjct  64   FGA-IGVQAAALELDVSSDADTIRKAVKEAWEIFGTIDVLINNAGIRGNVKSSLDLSKEE  122

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            W+ + +TNLTG+WL+SKYVCL M +AK GGS++N+SSISGL+RG L
Sbjct  123  WDKVFRTNLTGSWLISKYVCLLMRDAKRGGSVINVSSISGLHRGLL  168



>emb|CDX73333.1| BnaC05g27730D [Brassica napus]
Length=280

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V + LEPW EL  KV ++TGASSGIGRE+ LDL KAGC++IAAARRVDRL+SLC EIN 
Sbjct  5    QVLKQLEPWCELKDKVVLLTGASSGIGREVCLDLGKAGCKIIAAARRVDRLESLCSEINS  64

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
            + S   + A  +ELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDL+E+E
Sbjct  65   LSSTGIILAAPLELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTCLDLSEDE  124

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNR  512
            W+ + +TNLTG WLVSKYVC  M +AK GGS++N+SSI+GLNR
Sbjct  125  WDRVFRTNLTGVWLVSKYVCSLMRDAKRGGSVINVSSIAGLNR  167



>ref|NP_176449.2| putative ketoacyl-ACP reductase [Arabidopsis thaliana]
 gb|AEE33983.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=277

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V + LEPW EL  KV +VTGASSGIGREI LDL KAGC+++AAARRVDRL SLC EIN 
Sbjct  3    QVLKQLEPWCELKDKVVLVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLCSEINS  62

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
             G+   ++A A+ELDVS+D   I  AV+ AW+ FG ID LINNAG+RG V + LDL++EE
Sbjct  63   FGA-IGVQAAALELDVSSDADTIRKAVKEAWEIFGTIDVLINNAGIRGNVKSSLDLSKEE  121

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            W+ + +TNLTG+WL+SKYVCL M +AK GGS++N+SSISGL+RG L
Sbjct  122  WDKVFRTNLTGSWLISKYVCLLMRDAKRGGSVINVSSISGLHRGLL  167



>ref|NP_001185294.1| putative ketoacyl-ACP reductase [Arabidopsis thaliana]
 gb|AEE33986.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=282

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V + LEPW EL  KV +VTGASSGIGREI LDL KAGC+++AAARRVDRL SLC EIN 
Sbjct  8    QVLKQLEPWCELKDKVVLVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLCSEINS  67

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
             G+   ++A A+ELDVS+D   I  AV+ AW+ FG ID LINNAG+RG V + LDL++EE
Sbjct  68   FGA-IGVQAAALELDVSSDADTIRKAVKEAWEIFGTIDVLINNAGIRGNVKSSLDLSKEE  126

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            W+ + +TNLTG+WL+SKYVCL M +AK GGS++N+SSISGL+RG L
Sbjct  127  WDKVFRTNLTGSWLISKYVCLLMRDAKRGGSVINVSSISGLHRGLL  172



>ref|NP_190203.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 emb|CAB90944.1| dehydrogenase-like protein [Arabidopsis thaliana]
 gb|AAY78761.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
thaliana]
 gb|AEE78124.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=288

 Score =   191 bits (486),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V + LEPW EL  KV +VTGASSGIGREI LDL KAGC++IA ARRVDRL SLC EIN 
Sbjct  15   EVLKQLEPWCELKDKVVLVTGASSGIGREICLDLGKAGCKIIAVARRVDRLNSLCSEINS  74

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
              S T ++A A++LDV++D   I+  VQ AW  FG+IDALINNAG+RG V + LDL++EE
Sbjct  75   -SSSTGIQAAALKLDVTSDAATIQKVVQGAWGIFGKIDALINNAGIRGNVKSSLDLSKEE  133

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKF  467
            W+++ KTNLTG WLVSKYVC+ M +AK 
Sbjct  134  WDNVFKTNLTGPWLVSKYVCVLMRDAKL  161



>ref|XP_009139357.1| PREDICTED: probable L-xylulose reductase [Brassica rapa]
Length=280

 Score =   191 bits (485),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V   LEPW EL  KV ++TGASSGIGRE+ LDL KAGC++IAAARRVDRL+SLC EIN 
Sbjct  5    QVLNQLEPWSELKDKVVLLTGASSGIGREVCLDLGKAGCKIIAAARRVDRLESLCSEINS  64

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
            + S   + A  +ELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T L L+E+E
Sbjct  65   LSSTGIILAAPLELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTCLHLSEDE  124

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            W+ + +TNLTG WLVSKYVC  M +AK GGS++NISSI+GL+RG L
Sbjct  125  WDRVFRTNLTGAWLVSKYVCSLMRDAKSGGSVINISSIAGLHRGML  170



>ref|XP_006408894.1| hypothetical protein EUTSA_v10002227mg, partial [Eutrema salsugineum]
 gb|ESQ50347.1| hypothetical protein EUTSA_v10002227mg, partial [Eutrema salsugineum]
Length=283

 Score =   191 bits (486),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            V + LEPWREL  KV +VTGASSGIGREI LDL KAGC++IAAARRVD L SLC EIN  
Sbjct  12   VLKQLEPWRELKDKVVLVTGASSGIGREICLDLGKAGCKIIAAARRVDLLNSLCSEINSF  71

Query  207  GS-GTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
            GS GT  +  A+E DVS+D   I+ AV+ AW  FG+IDALINNAG+ G V + LDL E+E
Sbjct  72   GSTGTNNQPAALEPDVSSDAATIQKAVKEAWQVFGKIDALINNAGITGSVKSSLDLCEDE  131

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNR  512
            W+++ +TNLTG WL+SKYVC+ M + K  GS++NISSISGLNR
Sbjct  132  WDNVFRTNLTGPWLISKYVCVLMRDCKLSGSVINISSISGLNR  174



>ref|XP_006365797.1| PREDICTED: probable L-xylulose reductase-like [Solanum tuberosum]
Length=270

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW++LTGKV MVTGASSGIG E  LDL KAGCR+IAAARRVDRL +LC++IN    G 
Sbjct  1    MEPWKDLTGKVVMVTGASSGIGVEFCLDLTKAGCRIIAAARRVDRLTNLCNQINS--EGP  58

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              RA A+ELDV A+G  IEAAV+ AWDAFGRID L+NNAGVRG V + L L+EEEW    
Sbjct  59   ARRAFALELDVMANGATIEAAVKIAWDAFGRIDVLVNNAGVRGSVSSSLKLSEEEWEHTF  118

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
            +TNL G WLVSKYVC  M +AK
Sbjct  119  RTNLRGAWLVSKYVCRHMRDAK  140



>gb|AAD43618.1|AC005698_17 T3P18.17 [Arabidopsis thaliana]
Length=307

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V + LEPW EL  KV +VTGASSGIGREI LDL KAGC+++AAARRVDRL SLC EIN 
Sbjct  33   QVLKQLEPWCELKDKVVLVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLCSEINS  92

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
             G+   ++A A+ELDVS+D   I  AV+ AW+ FG ID LINNAG+RG V + LDL++EE
Sbjct  93   FGA-IGVQAAALELDVSSDADTIRKAVKEAWEIFGTIDVLINNAGIRGNVKSSLDLSKEE  151

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            W+ + +TNLTG+WL+SKYVCL M +AK GGS++N+SSISGL+RG L
Sbjct  152  WDKVFRTNLTGSWLISKYVCLLMRDAKRGGSVINVSSISGLHRGLL  197



>ref|XP_010673042.1| PREDICTED: L-xylulose reductase-like [Beta vulgaris subsp. vulgaris]
Length=296

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 137/173 (79%), Gaps = 14/173 (8%)
 Frame = +3

Query  42   EPWR---ELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV--  206
            + WR   EL GKV MVTGAS+G+G++  LDLAK+GC++IAAARR+DRLKSLCD IN +  
Sbjct  15   QQWRKIPELEGKVVMVTGASAGLGKDFCLDLAKSGCKIIAAARRIDRLKSLCDHINSLSS  74

Query  207  --------GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTP  362
                    G+G  +RAVA+ELDVSADG  I+A+V +AW+AFG I AL+NNAG+RG V + 
Sbjct  75   SSSSSSSSGNGG-VRAVAVELDVSADGKTIDASVNKAWNAFGCIHALVNNAGIRGNVKSA  133

Query  363  LDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LD+TEEEW++  KTNLTG WLVSK VC+RM +AK GGSIVNISSI+GLNRGQL
Sbjct  134  LDITEEEWDNTFKTNLTGAWLVSKSVCIRMRDAKIGGSIVNISSIAGLNRGQL  186



>ref|XP_009121071.1| PREDICTED: probable L-xylulose reductase isoform X1 [Brassica 
rapa]
Length=279

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 121/154 (79%), Gaps = 6/154 (4%)
 Frame = +3

Query  3    SEMESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKS  182
            S ++++VK  + LEPW EL  KV +VTGASSGIGREI LDLAKAGC++IAAARRVDRL+S
Sbjct  2    SNLQTQVK--KQLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCKIIAAARRVDRLES  59

Query  183  LCDEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTP  362
            LC EIN  G    ++AVA+ELDVS++   I+ AV+ AWD FG+I ALINNAG+RG V + 
Sbjct  60   LCSEINKTG----VQAVALELDVSSNAATIQKAVKEAWDIFGKIHALINNAGIRGNVKSC  115

Query  363  LDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            LDL+E EW+++  TNL G WLV+KYVC+ M +AK
Sbjct  116  LDLSENEWDNVLTTNLKGAWLVAKYVCVLMRDAK  149



>ref|XP_009112627.1| PREDICTED: probable L-xylulose reductase [Brassica rapa]
Length=287

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V   LEPWR+L  KV +VTGASSGIG+EI LDL KAGC++IAAARRVDRL SLC +IN 
Sbjct  13   EVLTKLEPWRDLKDKVVLVTGASSGIGKEICLDLGKAGCKIIAAARRVDRLNSLCSDINS  72

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
             GS T  +A A+E DV++D   I  AV+ AW+ FG+ID LINNAG+RG V + LDL+E+E
Sbjct  73   FGS-TGTQATALEFDVASDAATIRKAVKEAWEVFGKIDVLINNAGIRGNVKSSLDLSEDE  131

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            W+ + +TNLTG WLVSKYVC+ M +AK GGS++NISS++G++RG L
Sbjct  132  WDKVFRTNLTGPWLVSKYVCILMRDAKQGGSVINISSMAGVHRGML  177



>ref|XP_010265875.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nelumbo nucifera]
Length=290

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 126/172 (73%), Gaps = 11/172 (6%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING-----  203
            LEPW  L GKV MVTGASSG GRE+ LDLAKAGC ++AAARR DRLKSLC+EIN      
Sbjct  9    LEPWHRLDGKVVMVTGASSGFGRELCLDLAKAGCMIVAAARRKDRLKSLCNEINQSGSVS  68

Query  204  ------VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPL  365
                         RAVA++LD++A GP IEA+V++AWDAFGRIDAL+NNAGVRG V TPL
Sbjct  69   SGSSSEYDKPPAARAVAVDLDLNAKGPVIEASVRKAWDAFGRIDALVNNAGVRGGVSTPL  128

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            D  E+EW+++  TNLTG+WLV+KYV   M      GSIVNI+SI+G  RGQL
Sbjct  129  DFPEDEWSNIVNTNLTGSWLVTKYVGREMSKHNLKGSIVNITSIAGTERGQL  180



>ref|XP_009116225.1| PREDICTED: probable L-xylulose reductase isoform X1 [Brassica 
rapa]
Length=283

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 116/149 (78%), Gaps = 1/149 (1%)
 Frame = +3

Query  18   RVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEI  197
            + +V + LEPW EL  KV ++TGASSGIGREI LDLAK+GC++IAAARR+DRL+SLC EI
Sbjct  6    QTQVMKQLEPWCELKDKVVLLTGASSGIGREICLDLAKSGCKIIAAARRLDRLQSLCSEI  65

Query  198  NGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTE  377
            N   + T L A  +ELDVS+D   I+ AV++AWD FG ID LINNAG+RG V + LDL+E
Sbjct  66   NAFSTKTKL-AAPLELDVSSDSSTIQNAVKQAWDIFGHIDVLINNAGIRGNVRSSLDLSE  124

Query  378  EEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            EEW  + +TNLTG WLVSK+VC+ M +AK
Sbjct  125  EEWERVFRTNLTGPWLVSKHVCVLMRDAK  153



>ref|XP_009121072.1| PREDICTED: probable L-xylulose reductase isoform X2 [Brassica 
rapa]
Length=278

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 117/152 (77%), Gaps = 4/152 (3%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V + LEPW EL  KV +VTGASSGIGREI LDLAKAGC++IAAARRVDRL+SLC
Sbjct  1    MSNLQTVKKQLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCKIIAAARRVDRLESLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD  368
             EIN  G    ++AVA+ELDVS++   I+ AV+ AWD FG+I ALINNAG+RG V + LD
Sbjct  61   SEINKTG----VQAVALELDVSSNAATIQKAVKEAWDIFGKIHALINNAGIRGNVKSCLD  116

Query  369  LTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            L+E EW+++  TNL G WLV+KYVC+ M +AK
Sbjct  117  LSENEWDNVLTTNLKGAWLVAKYVCVLMRDAK  148



>ref|XP_004172090.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
isoform 2 [Cucumis sativus]
Length=286

 Score =   189 bits (481),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 127/169 (75%), Gaps = 8/169 (5%)
 Frame = +3

Query  36   HLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGS-  212
             LEPW +L GKV MVTGASSG+GRE  LDLA+AGC+++A ARR DRL+SLC EIN   S 
Sbjct  9    QLEPWNDLNGKVVMVTGASSGLGREFCLDLARAGCKIVAVARRTDRLQSLCQEINSFSSS  68

Query  213  ------GTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
                   TP RAVA+ELD+ AD   I+ AV++AWD+FG IDAL+NN G+RG V + LDL+
Sbjct  69   GSTFPTATP-RAVAVELDLKADSTIIKDAVRKAWDSFGFIDALVNNGGLRGTVKSSLDLS  127

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEW+D+  TNL G+WLVSKYVC+ M +    GS++NISSI GLNRG +
Sbjct  128  EEEWDDVMGTNLKGSWLVSKYVCIHMRDTNRSGSLINISSIGGLNRGHI  176



>ref|XP_009116226.1| PREDICTED: probable L-xylulose reductase isoform X2 [Brassica 
rapa]
Length=282

 Score =   189 bits (480),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 114/146 (78%), Gaps = 1/146 (1%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            V + LEPW EL  KV ++TGASSGIGREI LDLAK+GC++IAAARR+DRL+SLC EIN  
Sbjct  8    VMKQLEPWCELKDKVVLLTGASSGIGREICLDLAKSGCKIIAAARRLDRLQSLCSEINAF  67

Query  207  GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEW  386
             + T L A  +ELDVS+D   I+ AV++AWD FG ID LINNAG+RG V + LDL+EEEW
Sbjct  68   STKTKL-AAPLELDVSSDSSTIQNAVKQAWDIFGHIDVLINNAGIRGNVRSSLDLSEEEW  126

Query  387  NDLTKTNLTGTWLVSKYVCLRMCNAK  464
              + +TNLTG WLVSK+VC+ M +AK
Sbjct  127  ERVFRTNLTGPWLVSKHVCVLMRDAK  152



>ref|XP_004252844.1| PREDICTED: probable L-xylulose reductase [Solanum lycopersicum]
Length=270

 Score =   188 bits (478),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 113/143 (79%), Gaps = 3/143 (2%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW++LTGKV MVTGASSGIG E  LDLAKAGC +IAAARR+DRL+SLC+++N  G   
Sbjct  1    MEPWKDLTGKVVMVTGASSGIGLEFCLDLAKAGCSIIAAARRIDRLESLCNDMNSEGI--  58

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              RA A++LDV ++G  +EAAV+RAWDAFG I+ LINNAG+RG V +PL+L+EEEW    
Sbjct  59   -RRAFALKLDVMSNGATMEAAVERAWDAFGHINVLINNAGIRGPVSSPLELSEEEWEHTF  117

Query  399  KTNLTGTWLVSKYVCLRMCNAKF  467
             TNL G WL+SKYVC RM +AK 
Sbjct  118  NTNLRGAWLLSKYVCRRMRDAKL  140



>ref|XP_004172089.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
isoform 1 [Cucumis sativus]
Length=314

 Score =   190 bits (482),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 127/169 (75%), Gaps = 8/169 (5%)
 Frame = +3

Query  36   HLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGS-  212
             LEPW +L GKV MVTGASSG+GRE  LDLA+AGC+++A ARR DRL+SLC EIN   S 
Sbjct  9    QLEPWNDLNGKVVMVTGASSGLGREFCLDLARAGCKIVAVARRTDRLQSLCQEINSFSSS  68

Query  213  ------GTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
                   TP RAVA+ELD+ AD   I+ AV++AWD+FG IDAL+NN G+RG V + LDL+
Sbjct  69   GSTFPTATP-RAVAVELDLKADSTIIKDAVRKAWDSFGFIDALVNNGGLRGTVKSSLDLS  127

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEW+D+  TNL G+WLVSKYVC+ M +    GS++NISSI GLNRG +
Sbjct  128  EEEWDDVMGTNLKGSWLVSKYVCIHMRDTNRSGSLINISSIGGLNRGHI  176



>ref|XP_002886464.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62723.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=290

 Score =   189 bits (480),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 131/164 (80%), Gaps = 1/164 (1%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V R LEPW EL GKV +VTGASSGIGREI +DL KAGC++IAAARRVDRL SLC EIN 
Sbjct  16   QVLRQLEPWCELNGKVVLVTGASSGIGREICIDLGKAGCKIIAAARRVDRLDSLCFEINS  75

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
             G  T ++A A+ELDVS+D   I   V+ AW+ FG+ID LINNAG+RG V + LDL+EEE
Sbjct  76   FGL-TGIQAAALELDVSSDADTIRKVVKEAWEIFGKIDVLINNAGIRGNVKSSLDLSEEE  134

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRG  515
            W+ + +TNLTG+WLVSK+V + M +AK GGS++NISSISGL+RG
Sbjct  135  WDKVFRTNLTGSWLVSKFVGVLMRDAKRGGSVINISSISGLHRG  178



>ref|XP_004973876.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Setaria italica]
Length=277

 Score =   188 bits (478),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +3

Query  45   PWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPL  224
            PW  L G+V +VTGASSGIGR+  LDLA+AGCRV+AAARR DRL+SLCDEIN   +    
Sbjct  9    PWSRLEGQVVLVTGASSGIGRDFCLDLARAGCRVVAAARRADRLRSLCDEINASAAADGP  68

Query  225  RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKT  404
            RAVA+ELDV+A G A+EAAVQRAWDAFGRID LINNAG+RG VH+PLD  E+EW+ L KT
Sbjct  69   RAVAVELDVAAGGSALEAAVQRAWDAFGRIDVLINNAGIRGAVHSPLDWPEDEWDKLIKT  128

Query  405  NLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            NLTG WLV+K+VC RM +AK  GS++NISSI+GLNRG L
Sbjct  129  NLTGLWLVAKHVCRRMRDAKLKGSVINISSIAGLNRGHL  167



>ref|XP_008443382.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
[Cucumis melo]
Length=286

 Score =   189 bits (479),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 129/169 (76%), Gaps = 8/169 (5%)
 Frame = +3

Query  36   HLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGS-  212
            HLEPW  L GKV MVTGASSG+GR+  LDLA+AGC ++AAARR DRL+SLC EIN + S 
Sbjct  9    HLEPWNHLNGKVVMVTGASSGLGRDFCLDLARAGCNIVAAARRTDRLQSLCQEINRLASS  68

Query  213  ------GTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
                   TP RAVA+ELD+ AD   I+ AV++AWD+FG IDAL+NNAG+RG V + L+L+
Sbjct  69   GSSFQTATP-RAVAVELDLKADSTIIKDAVRKAWDSFGFIDALVNNAGLRGTVKSSLELS  127

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEW+++  TNL G+WLVSKYVC+ M +    GS++NISSI GLNRG +
Sbjct  128  EEEWDEVMGTNLKGSWLVSKYVCIHMRDTNRSGSVINISSIGGLNRGHI  176



>emb|CDP06198.1| unnamed protein product [Coffea canephora]
Length=288

 Score =   189 bits (479),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 126/173 (73%), Gaps = 11/173 (6%)
 Frame = +3

Query  36   HLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV---  206
              EPW  L GK+  VTGASSG+G+E  LDLAKAGC+V+AAARR++RLKSLCDEIN +   
Sbjct  6    QFEPWSHLDGKIVFVTGASSGLGKEFCLDLAKAGCKVVAAARRLERLKSLCDEINQLFPS  65

Query  207  -GSGTPL-------RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTP  362
                +P+       RAVA+ELDV+AD   IE +VQRAW+AFG IDAL+NNAGVRG + + 
Sbjct  66   PSRSSPVELDPNSTRAVAVELDVTADASTIETSVQRAWNAFGHIDALVNNAGVRGSISSS  125

Query  363  LDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LDLTE EWN   +TNLTG WLVSKYV   M  A   G IVN+SS+SGLNR QL
Sbjct  126  LDLTENEWNSTVRTNLTGAWLVSKYVGRHMREACRCGCIVNVSSVSGLNRAQL  178



>emb|CDP06199.1| unnamed protein product [Coffea canephora]
Length=288

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 127/182 (70%), Gaps = 15/182 (8%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME RV+     EPW  L GK+  VTGASSG+GRE  LDLA AGC+V+AAARR +RLKSLC
Sbjct  1    MEDRVQ----FEPWSHLDGKIVFVTGASSGLGREFCLDLATAGCKVVAAARRQERLKSLC  56

Query  189  DEINGVGSG-----------TPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNA  335
            DEIN +                 RAVA+ELDV+AD   IE +VQRAW+AFG IDAL+NNA
Sbjct  57   DEINQLFPSPSTSSTVELDPNSTRAVAVELDVTADASTIETSVQRAWNAFGHIDALVNNA  116

Query  336  GVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRG  515
            GVRG + + LDLTE EWN   +TNLTG WLVSKYV   M  A  GG IVN+SSISGLNR 
Sbjct  117  GVRGSISSSLDLTENEWNSTVRTNLTGAWLVSKYVGRHMREAGRGGCIVNVSSISGLNRA  176

Query  516  QL  521
            Q+
Sbjct  177  QM  178



>emb|CDY02920.1| BnaC04g25660D [Brassica napus]
Length=237

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V   LEPW EL  KV ++TGASSGIGRE+ LDL KAGC++IAAARRVDRL+ LC EIN 
Sbjct  5    QVLNQLEPWSELKDKVVLLTGASSGIGREVCLDLDKAGCKIIAAARRVDRLEFLCSEINS  64

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
            + S   + A   ELDVS+D   I+ AV++AWD FG+ID LINNAG+R  V T LDL+E+E
Sbjct  65   LSSTGIMLAAPFELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRSNVKTCLDLSEDE  124

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            W+ + +TNLTG WLVSKYVC  M +AK
Sbjct  125  WDRVFRTNLTGAWLVSKYVCSLMRDAK  151



>ref|XP_006367949.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like, 
partial [Solanum tuberosum]
Length=261

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 104/134 (78%), Gaps = 3/134 (2%)
 Frame = +3

Query  63   GKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLRAVAIE  242
            GK+ MVTGASSGIG E   DLAKAGC +IAAARRVDRLKSLCDEIN  G G   RA A+E
Sbjct  1    GKIVMVTGASSGIGLEFCFDLAKAGCSIIAAARRVDRLKSLCDEINSKGHG---RAFALE  57

Query  243  LDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTW  422
            LDV+ADG  IE+AVQ AWDAFG ID LINNAG+RG V + L+LTEEEW     TNL GTW
Sbjct  58   LDVAADGATIESAVQIAWDAFGHIDVLINNAGIRGSVSSSLELTEEEWEHTFNTNLKGTW  117

Query  423  LVSKYVCLRMCNAK  464
            LVSK VC RM +AK
Sbjct  118  LVSKCVCRRMRDAK  131



>ref|XP_004136692.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
isoform 2 [Cucumis sativus]
 gb|KGN59543.1| hypothetical protein Csa_3G824880 [Cucumis sativus]
Length=286

 Score =   187 bits (475),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 127/169 (75%), Gaps = 8/169 (5%)
 Frame = +3

Query  36   HLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING----  203
             LEPW +L GKV MVTGASSG+GRE  LDLA+AGC+++A ARR DRL+SLC EIN     
Sbjct  9    QLEPWNDLNGKVVMVTGASSGLGREFCLDLARAGCKIVAVARRTDRLQSLCQEINSSSSS  68

Query  204  ---VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
                 + TP RAVA+ELD+ AD   I+ AV++AWD+FG IDAL+NN G+RG V + LDL+
Sbjct  69   GSTFPTATP-RAVAVELDLKADSTIIKDAVRKAWDSFGFIDALVNNGGLRGTVKSSLDLS  127

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEW+D+  TNL G+WLVSKYVC+ M +    GS++NISSI GLNRG +
Sbjct  128  EEEWDDVMGTNLKGSWLVSKYVCIHMRDTNRSGSLINISSIGGLNRGHI  176



>ref|XP_004136691.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
isoform 1 [Cucumis sativus]
Length=314

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 127/169 (75%), Gaps = 8/169 (5%)
 Frame = +3

Query  36   HLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING----  203
             LEPW +L GKV MVTGASSG+GRE  LDLA+AGC+++A ARR DRL+SLC EIN     
Sbjct  9    QLEPWNDLNGKVVMVTGASSGLGREFCLDLARAGCKIVAVARRTDRLQSLCQEINSSSSS  68

Query  204  ---VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
                 + TP RAVA+ELD+ AD   I+ AV++AWD+FG IDAL+NN G+RG V + LDL+
Sbjct  69   GSTFPTATP-RAVAVELDLKADSTIIKDAVRKAWDSFGFIDALVNNGGLRGTVKSSLDLS  127

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EEEW+D+  TNL G+WLVSKYVC+ M +    GS++NISSI GLNRG +
Sbjct  128  EEEWDDVMGTNLKGSWLVSKYVCIHMRDTNRSGSLINISSIGGLNRGHI  176



>ref|NP_565425.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEC06694.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=312

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +3

Query  54   ELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLRAV  233
            EL  KV +VTGASSGIGRE+ LDLAKAGC++IAAARRVDRLKSLC EIN       ++A 
Sbjct  46   ELKDKVVLVTGASSGIGREVCLDLAKAGCKIIAAARRVDRLKSLCSEINRFEYSAGIQAE  105

Query  234  AIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLT  413
            A+ELDVS+D   ++ AV++AW+ FG+IDALINNAG RG V + LDL+E+EW+ + KTNLT
Sbjct  106  ALELDVSSDAATVQKAVKKAWEIFGKIDALINNAGFRGNVKSSLDLSEDEWDKVFKTNLT  165

Query  414  GTWLVSKYVCLRMCNAK  464
            GTWLVSKYVC+ M +AK
Sbjct  166  GTWLVSKYVCILMRDAK  182



>ref|XP_011079076.1| PREDICTED: L-rhamnose-1-dehydrogenase-like [Sesamum indicum]
Length=290

 Score =   186 bits (473),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 133/180 (74%), Gaps = 9/180 (5%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME+  +VA  LEPW  L  K+ +VTGASSG+GRE  LDLAKAGCR++AAARR DRL+SLC
Sbjct  1    MENSSQVAAQLEPWLRLENKIVLVTGASSGLGREFCLDLAKAGCRIVAAARRKDRLQSLC  60

Query  189  DEING--VGSGTPL-------RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGV  341
            +EIN    GS + +       RAVA+ELDV+A G  IEA VQ+AW AFGRIDALINNAG+
Sbjct  61   EEINNWVDGSSSSMGPSQDQPRAVAVELDVTAAGVTIEACVQKAWAAFGRIDALINNAGI  120

Query  342  RGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            RG   + ++L+EEEW  + +TNLTG+WLV+K V  RM  A  GGSI+NISS +GLNR Q 
Sbjct  121  RGHAMSSIELSEEEWKQVVQTNLTGSWLVAKSVARRMREAGQGGSIINISSAAGLNRTQF  180



>emb|CDY40209.1| BnaA09g34910D [Brassica napus]
Length=312

 Score =   187 bits (474),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 113/146 (77%), Gaps = 1/146 (1%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            V + LEPW EL  KV ++TGASSGIGREI LDLAK+GC++IAAARR+DRL+SLC EIN  
Sbjct  38   VMKQLEPWCELKDKVVLLTGASSGIGREICLDLAKSGCKIIAAARRLDRLQSLCSEINAF  97

Query  207  GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEW  386
             + T L A  +ELDVS+D   I  AV++AWD FG ID LINNAG+RG V + LDL+EEEW
Sbjct  98   STKTKL-AAPLELDVSSDTSTIRNAVKQAWDIFGHIDVLINNAGIRGNVKSSLDLSEEEW  156

Query  387  NDLTKTNLTGTWLVSKYVCLRMCNAK  464
              + +TNLTG WLVSK+VC+ M +AK
Sbjct  157  ERVFRTNLTGPWLVSKHVCVLMRDAK  182



>ref|XP_009599584.1| PREDICTED: probable L-xylulose reductase [Nicotiana tomentosiformis]
Length=269

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 109/142 (77%), Gaps = 3/142 (2%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW +L+G V MVTGASSGIGRE+ LDLAKA C +I AA RVDRLKSLCDEIN  G+  
Sbjct  1    MEPWNDLSGIVVMVTGASSGIGRELCLDLAKASCSIIVAAHRVDRLKSLCDEINSDGT--  58

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              RA A+ELD++A+G  IEA VQRAWDA G IDAL+NNAG+RG + + L L+E+EWN   
Sbjct  59   -RRAFAVELDINANGATIEAIVQRAWDASGLIDALVNNAGIRGSISSSLKLSEDEWNHTF  117

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G WLVSKYVC  M +AK
Sbjct  118  NTNLRGAWLVSKYVCRCMPDAK  139



>ref|XP_009631507.1| PREDICTED: probable L-xylulose reductase isoform X2 [Nicotiana 
tomentosiformis]
Length=259

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 109/142 (77%), Gaps = 13/142 (9%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW++L+G V MVTGASSGIGRE+ LDLAKA C +IAAARRVD LKSLCDEIN  G+  
Sbjct  1    MEPWKDLSGIVVMVTGASSGIGRELCLDLAKASCSIIAAARRVDSLKSLCDEINSDGT--  58

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              RA A+ELD++A+G  IEAAVQRAWDAFGRIDAL+NNAG+R          E+EWN   
Sbjct  59   -RRAFAVELDINANGATIEAAVQRAWDAFGRIDALVNNAGIR----------EDEWNHTF  107

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G WLVSKYVC RM +AK
Sbjct  108  NTNLRGAWLVSKYVCRRMPDAK  129



>ref|XP_011079074.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Sesamum indicum]
Length=291

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 117/157 (75%), Gaps = 9/157 (6%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            MESR +VA  LEPW  +  KV +VTGASSG+GRE  LDLAKAGC ++AAARR DRL+SLC
Sbjct  1    MESRSQVAAQLEPWLRIENKVVLVTGASSGLGREFCLDLAKAGCCIVAAARRKDRLQSLC  60

Query  189  DEING--VGSGTPL-------RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGV  341
            +EIN    GS + +       RAVA+ELDV+A G AIEA VQ+AW AFGRIDALINNAG+
Sbjct  61   EEINSWVDGSSSSMGPSQDQPRAVAVELDVTAVGAAIEACVQKAWAAFGRIDALINNAGI  120

Query  342  RGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRM  452
            RG   + ++L+EEEW  + +TNLTG+W V+K V  RM
Sbjct  121  RGHTRSSIELSEEEWEQVLQTNLTGSWFVAKSVARRM  157



>ref|XP_008455802.1| PREDICTED: probable L-xylulose reductase [Cucumis melo]
Length=294

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 113/154 (73%), Gaps = 13/154 (8%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV----  206
            LEPW +L GKV MVTGAS+G+GRE  LDLA+AGC++IAAARR +RL+SLCDEIN +    
Sbjct  11   LEPWNDLKGKVVMVTGASAGLGREFCLDLARAGCKIIAAARRTNRLQSLCDEINQLDFSI  70

Query  207  ---------GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHT  359
                     G+    RAVA+ELDV A+G +IE +V +AWD FG ID L+NNAG+RG V +
Sbjct  71   LSSALTSPMGAVESRRAVAVELDVCANGKSIEESVTKAWDYFGFIDTLVNNAGIRGNVKS  130

Query  360  PLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNA  461
            PL+L+E+EW+D   TNL G WLVSKYVC+ M  A
Sbjct  131  PLELSEKEWDDTMATNLKGQWLVSKYVCILMNKA  164



>emb|CDX73391.1| BnaC08g26120D [Brassica napus]
Length=469

 Score =   188 bits (478),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 115/147 (78%), Gaps = 1/147 (1%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            V + LEPW EL  KV ++TGASSGIGREI LDLAK+GC++IAAARR+DRL+SLC EIN +
Sbjct  192  VMKQLEPWCELKDKVVLLTGASSGIGREICLDLAKSGCKIIAAARRLDRLQSLCSEINAL  251

Query  207  GSGTPLR-AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
             S T  + A  +ELDVS+D   I+ AV++AWD FG ID LINNAG+RG V + LDL+EEE
Sbjct  252  FSPTKTKQAAPLELDVSSDSSTIQNAVKQAWDIFGNIDVLINNAGIRGSVKSSLDLSEEE  311

Query  384  WNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            W  + +TNLTG WLVSK+VC+ M +AK
Sbjct  312  WERVFRTNLTGPWLVSKHVCVLMRDAK  338



>ref|XP_002444769.1| hypothetical protein SORBIDRAFT_07g027700 [Sorghum bicolor]
 gb|EES14264.1| hypothetical protein SORBIDRAFT_07g027700 [Sorghum bicolor]
Length=279

 Score =   183 bits (465),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +3

Query  45   PWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV-GSGTP  221
            PW  + G+V +VTGASSGIGR+  LDLA+AGCRV+AAARR DRL+SLCDEIN    +   
Sbjct  10   PWSSMEGQVVLVTGASSGIGRDFCLDLARAGCRVVAAARRADRLRSLCDEINASEAAAQG  69

Query  222  LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTK  401
             RAVA+ELDV+A G  +EAAVQRAWDAFGRIDALINNAG+RG VH+PLD  E+EW+ + K
Sbjct  70   PRAVAVELDVAAGGSVLEAAVQRAWDAFGRIDALINNAGIRGGVHSPLDWPEDEWDRIIK  129

Query  402  TNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            TNLTG+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG L
Sbjct  130  TNLTGSWLVAKHVCRRMRDAKLYGSVVNITSIAGLNRGHL  169



>ref|XP_009763303.1| PREDICTED: probable L-xylulose reductase isoform X2 [Nicotiana 
sylvestris]
Length=259

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 105/142 (74%), Gaps = 13/142 (9%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW+ L G V MVTGASSGIGRE+ LDLAKAGC +IAAARRVDRLKSLCDEIN  G   
Sbjct  1    MEPWKNLNGIVVMVTGASSGIGRELCLDLAKAGCSIIAAARRVDRLKSLCDEINSEGIQ-  59

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              RA A+ELD++A+G  IE AVQ AW+ FGRIDAL+NNAGVR          EEEWN   
Sbjct  60   --RAYAVELDITANGATIEVAVQIAWNTFGRIDALVNNAGVR----------EEEWNHTF  107

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G WLVSKYVC RM +AK
Sbjct  108  NTNLRGAWLVSKYVCRRMHDAK  129



>emb|CDY03343.1| BnaC09g10050D [Brassica napus]
Length=280

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 129/163 (79%), Gaps = 1/163 (1%)
 Frame = +3

Query  33   RHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGS  212
            + LEPWR+L  KV +VTGASSGIG+EI LDL KAGC++IAAARRVDRL SLC +IN   S
Sbjct  9    KKLEPWRDLKDKVVLVTGASSGIGKEICLDLGKAGCKIIAAARRVDRLNSLCSDINSFCS  68

Query  213  GTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWND  392
             T  +A +++LDV++D   I  AV+ AW  FG+ID LINNAG+RG V + LDL+E+EW+ 
Sbjct  69   -TGTQAASLKLDVASDAATIRKAVKGAWGIFGKIDVLINNAGIRGNVKSSLDLSEDEWDK  127

Query  393  LTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            + +TNLTG WLVSKYVC+ M +AK GGS++NISS++G++RG L
Sbjct  128  VFRTNLTGPWLVSKYVCILMRDAKQGGSVINISSMAGVHRGML  170



>ref|XP_009763295.1| PREDICTED: probable L-xylulose reductase isoform X1 [Nicotiana 
sylvestris]
Length=269

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW+ L G V MVTGASSGIGRE+ LDLAKAGC +IAAARRVDRLKSLCDEIN  G   
Sbjct  1    MEPWKNLNGIVVMVTGASSGIGRELCLDLAKAGCSIIAAARRVDRLKSLCDEINSEGIQ-  59

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              RA A+ELD++A+G  IE AVQ AW+ FGRIDAL+NNAGVRG + + L L+EEEWN   
Sbjct  60   --RAYAVELDITANGATIEVAVQIAWNTFGRIDALVNNAGVRGSLSSSLKLSEEEWNHTF  117

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G WLVSKYVC RM +AK
Sbjct  118  NTNLRGAWLVSKYVCRRMHDAK  139



>ref|XP_004248275.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Solanum lycopersicum]
Length=276

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 110/143 (77%), Gaps = 4/143 (3%)
 Frame = +3

Query  48   WRE-LTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSG---  215
            W++ L+GKV MVTGASSGIGRE+S+DLAKAGCR+I +ARRVD+LKSLC+ ING G+    
Sbjct  4    WQDGLSGKVVMVTGASSGIGRELSIDLAKAGCRIIVSARRVDKLKSLCNHINGRGNSELD  63

Query  216  TPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDL  395
                A+A+ELDV+A+G  IEAAVQ AWDAFG ID LINNAGVRG V + L+L EEEW   
Sbjct  64   PAPNAIAVELDVTANGGNIEAAVQIAWDAFGHIDVLINNAGVRGCVSSSLELPEEEWEHT  123

Query  396  TKTNLTGTWLVSKYVCLRMCNAK  464
              TNL G WLVSKYVC  M + K
Sbjct  124  FTTNLRGAWLVSKYVCRHMIDVK  146



>ref|XP_009594209.1| PREDICTED: probable L-xylulose reductase [Nicotiana tomentosiformis]
Length=269

 Score =   181 bits (458),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW++L+G V MVTGASSGIGRE+ LDLAKA   +I AAR  DRLKSLCDEIN  G+  
Sbjct  1    MEPWKDLSGIVVMVTGASSGIGRELCLDLAKASYNIIVAARCDDRLKSLCDEINSDGT--  58

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              RA A+EL+++A+G  IEAAVQ+AWDAFGRID L++NAG+RG + + L L+E+EWN   
Sbjct  59   -RRAFAVELEINANGATIEAAVQKAWDAFGRIDVLVSNAGIRGSISSSLKLSEDEWNHTF  117

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G WLVSK+VC RM +AK
Sbjct  118  NTNLRGAWLVSKHVCRRMRDAK  139



>ref|XP_006364793.1| PREDICTED: dehydrogenase/reductase SDR family member 7-like isoform 
X2 [Solanum tuberosum]
Length=147

 Score =   177 bits (448),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 107/132 (81%), Gaps = 2/132 (2%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
             VA HLEPW +L GKV  VTGAS+G+GRE  LDLA++GCRV+A ARR DRLKSLCDEIN 
Sbjct  18   NVANHLEPWLQLEGKVVFVTGASAGLGREFCLDLARSGCRVVAGARRGDRLKSLCDEINT  77

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
              +   +RA+AIELDV+ADG  IEA+V++AWDAFG IDALINNAGVRG + + +D++EEE
Sbjct  78   --NSHLVRAMAIELDVTADGTTIEASVKKAWDAFGHIDALINNAGVRGGIKSSVDISEEE  135

Query  384  WNDLTKTNLTGT  419
            W +  +TNLTG+
Sbjct  136  WENTLRTNLTGS  147



>gb|EYU20811.1| hypothetical protein MIMGU_mgv11b022665mg [Erythranthe guttata]
Length=203

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 108/145 (74%), Gaps = 7/145 (5%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING-----  203
            LEPW  L GK  MVTGASSG+G E  LDLAKAGCR++AAARR+++L+SLC +IN      
Sbjct  3    LEPWSRLEGKTVMVTGASSGLGFEFCLDLAKAGCRIVAAARRIEKLESLCQQINNNKMEY  62

Query  204  --VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTE  377
                +G   RA+A+ELDV+AD  AIE  V++AWDAFG IDALINNAG RG V + L+L  
Sbjct  63   SDAINGGARRAIAVELDVTADPTAIEECVRKAWDAFGHIDALINNAGFRGSVKSSLNLPS  122

Query  378  EEWNDLTKTNLTGTWLVSKYVCLRM  452
            EEWN + KTNLTG+WLV+K+V  RM
Sbjct  123  EEWNQVVKTNLTGSWLVAKFVGKRM  147



>ref|XP_009794629.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Nicotiana 
sylvestris]
Length=136

 Score =   175 bits (444),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 100/123 (81%), Gaps = 7/123 (6%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME+  KVA  LEPWRELTGKV M+TGASSGIGRE  LDL+++GCR+IAAARRV+RLKSLC
Sbjct  1    MENHAKVASQLEPWRELTGKVVMITGASSGIGREFCLDLSRSGCRIIAAARRVNRLKSLC  60

Query  189  DEINGV-------GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRG  347
            DEING             +RAVAIELDVSA+GP IE AVQ+AWD+FGRIDAL+NNAGVRG
Sbjct  61   DEINGFSSNSNESSLNQEVRAVAIELDVSANGPIIEDAVQKAWDSFGRIDALVNNAGVRG  120

Query  348  RVH  356
             +H
Sbjct  121  EMH  123



>gb|EYU20810.1| hypothetical protein MIMGU_mgv1a011271mg [Erythranthe guttata]
Length=287

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 130/167 (78%), Gaps = 6/167 (4%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEIN------  200
             EPW +L GK+ MVTGASSG+G E  LDLAKAGCRV+AAARR+++L SLC +IN      
Sbjct  11   FEPWSQLEGKIVMVTGASSGLGLEFCLDLAKAGCRVVAAARRIEKLDSLCQQINHEMEYS  70

Query  201  GVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEE  380
                G   +A+A+ELD++AD  AIEA+V++AWDAFG IDALINNAGVRG + + L+L+++
Sbjct  71   DAIYGGAHQAIAVELDLTADSTAIEASVRKAWDAFGHIDALINNAGVRGSIKSSLNLSDD  130

Query  381  EWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            EWN + KTNLTG+WLV+K V  RM +A  GGSI+NISS+SGLNR Q+
Sbjct  131  EWNHVVKTNLTGSWLVAKCVGKRMRDAARGGSIINISSVSGLNRMQV  177



>gb|KGN54692.1| hypothetical protein Csa_4G427280 [Cucumis sativus]
Length=297

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 111/157 (71%), Gaps = 16/157 (10%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEIN----GV  206
            LEPW +L GKV MVTGASSG+GRE  LDLA+AGC++IAAARR  RL+SLCDEIN     V
Sbjct  11   LEPWNDLNGKVVMVTGASSGLGREFCLDLARAGCKIIAAARRTSRLQSLCDEINELDFSV  70

Query  207  GS---GTPLR---------AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR  350
             S    +P+          AVA+ELDV   G +IE +V +AWD FG ID L+NNAG+RG 
Sbjct  71   SSSALASPISPTGAVESRPAVAVELDVCGHGKSIEESVTKAWDYFGFIDTLVNNAGLRGS  130

Query  351  VHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNA  461
            V +PL+L+E+EW+D   TNL G WLVSKYVC+ M  A
Sbjct  131  VKSPLELSEKEWDDTMDTNLKGQWLVSKYVCILMNKA  167



>ref|XP_006367340.1| PREDICTED: probable L-xylulose reductase-like, partial [Solanum 
tuberosum]
Length=271

 Score =   178 bits (451),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 113/144 (78%), Gaps = 3/144 (2%)
 Frame = +3

Query  33   RHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGS  212
            R +EPW++L GKV MVTGASSGIGRE+ LDLAKAGC +IAAARR+DRLKSLC+ IN  G 
Sbjct  1    RKMEPWKDLKGKVVMVTGASSGIGRELCLDLAKAGCSIIAAARRIDRLKSLCNHINSEGL  60

Query  213  GTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWND  392
                RAVA+ELDV+++G  IE AVQ AW+AFGRID LINNAG+RG V   L+L+EEEW  
Sbjct  61   Q---RAVALELDVTSNGATIEVAVQIAWNAFGRIDTLINNAGIRGSVSFSLELSEEEWEH  117

Query  393  LTKTNLTGTWLVSKYVCLRMCNAK  464
               TNL G WLVSKYVC RM +AK
Sbjct  118  TFNTNLRGAWLVSKYVCRRMRDAK  141



>ref|XP_004144361.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=297

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 112/157 (71%), Gaps = 16/157 (10%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEIN----GV  206
            LEPW +L GKV MVTGAS+G+GRE  LDLA+AGC++IAAARR  RL+SLCDEIN     V
Sbjct  11   LEPWNDLNGKVVMVTGASAGLGREFCLDLARAGCKIIAAARRTSRLQSLCDEINELDFSV  70

Query  207  GS---GTPLR---------AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR  350
             S    +P+          AVA+ELDV  +G +IE +V +AWD FG ID L+NNAG+RG 
Sbjct  71   SSSALASPISPTGAVESRPAVAVELDVCGNGKSIEESVTKAWDYFGFIDTLVNNAGLRGS  130

Query  351  VHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNA  461
            V +PL+L+E+EW+D   TNL G WLVSKYVC+ M  A
Sbjct  131  VKSPLELSEKEWDDTMDTNLKGQWLVSKYVCILMNKA  167



>ref|XP_003632638.2| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Vitis vinifera]
Length=297

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 105/144 (73%), Gaps = 7/144 (5%)
 Frame = +3

Query  42   EPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVG-SGT  218
            EPW  L GKV +VTGASS + RE+ L+LA+ GC+++A A R DRLKSLCDEIN    SG+
Sbjct  10   EPWNNLEGKVILVTGASSSLDRELCLNLARVGCKIVAVAHRTDRLKSLCDEINHPAFSGS  69

Query  219  PL------RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEE  380
            PL      RAVA+E DV+AD P I+A+V +AWD FGRID LINN G RG V   L+L EE
Sbjct  70   PLNPNTTVRAVAVEFDVTADDPTIDASVHKAWDGFGRIDVLINNVGFRGTVKNSLELDEE  129

Query  381  EWNDLTKTNLTGTWLVSKYVCLRM  452
            EW +  KTNL GTWLVSK+VC RM
Sbjct  130  EWGEGMKTNLNGTWLVSKHVCRRM  153



>ref|XP_011075456.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
isoform X2 [Sesamum indicum]
Length=284

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 126/172 (73%), Gaps = 6/172 (3%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            ++   LEPW  L GK+ MVTGASSG+GRE  LDLAKAGCR+IAAARR+DRL SLCDEIN 
Sbjct  4    EILHTLEPWSRLDGKIVMVTGASSGLGREFCLDLAKAGCRIIAAARRMDRLGSLCDEINQ  63

Query  204  V------GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPL  365
            +      G+G    AVA+ELD+++D  AI A++ +AWDAFG ID LINNAGVRG+  + L
Sbjct  64   LNSLMVGGNGDGCLAVAVELDITSDDNAIGASIAKAWDAFGHIDVLINNAGVRGQKRSSL  123

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            ++ +EEWN +  TNL GTW VSK V  R+  A+   SI+NISSI+GLNR Q 
Sbjct  124  EIGKEEWNQVLNTNLIGTWEVSKCVASRLRFARRKASIINISSITGLNRVQF  175



>ref|NP_001062206.1| Os08g0510400 [Oryza sativa Japonica Group]
 dbj|BAC57400.1| putative alcohol dehydrogenase homolog [Oryza sativa Japonica 
Group]
 dbj|BAF24120.1| Os08g0510400 [Oryza sativa Japonica Group]
 gb|EAZ07584.1| hypothetical protein OsI_29835 [Oryza sativa Indica Group]
 dbj|BAG91409.1| unnamed protein product [Oryza sativa Japonica Group]
Length=284

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +3

Query  48   WRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLR  227
            W  L G+V +VTGASSG+GRE  LDLA+AGC V+AAARR DRL+SLCDEIN         
Sbjct  17   WSRLEGRVVLVTGASSGLGREFCLDLARAGCLVVAAARRADRLRSLCDEINASAPRASAA  76

Query  228  AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTN  407
            A A+ELDV++ GPA+EAAVQ AWDAFGRID LINNAG+RG VH+PLD  E+EW  L KTN
Sbjct  77   AAAVELDVASGGPALEAAVQSAWDAFGRIDVLINNAGLRGGVHSPLDWPEDEWETLIKTN  136

Query  408  LTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LTG+WLV+K+VC RM +AK  GS++NISS+SGLNRG L
Sbjct  137  LTGSWLVAKHVCRRMRDAKLKGSVINISSVSGLNRGHL  174



>ref|XP_004157996.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=297

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 110/157 (70%), Gaps = 16/157 (10%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV----  206
            LEPW +L GKV MVTGAS+G+GRE  LDLA+AGC++IAAARR  RL+SLCDEIN +    
Sbjct  11   LEPWNDLNGKVVMVTGASAGLGREFCLDLARAGCKIIAAARRTSRLQSLCDEINELDFSV  70

Query  207  ------------GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR  350
                        G+    RAVA+ELDV  +G +IE +V++AWD FG ID L+NNAG RG 
Sbjct  71   LSSALASPISPTGAVESRRAVAVELDVCGNGKSIEESVRKAWDYFGFIDTLVNNAGFRGS  130

Query  351  VHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNA  461
            V +P++L+EEEW+    TNL G WLVSKYVC+ M  A
Sbjct  131  VKSPVELSEEEWDYTMGTNLKGQWLVSKYVCILMNKA  167



>ref|XP_009781380.1| PREDICTED: L-xylulose reductase-like [Nicotiana sylvestris]
Length=269

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 112/142 (79%), Gaps = 3/142 (2%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +E W++L+G V MVTGASSGIGRE+ LDLAKAGC +IAAARRVD+LKSLCDEIN  G+  
Sbjct  1    METWKDLSGIVVMVTGASSGIGRELCLDLAKAGCSIIAAARRVDKLKSLCDEINSEGT--  58

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              RA AIELD++A+G  IEAA Q AWD FGRIDAL+NNAGVRG + + L+L+E+EW    
Sbjct  59   -RRAFAIELDITANGATIEAAGQIAWDTFGRIDALVNNAGVRGSISSSLELSEDEWKHTF  117

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G WLVSKYVC  M +AK
Sbjct  118  NTNLRGAWLVSKYVCRCMRDAK  139



>ref|XP_004144362.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=297

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 109/157 (69%), Gaps = 16/157 (10%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV----  206
            LEPW +L GKV MVTGAS+G+GRE  LDLA+AGC++IAAARR  RL+SLCDEIN +    
Sbjct  11   LEPWNDLNGKVVMVTGASAGLGREFCLDLARAGCKIIAAARRTSRLQSLCDEINELDFSV  70

Query  207  ------------GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR  350
                        G+    RAVA+ELDV  +G +IE +V +AWD FG ID L+NNAG RG 
Sbjct  71   LSSALASPISPTGAVESRRAVAVELDVCGNGKSIEESVTKAWDYFGFIDTLVNNAGFRGS  130

Query  351  VHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNA  461
            V +P++L+EEEW+    TNL G WLVSKYVC+ M  A
Sbjct  131  VKSPVELSEEEWDYTMGTNLKGQWLVSKYVCILMNKA  167



>dbj|BAK03236.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=283

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 133/173 (77%), Gaps = 2/173 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M S +     + PW +L G+V +VTGASSGIGR+  LDLA+AGCRV+AAARR DRL+SLC
Sbjct  1    MASSLPEKAGVSPWSKLEGQVVLVTGASSGIGRDFCLDLARAGCRVVAAARRADRLRSLC  60

Query  189  DEINGVGSGTPLR--AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTP  362
            DEIN   +       AVA+ELDV+A G A+EAAVQRAWDAFGRID LINNAG+RG VH+ 
Sbjct  61   DEINASAAAVASLPWAVAVELDVAAGGSAVEAAVQRAWDAFGRIDVLINNAGLRGGVHSS  120

Query  363  LDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LD  E+EW+ L KTNLTG WLV+K+VC  M +AK  GS++NISS++GLNRG L
Sbjct  121  LDWPEDEWDKLIKTNLTGLWLVAKHVCRHMRDAKIKGSVINISSVAGLNRGNL  173



>ref|XP_006302904.1| hypothetical protein CARUB_v10021033mg, partial [Capsella rubella]
 gb|EOA35802.1| hypothetical protein CARUB_v10021033mg, partial [Capsella rubella]
Length=175

 Score =   173 bits (438),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 121/149 (81%), Gaps = 1/149 (1%)
 Frame = +3

Query  75   MVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLRAVAIELDVS  254
            +VTGASSGIGREI LDL KAGC++IAAARRVDRL SLC EIN   S   ++A A+ELDVS
Sbjct  2    LVTGASSGIGREICLDLGKAGCKIIAAARRVDRLNSLCSEINSFDS-AGIQAAALELDVS  60

Query  255  ADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSK  434
            +DG  I+ AV+ AW+ FG ID LINNAG+RG V + LD +EEEW+ + +TNLTG+WLVSK
Sbjct  61   SDGDTIQRAVKEAWEIFGNIDVLINNAGIRGNVKSSLDWSEEEWDKVFRTNLTGSWLVSK  120

Query  435  YVCLRMCNAKFggsivnissisgLNRGQL  521
            YVC+ M +AK GGS++NISSISGL+RG L
Sbjct  121  YVCVLMRDAKRGGSVINISSISGLHRGLL  149



>ref|XP_006364792.1| PREDICTED: dehydrogenase/reductase SDR family member 7-like isoform 
X1 [Solanum tuberosum]
Length=154

 Score =   172 bits (435),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 105/132 (80%), Gaps = 2/132 (2%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
             VA HLEPW +L GKV  VTGAS+G+GRE  LDLA++GCRV+A ARR DRLKSLCDEIN 
Sbjct  18   NVANHLEPWLQLEGKVVFVTGASAGLGREFCLDLARSGCRVVAGARRGDRLKSLCDEIN-  76

Query  204  VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEE  383
              +   +RA+AIELDV+ADG  IEA+V++AWDAFG IDALINNAGVRG + + +D++EEE
Sbjct  77   -TNSHLVRAMAIELDVTADGTTIEASVKKAWDAFGHIDALINNAGVRGGIKSSVDISEEE  135

Query  384  WNDLTKTNLTGT  419
            W +  +TN + +
Sbjct  136  WENTLRTNCSAS  147



>ref|XP_011075454.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
isoform X1 [Sesamum indicum]
Length=287

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 126/175 (72%), Gaps = 9/175 (5%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            ++   LEPW  L GK+ MVTGASSG+GRE  LDLAKAGCR+IAAARR+DRL SLCDEIN 
Sbjct  4    EILHTLEPWSRLDGKIVMVTGASSGLGREFCLDLAKAGCRIIAAARRMDRLGSLCDEINQ  63

Query  204  V------GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVR---GRVH  356
            +      G+G    AVA+ELD+++D  AI A++ +AWDAFG ID LINNAGVR   G+  
Sbjct  64   LNSLMVGGNGDGCLAVAVELDITSDDNAIGASIAKAWDAFGHIDVLINNAGVRAEVGQKR  123

Query  357  TPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            + L++ +EEWN +  TNL GTW VSK V  R+  A+   SI+NISSI+GLNR Q 
Sbjct  124  SSLEIGKEEWNQVLNTNLIGTWEVSKCVASRLRFARRKASIINISSITGLNRVQF  178



>ref|XP_009596119.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=298

 Score =   172 bits (435),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 112/153 (73%), Gaps = 4/153 (3%)
 Frame = +3

Query  12   ESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCD  191
            + ++    HLE  R+L  KV  VTGAS G+GRE  LDLA++GC+V+AAARR DRLKSLCD
Sbjct  19   QKKINAVDHLE--RQLEDKVVFVTGASVGLGREFCLDLARSGCKVVAAARRTDRLKSLCD  76

Query  192  EINGVGSGTPLRAVAIELDV--SADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPL  365
            EIN + S       A+ + +  +ADGP I+A+VQ+AWDAFG ID LINNAGVRG + + +
Sbjct  77   EINAMASSNVEVVRAVAVVLNVTADGPLIKASVQKAWDAFGHIDVLINNAGVRGEIKSAV  136

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            D++EEEW++  +TNLTG+WLVSKYV   M  AK
Sbjct  137  DISEEEWHNTLRTNLTGSWLVSKYVGKHMQAAK  169



>ref|XP_009792301.1| PREDICTED: dehydrogenase/reductase SDR family member 7-like [Nicotiana 
sylvestris]
 ref|XP_009792302.1| PREDICTED: dehydrogenase/reductase SDR family member 7-like [Nicotiana 
sylvestris]
Length=192

 Score =   166 bits (420),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 3/105 (3%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +EPW+EL GKV MVTGASSGIGRE SLDLAK+GCR+IAAARRVDRLKSLCDEIN  G   
Sbjct  1    MEPWKELRGKVVMVTGASSGIGREFSLDLAKSGCRIIAAARRVDRLKSLCDEINSEG---  57

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRV  353
            P RA+A+ELDV+A+G  IEAAVQ AWDAFGRIDAL+NNAG+RG +
Sbjct  58   PRRAIAVELDVTANGATIEAAVQIAWDAFGRIDALVNNAGLRGSL  102



>dbj|BAK02348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=281

 Score =   168 bits (426),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +3

Query  45   PWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPL  224
            PW +L G+V +VTGASSG+GRE  LDLA+AGCRV+AAARR  RL+SLCDEIN    G   
Sbjct  13   PWSKLQGQVVLVTGASSGLGREFCLDLARAGCRVVAAARRAGRLRSLCDEINAAAEGPLP  72

Query  225  RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKT  404
             AVA+ELDV+A    +E AVQRAWDAFGR+D LINNAGVRG VH+ LD  E+EW+ L KT
Sbjct  73   LAVAVELDVAAGESLVEDAVQRAWDAFGRVDVLINNAGVRGGVHSALDWPEDEWDKLMKT  132

Query  405  NLTGTWLVSKYVCLRMCNAKF  467
            NL G WLV+K+VC RM +A+ 
Sbjct  133  NLRGVWLVAKHVCRRMRDAEL  153



>ref|XP_006850022.1| hypothetical protein AMTR_s00022p00187970 [Amborella trichopoda]
 gb|ERN11603.1| hypothetical protein AMTR_s00022p00187970 [Amborella trichopoda]
Length=289

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 123/170 (72%), Gaps = 13/170 (8%)
 Frame = +3

Query  42   EPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEIN-------  200
            E  R + GKV MVTGASSG+GRE  L LAK+GC+++A ARR + L+SLC+EIN       
Sbjct  13   ENPRYINGKVIMVTGASSGLGREFCLSLAKSGCKILACARRTELLRSLCEEINSLNVSFG  72

Query  201  ---GVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDL  371
               G  SG    AV++++DVS +G AI+ AVQ AW+ +GRIDALINNAG+RG V +PLDL
Sbjct  73   EFSGQNSG---EAVSVKVDVSQNGKAIDEAVQLAWNIYGRIDALINNAGIRGHVASPLDL  129

Query  372  TEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             EEEWN +  TNL GTWLV++ VC RMC+A   GS++NISSI GL RG L
Sbjct  130  DEEEWNSVMATNLRGTWLVARSVCRRMCDANQKGSVINISSIGGLPRGLL  179



>ref|XP_003574753.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Brachypodium distachyon]
Length=281

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = +3

Query  45   PWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPL  224
            PW  L G+V +VTGASSG+GRE  LDLA+AGCRV+AAARR DRL+SLCDEIN        
Sbjct  13   PWSRLEGQVVLVTGASSGLGREFCLDLARAGCRVVAAARRADRLRSLCDEINAAADAHGT  72

Query  225  RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKT  404
            RAVA+E+DV+A G A EAAVQRAWDAFGRID LINNAG+RG V++ LD  E+EW+ L KT
Sbjct  73   RAVAVEIDVAAGGSAAEAAVQRAWDAFGRIDVLINNAGIRGGVYSALDWPEDEWDKLMKT  132

Query  405  NLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            NLTG WLV+K++C RM  +K  GS++NISS++GLNRG L
Sbjct  133  NLTGLWLVAKHICRRMHESKIKGSVINISSVAGLNRGHL  171



>ref|NP_001152499.1| LOC100286139 [Zea mays]
 gb|ACG47903.1| 3-oxoacyl-reductase [Zea mays]
Length=280

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  48   WRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLR  227
            W  L G+V +VTGASSGIGR+  LDLA+AGCRV+AAARR DRL+SLCDEIN   +    R
Sbjct  13   WSRLEGQVVLVTGASSGIGRDFCLDLARAGCRVVAAARRADRLRSLCDEINPSAASRAPR  72

Query  228  AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTN  407
            AVA+E+DV+A G A+EAAVQ+AWDAFGRIDAL+NNAG+RG VH+PLD  E+EW+ + KTN
Sbjct  73   AVAVEVDVAAGGSALEAAVQKAWDAFGRIDALVNNAGIRGAVHSPLDWPEDEWDRIIKTN  132

Query  408  LTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LTG+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG L
Sbjct  133  LTGSWLVAKHVCRRMRDAKLKGSVVNITSIAGLNRGHL  170



>gb|KDO37848.1| hypothetical protein CISIN_1g033624mg [Citrus sinensis]
Length=115

 Score =   160 bits (404),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 93/111 (84%), Gaps = 3/111 (3%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V+ HLEPW +L  KV MVTGASSG+GRE  LDLAKAGCR++AAARRVDRLKSLCDEIN 
Sbjct  4    QVSDHLEPWHDLNEKVVMVTGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINK  63

Query  204  ---VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRG  347
               VGS   +RAVA+ELDV ADG  IE +VQ+AW+AFGR+DAL+NNAG+RG
Sbjct  64   PGMVGSPDSVRAVAVELDVCADGATIEISVQKAWEAFGRVDALVNNAGIRG  114



>gb|ACS12983.1| 2,4-dienoyl-CoA reductase [Jatropha curcas]
Length=308

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 129/195 (66%), Gaps = 29/195 (15%)
 Frame = +3

Query  24   KVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING  203
            +V   LEPW +L  KV ++TGASSG+GR+  LDLAK+GCR++AAARRV RLKSLC+EIN 
Sbjct  4    QVPAQLEPWCDLHNKVVLITGASSGLGRDFCLDLAKSGCRILAAARRVGRLKSLCEEINQ  63

Query  204  VGS------GTPLRAVAIELDVSADGPAIEAAVQRAWDAFG-------------------  308
            + S       T LRAVA+ELDV  DG  I+ +VQ AW+A G                   
Sbjct  64   LPSSANVKPSTGLRAVAVELDVCVDGVTIDKSVQSAWEALGESMLWLIMLVLEVFYIFCL  123

Query  309  ---RIDALINNAG-VRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggs  476
               +        G V G V TPLDL+EEEWN + +TNLTG+WLVSK VCLRM +AK GGS
Sbjct  124  DDEKFPIFEKIYGVVSGSVKTPLDLSEEEWNHVIRTNLTGSWLVSKSVCLRMRDAKQGGS  183

Query  477  ivnissisgLNRGQL  521
            I+NISSI+GL+RGQL
Sbjct  184  IINISSIAGLDRGQL  198



>tpg|DAA47976.1| TPA: 3-oxoacyl-reductase [Zea mays]
Length=280

 Score =   164 bits (415),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  48   WRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLR  227
            W  L G+V +VTGASSGIGR+  LDLA+AGCRV+AAARR DRL+SLCDEIN   +    R
Sbjct  13   WSRLEGQVVLVTGASSGIGRDFCLDLARAGCRVVAAARRADRLRSLCDEINASAASRAPR  72

Query  228  AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTN  407
            AVA+E+DV+A G A+EAAVQ+AWDAFGRIDAL+NNAG+RG VH+PLD  E+EW+ + KTN
Sbjct  73   AVAVEVDVAAGGSALEAAVQKAWDAFGRIDALVNNAGIRGAVHSPLDWPEDEWDRIIKTN  132

Query  408  LTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LTG+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG L
Sbjct  133  LTGSWLVAKHVCRRMRDAKLKGSVVNITSIAGLNRGHL  170



>ref|XP_008680945.1| PREDICTED: LOC100286139 isoform X4 [Zea mays]
Length=275

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  48   WRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLR  227
            W  L G+V +VTGASSGIGR+  LDLA+AGCRV+AAARR DRL+SLCDEIN   +    R
Sbjct  13   WSRLEGQVVLVTGASSGIGRDFCLDLARAGCRVVAAARRADRLRSLCDEINASAASRAPR  72

Query  228  AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTN  407
            AVA+E+DV+A G A+EAAVQ+AWDAFGRIDAL+NNAG+RG VH+PLD  E+EW+ + KTN
Sbjct  73   AVAVEVDVAAGGSALEAAVQKAWDAFGRIDALVNNAGIRGAVHSPLDWPEDEWDRIIKTN  132

Query  408  LTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LTG+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG L
Sbjct  133  LTGSWLVAKHVCRRMRDAKLKGSVVNITSIAGLNRGHL  170



>ref|XP_008680943.1| PREDICTED: LOC100286139 isoform X3 [Zea mays]
Length=292

 Score =   164 bits (414),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  48   WRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLR  227
            W  L G+V +VTGASSGIGR+  LDLA+AGCRV+AAARR DRL+SLCDEIN   +    R
Sbjct  13   WSRLEGQVVLVTGASSGIGRDFCLDLARAGCRVVAAARRADRLRSLCDEINASAASRAPR  72

Query  228  AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTN  407
            AVA+E+DV+A G A+EAAVQ+AWDAFGRIDAL+NNAG+RG VH+PLD  E+EW+ + KTN
Sbjct  73   AVAVEVDVAAGGSALEAAVQKAWDAFGRIDALVNNAGIRGAVHSPLDWPEDEWDRIIKTN  132

Query  408  LTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LTG+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG L
Sbjct  133  LTGSWLVAKHVCRRMRDAKLKGSVVNITSIAGLNRGHL  170



>ref|XP_008680941.1| PREDICTED: LOC100286139 isoform X2 [Zea mays]
 gb|ACN26914.1| unknown [Zea mays]
Length=315

 Score =   164 bits (414),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  48   WRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLR  227
            W  L G+V +VTGASSGIGR+  LDLA+AGCRV+AAARR DRL+SLCDEIN   +    R
Sbjct  13   WSRLEGQVVLVTGASSGIGRDFCLDLARAGCRVVAAARRADRLRSLCDEINASAASRAPR  72

Query  228  AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTN  407
            AVA+E+DV+A G A+EAAVQ+AWDAFGRIDAL+NNAG+RG VH+PLD  E+EW+ + KTN
Sbjct  73   AVAVEVDVAAGGSALEAAVQKAWDAFGRIDALVNNAGIRGAVHSPLDWPEDEWDRIIKTN  132

Query  408  LTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LTG+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG L
Sbjct  133  LTGSWLVAKHVCRRMRDAKLKGSVVNITSIAGLNRGHL  170



>tpg|DAA47977.1| TPA: hypothetical protein ZEAMMB73_585385 [Zea mays]
Length=319

 Score =   164 bits (414),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  48   WRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLR  227
            W  L G+V +VTGASSGIGR+  LDLA+AGCRV+AAARR DRL+SLCDEIN   +    R
Sbjct  13   WSRLEGQVVLVTGASSGIGRDFCLDLARAGCRVVAAARRADRLRSLCDEINASAASRAPR  72

Query  228  AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTN  407
            AVA+E+DV+A G A+EAAVQ+AWDAFGRIDAL+NNAG+RG VH+PLD  E+EW+ + KTN
Sbjct  73   AVAVEVDVAAGGSALEAAVQKAWDAFGRIDALVNNAGIRGAVHSPLDWPEDEWDRIIKTN  132

Query  408  LTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LTG+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG L
Sbjct  133  LTGSWLVAKHVCRRMRDAKLKGSVVNITSIAGLNRGHL  170



>ref|XP_008680935.1| PREDICTED: LOC100286139 isoform X1 [Zea mays]
Length=366

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  48   WRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLR  227
            W  L G+V +VTGASSGIGR+  LDLA+AGCRV+AAARR DRL+SLCDEIN   +    R
Sbjct  13   WSRLEGQVVLVTGASSGIGRDFCLDLARAGCRVVAAARRADRLRSLCDEINASAASRAPR  72

Query  228  AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTN  407
            AVA+E+DV+A G A+EAAVQ+AWDAFGRIDAL+NNAG+RG VH+PLD  E+EW+ + KTN
Sbjct  73   AVAVEVDVAAGGSALEAAVQKAWDAFGRIDALVNNAGIRGAVHSPLDWPEDEWDRIIKTN  132

Query  408  LTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LTG+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG L
Sbjct  133  LTGSWLVAKHVCRRMRDAKLKGSVVNITSIAGLNRGHL  170



>ref|XP_002884088.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH60347.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=278

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 116/172 (67%), Gaps = 21/172 (12%)
 Frame = +3

Query  6    EMESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSL  185
            E   R  ++ H  PW EL  KV +VTGASSGIGRE+ LDLAKAGC++IA ARRVDRLKSL
Sbjct  18   EHAKRNNMSNHQTPWCELKDKVVLVTGASSGIGREVCLDLAKAGCKIIAEARRVDRLKSL  77

Query  186  CDEINGVGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPL  365
            C EIN       L+A A+ELDVS+D P I+ A          ID LINNAG RG      
Sbjct  78   CSEINSFEYSAGLQAAALELDVSSDAPTIQKA----------IDVLINNAGFRG------  121

Query  366  DLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
                  W+ + KTNLTGTWLVSKYVC+ M +AK GGS+++I S+SGL+RGQ+
Sbjct  122  -----NWDKVIKTNLTGTWLVSKYVCILMRDAKRGGSVISILSVSGLHRGQV  168



>ref|XP_006362945.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X3 [Solanum tuberosum]
Length=260

 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 110/142 (77%), Gaps = 3/142 (2%)
 Frame = +3

Query  48   WRE-LTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGS--GT  218
            W++ L  KV MVTGASSGIGRE+S++LAK GCR+I +ARRVD+LKSLC+ IN      G 
Sbjct  4    WQDGLNRKVVMVTGASSGIGRELSINLAKVGCRIIVSARRVDKLKSLCNHINSSSKSEGP  63

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
             L A+A+ELDV+A+G  IEAAVQ AWDAFGRIDAL+NNAGVRG V + L+L+EEEW    
Sbjct  64   SLNAIAVELDVTANGGNIEAAVQIAWDAFGRIDALVNNAGVRGSVSSSLELSEEEWEHTF  123

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G WLVSK+VC  M +AK
Sbjct  124  TTNLRGAWLVSKFVCRHMIDAK  145



>ref|XP_006362944.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=275

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 110/142 (77%), Gaps = 3/142 (2%)
 Frame = +3

Query  48   WRE-LTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGS--GT  218
            W++ L  KV MVTGASSGIGRE+S++LAK GCR+I +ARRVD+LKSLC+ IN      G 
Sbjct  4    WQDGLNRKVVMVTGASSGIGRELSINLAKVGCRIIVSARRVDKLKSLCNHINSSSKSEGP  63

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
             L A+A+ELDV+A+G  IEAAVQ AWDAFGRIDAL+NNAGVRG V + L+L+EEEW    
Sbjct  64   SLNAIAVELDVTANGGNIEAAVQIAWDAFGRIDALVNNAGVRGSVSSSLELSEEEWEHTF  123

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G WLVSK+VC  M +AK
Sbjct  124  TTNLRGAWLVSKFVCRHMIDAK  145



>ref|XP_006362943.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=276

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 110/142 (77%), Gaps = 3/142 (2%)
 Frame = +3

Query  48   WRE-LTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGS--GT  218
            W++ L  KV MVTGASSGIGRE+S++LAK GCR+I +ARRVD+LKSLC+ IN      G 
Sbjct  4    WQDGLNRKVVMVTGASSGIGRELSINLAKVGCRIIVSARRVDKLKSLCNHINSSSKSEGP  63

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
             L A+A+ELDV+A+G  IEAAVQ AWDAFGRIDAL+NNAGVRG V + L+L+EEEW    
Sbjct  64   SLNAIAVELDVTANGGNIEAAVQIAWDAFGRIDALVNNAGVRGSVSSSLELSEEEWEHTF  123

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G WLVSK+VC  M +AK
Sbjct  124  TTNLRGAWLVSKFVCRHMIDAK  145



>pir||S39508 alcohol dehydrogenase homolog, ripening-related - tomato  (fragment)
Length=242

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 105/132 (80%), Gaps = 6/132 (5%)
 Frame = +3

Query  144  VIAAARRVDRLKSLCDEING------VGSGTPLRAVAIELDVSADGPAIEAAVQRAWDAF  305
            +IAAARR+DRL+SLCDEIN         S   LRAVAIELDVSA+G AIEAAVQ+AWDAF
Sbjct  1    IIAAARRIDRLQSLCDEINSNSSNGSTKSSQDLRAVAIELDVSANGSAIEAAVQKAWDAF  60

Query  306  GRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivn  485
            GRID L+NNAG RG V +PL+L+EEEW  + KTNL G WLV+KYVC+ M  A  GGSI+N
Sbjct  61   GRIDGLVNNAGFRGSVLSPLELSEEEWEKIHKTNLRGAWLVTKYVCMHMRAANQGGSIIN  120

Query  486  issisgLNRGQL  521
            ISSI+G+NRGQL
Sbjct  121  ISSIAGINRGQL  132



>ref|XP_006365822.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic-like 
[Solanum tuberosum]
Length=116

 Score =   153 bits (386),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 87/106 (82%), Gaps = 3/106 (3%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT  218
            +E W++L+GKV MVTGASSGIGREI LDLAKAGC +IA+ARR DRLKSLCD IN  G   
Sbjct  1    MESWKDLSGKVVMVTGASSGIGREICLDLAKAGCSIIASARRFDRLKSLCDAINSEGRQC  60

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVH  356
               A A+ELD++ADG  +EA VQRAWDAFGRIDALINNAG+RG +H
Sbjct  61   ---AFALELDITADGFTVEAVVQRAWDAFGRIDALINNAGLRGNIH  103



>ref|XP_008340684.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Malus domestica]
Length=130

 Score =   153 bits (387),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 97/126 (77%), Gaps = 14/126 (11%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME+  +++ +LEPW  L GKV MVTGASSG+GRE+ LDLAKAGCR++AAARR+DRL+S+C
Sbjct  1    MENPHRLSDNLEPWSHLHGKVVMVTGASSGLGRELCLDLAKAGCRIVAAARRIDRLQSVC  60

Query  189  DEINGV--------------GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALI  326
            D+IN +              G+G   RAVA+ELDVSADGPAIE +V +AWDAFG IDAL+
Sbjct  61   DQINQLSITAPSSSSSVADSGTGGGPRAVAVELDVSADGPAIEKSVNKAWDAFGLIDALV  120

Query  327  NNAGVR  344
            NNAG+R
Sbjct  121  NNAGIR  126



>ref|XP_006364794.1| PREDICTED: dehydrogenase/reductase SDR family member 7-like isoform 
X3 [Solanum tuberosum]
Length=133

 Score =   150 bits (379),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 88/106 (83%), Gaps = 2/106 (2%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            VA HLEPW +L GKV  VTGAS+G+GRE  LDLA++GCRV+A ARR DRLKSLCDEIN  
Sbjct  19   VANHLEPWLQLEGKVVFVTGASAGLGREFCLDLARSGCRVVAGARRGDRLKSLCDEIN--  76

Query  207  GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVR  344
             +   +RA+AIELDV+ADG  IEA+V++AWDAFG IDALINNAGVR
Sbjct  77   TNSHLVRAMAIELDVTADGTTIEASVKKAWDAFGHIDALINNAGVR  122



>ref|XP_006299633.1| hypothetical protein CARUB_v10015813mg, partial [Capsella rubella]
 gb|EOA32531.1| hypothetical protein CARUB_v10015813mg, partial [Capsella rubella]
Length=195

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 108/135 (80%), Gaps = 5/135 (4%)
 Frame = +3

Query  117  LDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTP--LRAVAIELDVSADGPAIEAAVQR  290
             DL KAGC+++AA RRVDRLKSLC EIN   S  P  ++A A+ELDVS+D   I+ AV+ 
Sbjct  2    FDLGKAGCKIVAAVRRVDRLKSLCSEIN---SFNPRGIQAAALELDVSSDAATIQKAVKE  58

Query  291  AWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFg  470
            AW+ FG+IDALINNAG RG V + LDL+E+EW+ + KTNLTGTWLVSKY+C+ M +AK G
Sbjct  59   AWEIFGKIDALINNAGFRGNVRSSLDLSEDEWDKVFKTNLTGTWLVSKYICVLMRDAKHG  118

Query  471  gsivnissisgLNRG  515
            GS++NISS+SGL+RG
Sbjct  119  GSVINISSVSGLHRG  133



>ref|XP_001760079.1| predicted protein [Physcomitrella patens]
 gb|EDQ75204.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 100/142 (70%), Gaps = 6/142 (4%)
 Frame = +3

Query  57   LTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGT------  218
            L GKVA++TGASSG+GRE +L L+K G  VI AARR + L SLCDEIN + + +      
Sbjct  4    LEGKVALITGASSGLGREFALSLSKNGANVILAARRKNLLDSLCDEINALANQSEGKGPR  63

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
              +AVAIELDVSA  P I+AAV++AW A G ID L+NNAG+RG V TP+D  E EWN + 
Sbjct  64   SGKAVAIELDVSASEPVIDAAVEKAWAALGYIDVLVNNAGLRGPVRTPIDQEEHEWNAIF  123

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL GTWL+SK V  R+  AK
Sbjct  124  NTNLRGTWLMSKAVSKRLVAAK  145



>ref|XP_006303027.1| hypothetical protein CARUB_v10021183mg, partial [Capsella rubella]
 gb|EOA35925.1| hypothetical protein CARUB_v10021183mg, partial [Capsella rubella]
Length=110

 Score =   147 bits (371),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  27   VARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV  206
            V R LEPW EL  KV +V GASSGIGREI LDL KAGC++IAAARRVDRL SLC EIN  
Sbjct  1    VLRQLEPWCELKDKVVLVAGASSGIGREICLDLGKAGCKIIAAARRVDRLNSLCSEINSF  60

Query  207  GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHT  359
            GS T ++A A+ELDVS+DG  I+ AV+ AW+ FG ID LINNAG+RG V +
Sbjct  61   GS-TGIQAAALELDVSSDGATIQKAVKEAWEIFGNIDVLINNAGIRGNVKS  110



>gb|EAZ43296.1| hypothetical protein OsJ_27892 [Oryza sativa Japonica Group]
Length=274

 Score =   150 bits (378),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 111/159 (70%), Gaps = 12/159 (8%)
 Frame = +3

Query  48   WRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKS-LCDEINGVGSGTPL  224
            W  L G+V +             LDLA+AGC V+AAARR DR  S L  + +    G   
Sbjct  17   WSRLEGRVVL-----------FCLDLARAGCLVVAAARRADRFGSALRRDQSLPAPGVSA  65

Query  225  RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKT  404
             A A+ELDV++ GPA+EAAVQ AWDAFGRID LINNAG+RG VH+PLD  E+EW  L KT
Sbjct  66   AAAAVELDVASGGPALEAAVQSAWDAFGRIDVLINNAGLRGGVHSPLDWPEDEWETLIKT  125

Query  405  NLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            NLTG+WLV+K+VC RM +AK  GS++NISS+SGLNRG L
Sbjct  126  NLTGSWLVAKHVCRRMRDAKLKGSVINISSVSGLNRGHL  164



>gb|ABK21106.1| unknown [Picea sitchensis]
Length=295

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 117/176 (66%), Gaps = 4/176 (2%)
 Frame = +3

Query  3    SEMESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKS  182
            S ME + +  + L    +L GKVA+VTGAS+G+GRE +L LAK GC V+  ARR D L+S
Sbjct  10   SSMEGKTE-KKGLNYREDLVGKVALVTGASAGLGREFALSLAKNGCHVVVTARRQDLLRS  68

Query  183  LCDEINGVGSGTPL---RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRV  353
            +C EI+ + S +P    +++ ++LDVSA    I+ AV++AW  FG ID L+NNAG RG V
Sbjct  69   VCHEIDLLNSFSPFQPAKSMMLQLDVSASEKDIDMAVEKAWQGFGAIDILVNNAGYRGTV  128

Query  354  HTPLDLTEEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
             +PL   EEEWN +  TN+ G WLVSK V  RM +A   GSI+NISS +  NRG L
Sbjct  129  KSPLQYDEEEWNTVINTNMRGVWLVSKCVAKRMRDAGKKGSIINISSTASANRGNL  184



>gb|EYU20809.1| hypothetical protein MIMGU_mgv11b016674mg [Erythranthe guttata]
Length=267

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 112/153 (73%), Gaps = 11/153 (7%)
 Frame = +3

Query  84   GASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEING---------VGSGTPLRAVA  236
            GASSG+G    LDLAKAGCR++AAARRV++L SLC +IN             GT L AVA
Sbjct  15   GASSGLGF-FCLDLAKAGCRIVAAARRVEKLDSLCQQINNNKMEYSMSLTIYGTRL-AVA  72

Query  237  IELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTG  416
            +ELDV+AD  AIEA+V +AWDAFG ID LINNAG RG+V +PL L+ EEWN + KT LTG
Sbjct  73   VELDVTADPAAIEASVWKAWDAFGHIDTLINNAGFRGQVRSPLTLSPEEWNQVVKTILTG  132

Query  417  TWLVSKYVCLRMCNAKFggsivnissisgLNRG  515
            +WLV+K V  RM  A   GSI+NISS+SGLNRG
Sbjct  133  SWLVAKSVGKRMRAAARNGSIINISSVSGLNRG  165



>gb|ADE77298.1| unknown [Picea sitchensis]
Length=289

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 113/169 (67%), Gaps = 12/169 (7%)
 Frame = +3

Query  51   RELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTP---  221
            + L GKV +VTGASSG+GRE +L  A+ GC ++A ARR   L SLC +I+ + +  P   
Sbjct  11   KGLEGKVVLVTGASSGLGREFALSFARRGCNIVATARRTQLLISLCQDIDKLNNSAPASL  70

Query  222  ---------LRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLT  374
                     ++A+A++LDVS     ++AAV  AW  FGRID LINNAG RG V++ LDL 
Sbjct  71   QGCSNSRLLVKALAVKLDVSQSDAVVDAAVGIAWQCFGRIDVLINNAGFRGNVNSSLDLK  130

Query  375  EEEWNDLTKTNLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            E+EWN +  TNL GTWLVSK V  RM  AK GGSI+NISSI GL RG+L
Sbjct  131  EDEWNKVITTNLRGTWLVSKAVGKRMREAKRGGSIINISSIGGLPRGEL  179



>ref|XP_006660269.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Oryza brachyantha]
Length=246

 Score =   141 bits (356),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 101/159 (64%), Gaps = 39/159 (25%)
 Frame = +3

Query  45   PWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPL  224
            PW  L G+V +VTGASSG+GRE  LDL                                 
Sbjct  17   PWGRLDGQVVLVTGASSGLGREFCLDL---------------------------------  43

Query  225  RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKT  404
                  LDV++ G A+EAAVQRAWDAFGRID LINNAG+RG VH+PLD  E++WN L KT
Sbjct  44   ------LDVASGGAALEAAVQRAWDAFGRIDVLINNAGLRGGVHSPLDWPEDDWNTLIKT  97

Query  405  NLTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            NLTG+WLVSK+VC RM +AK  GS++NISS+SGLNRG L
Sbjct  98   NLTGSWLVSKHVCRRMHDAKIKGSVINISSVSGLNRGHL  136



>ref|XP_009391135.1| PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydroxysteroid dehydrogenase-like 
4A [Musa acuminata subsp. malaccensis]
Length=125

 Score =   135 bits (341),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 85/108 (79%), Gaps = 2/108 (2%)
 Frame = +3

Query  33   RHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGS  212
            R   PWR L GKV MVTGASSGIG +  LDLA+AGC++IAAARR DRL+S+C+EIN  GS
Sbjct  8    RTSPPWRSLDGKVVMVTGASSGIGWDHCLDLARAGCQIIAAARRTDRLRSICEEINXSGS  67

Query  213  G--TPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR  350
               + +R+VAIELDVS+  PAI A+VQRA D F RID L+NNAG+RG+
Sbjct  68   SETSAIRSVAIELDVSSGEPAIAASVQRACDTFDRIDGLVNNAGIRGK  115



>ref|XP_004174045.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like, 
partial [Cucumis sativus]
Length=111

 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVG-SG  215
            LEPW +L GKV MVTGASSG+GRE  LDLA+AGC++IAAARR  RL+SLCDEIN +  S 
Sbjct  11   LEPWNDLNGKVVMVTGASSGLGREFCLDLARAGCKIIAAARRTSRLQSLCDEINELDFSS  70

Query  216  TPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVR  344
             P  AVA+ELDV  +G +IE +V +AWD FG ID L+NNAG+R
Sbjct  71   RP--AVAVELDVCGNGKSIEESVTKAWDYFGFIDTLVNNAGLR  111



>gb|EMS67034.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Triticum urartu]
Length=248

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 85/140 (61%), Gaps = 33/140 (24%)
 Frame = +3

Query  48   WRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLR  227
            W +L G+V +VTGASSGIGRE  LDLA+ GCR                            
Sbjct  14   WSKLQGQVVLVTGASSGIGREFCLDLARGGCR----------------------------  45

Query  228  AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTN  407
                 LDV+A    +EAAVQ+AWDAFGR+D LINNAGVRG VH+ LD  E+EW+ L KTN
Sbjct  46   -----LDVAAGESFVEAAVQKAWDAFGRVDVLINNAGVRGGVHSALDWPEDEWDKLMKTN  100

Query  408  LTGTWLVSKYVCLRMCNAKF  467
            L G WLV+K+VC RM +AK 
Sbjct  101  LRGVWLVAKHVCRRMRDAKL  120



>gb|EMT10558.1| 3-oxoacyl-(acyl-carrier-protein) reductase 3, chloroplastic [Aegilops 
tauschii]
Length=179

 Score =   131 bits (330),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = +3

Query  45   PWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPL  224
            PW +L G+V +VTGASSG+GRE  LDLA+AGCRV+ AARR DRL+SLCDEIN      PL
Sbjct  13   PWSKLQGQVVLVTGASSGLGREFCLDLARAGCRVVGAARRADRLRSLCDEINAAAQ-VPL  71

Query  225  RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRG  347
             AVA+ LDV+A   ++EAAV  AWDAFGR+D LINNAGVR 
Sbjct  72   -AVAVGLDVAAGESSVEAAVLTAWDAFGRVDVLINNAGVRA  111



>gb|KGN54696.1| hypothetical protein Csa_4G429300 [Cucumis sativus]
Length=134

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 82/118 (69%), Gaps = 16/118 (14%)
 Frame = +3

Query  39   LEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV----  206
            LEPW +L GKV MVTGAS+G+GRE  LDLA+AGC++IAAARR  RL+SLCDEIN +    
Sbjct  11   LEPWNDLNGKVVMVTGASAGLGREFCLDLARAGCKIIAAARRTSRLQSLCDEINELDFSV  70

Query  207  ------------GSGTPLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVR  344
                        G+    RAVA+ELDV  +G +IE +V++AWD FG ID L+NNAG R
Sbjct  71   LSSALASPISPTGAVESRRAVAVELDVCGNGKSIEESVRKAWDYFGFIDTLVNNAGFR  128



>gb|KHN24253.1| 3-oxoacyl-[acyl-carrier-protein] reductase 1 [Glycine soja]
Length=202

 Score =   127 bits (318),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  249  VSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLTGTWLV  428
            V+ADGPAI+ AVQ+AWDAFGR+D+LINNAGVRG V +PL L+EEEW+ + KTNLTG WLV
Sbjct  2    VAADGPAIDRAVQKAWDAFGRVDSLINNAGVRGSVKSPLKLSEEEWDHVFKTNLTGCWLV  61

Query  429  SKYVCLRMCNAKFggsivnissisgLNRGQL  521
            SKYVC RMC+ +  GSI+NISS+SGLNRGQL
Sbjct  62   SKYVCKRMCDIQLKGSIINISSVSGLNRGQL  92



>ref|XP_008351408.1| PREDICTED: very-long-chain 3-oxoacyl-CoA reductase-like [Malus 
domestica]
Length=170

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 15/109 (14%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            ME+  +V+ HLEPWR L GKV MVTGASSG+GR+  LDLAKAGCR++AAARR+DRL+S+C
Sbjct  1    MENSHQVSDHLEPWRHLHGKVVMVTGASSGLGRDFCLDLAKAGCRIVAAARRIDRLQSVC  60

Query  189  DEINGVGSGTP---------------LRAVAIELDVSADGPAIEAAVQR  290
            D+IN +    P                RAVA+ELDVSADGPAIE +V R
Sbjct  61   DQINQLSITAPSFSSSAVADNIPGGGPRAVAVELDVSADGPAIEKSVNR  109



>ref|XP_006303056.1| hypothetical protein CARUB_v10021215mg, partial [Capsella rubella]
 gb|EOA35954.1| hypothetical protein CARUB_v10021215mg, partial [Capsella rubella]
Length=90

 Score =   115 bits (288),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +3

Query  9    MESRVKVARHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLC  188
            M +   V R LEPW EL  KV +VTGASSGIGREI LDL KAGC++IAAARRVDRL SLC
Sbjct  1    MSNHQTVLRQLEPWCELKDKVVLVTGASSGIGREICLDLGKAGCKIIAAARRVDRLNSLC  60

Query  189  DEINGVGSGTPLRAVAIELDVSADGPAIEAA  281
             EIN  GS T ++A A+ELDVS+DG  ++ A
Sbjct  61   SEINSFGS-TGIQAAALELDVSSDGATVQKA  90



>gb|EMS50889.1| Gluconate 5-dehydrogenase [Triticum urartu]
Length=226

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  228  AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTN  407
            AVAIELDV+A G  +EAAVQRAWDAFGRID LINNAG+RG +H+ LD  E++W+ L KTN
Sbjct  19   AVAIELDVAAGGSTVEAAVQRAWDAFGRIDVLINNAGLRGGIHSSLDWPEDDWDKLHKTN  78

Query  408  LTGTWLVSKYVCLRMCNAKFggsivnissisgLNRGQL  521
            LTG+WLV+K+VC  M +AK  GS++NISS++GL+RG +
Sbjct  79   LTGSWLVAKHVCRHMRDAKIKGSVINISSVAGLHRGDV  116



>ref|XP_002974604.1| hypothetical protein SELMODRAFT_101607 [Selaginella moellendorffii]
 gb|EFJ24124.1| hypothetical protein SELMODRAFT_101607 [Selaginella moellendorffii]
Length=278

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 91/149 (61%), Gaps = 22/149 (15%)
 Frame = +3

Query  66   KVAMVTGASSGIGREISLDLAKAGC-RVIAAARRVDRLKSLCDEINGVGSGTPLRAVAIE  242
            +V +VTGASSG+G+E ++  A+ G  RV+ AARR   L+S+C+EI          A ++E
Sbjct  7    RVVLVTGASSGLGKEFAIAFARQGSYRVVLAARRTHLLESVCEEIG------HHDARSVE  60

Query  243  LDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR---------------VHTPLDLTE  377
            LDVSA+   I+AAV RAW+ FG +D LINNAG+RG                V +PL+L E
Sbjct  61   LDVSANEKFIDAAVDRAWNCFGGVDVLINNAGIRGNSSISFSLSFENMKRPVKSPLELDE  120

Query  378  EEWNDLTKTNLTGTWLVSKYVCLRMCNAK  464
            ++WN    TN  GTWLVSK V  RM  AK
Sbjct  121  DDWNKTFNTNTRGTWLVSKAVARRMVAAK  149



>ref|XP_002963314.1| hypothetical protein SELMODRAFT_80357 [Selaginella moellendorffii]
 gb|EFJ35185.1| hypothetical protein SELMODRAFT_80357 [Selaginella moellendorffii]
Length=275

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +3

Query  66   KVAMVTGASSGIGREISLDLAKAGC-RVIAAARRVDRLKSLCDEINGVGSGTPLRAVAIE  242
            +V +VTGASSG+G+E ++  A+ G  RV+ AARR   L+S+C+EI          A ++E
Sbjct  8    RVVLVTGASSGLGKEFAIAFAQQGSYRVVLAARRTHLLESVCEEIG------HHDARSVE  61

Query  243  LDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGR-----------VHTPLDLTEEEWN  389
            LDVSA    I+A V RAW+ FG +D L+NNAG+RG            V +PL+L E++WN
Sbjct  62   LDVSASEKFIDAGVDRAWNCFGGVDVLVNNAGIRGNIIFCFSFPSGPVKSPLELDEDDWN  121

Query  390  DLTKTNLTGTWLVSKYVCLRMCNAK  464
                TN  GTWLVSK V  RM  AK
Sbjct  122  KTFNTNTRGTWLVSKAVARRMVAAK  146



>ref|XP_009139356.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Brassica rapa]
Length=247

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  228  AVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTN  407
            A  IELDVS+D   I+ AV++AWD FG+ID LINNAG+RG V T LDLTE+EWN + +TN
Sbjct  40   AAPIELDVSSDAATIQKAVKQAWDIFGKIDVLINNAGIRGNVKTSLDLTEDEWNTVFRTN  99

Query  408  LTGTWLVSKYVCLRMCNAKFggsivnissisgLNRG  515
            LTG WLVSKYVC  M ++K GGS++N+SSISGL+RG
Sbjct  100  LTGPWLVSKYVCSLMRDSKRGGSVINVSSISGLHRG  135



>ref|XP_009599582.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=167

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
            P RA A+ELD++ADG  I+A VQ AWDAFG IDAL+NNAGVRG V + +D +E+E N   
Sbjct  46   PPRAFAMELDITADGATIKAPVQIAWDAFGGIDALVNNAGVRGSVSSSVDFSEDERNHTF  105

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G WLVSKYVC RM +AK
Sbjct  106  NTNLRGAWLVSKYVCRRMRDAK  127



>ref|XP_009599581.1| PREDICTED: glucose and ribitol dehydrogenase homolog isoform 
X1 [Nicotiana tomentosiformis]
Length=180

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  219  PLRAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLT  398
            P RA A+ELD++ADG  I+A VQ AWDAFG IDAL+NNAGVRG V + +D +E+E N   
Sbjct  46   PPRAFAMELDITADGATIKAPVQIAWDAFGGIDALVNNAGVRGSVSSSVDFSEDERNHTF  105

Query  399  KTNLTGTWLVSKYVCLRMCNAK  464
             TNL G WLVSKYVC RM +AK
Sbjct  106  NTNLRGAWLVSKYVCRRMRDAK  127



>emb|CBI32788.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 63/87 (72%), Gaps = 6/87 (7%)
 Frame = +3

Query  210  SGTPL------RAVAIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDL  371
            SG+PL      RAVA+E DV+AD P I+A+V +AWD FGRID LINN G RG V   L+L
Sbjct  48   SGSPLNPNTTVRAVAVEFDVTADDPTIDASVHKAWDGFGRIDVLINNVGFRGTVKNSLEL  107

Query  372  TEEEWNDLTKTNLTGTWLVSKYVCLRM  452
             EEEW +  KTNL GTWLVSK+VC RM
Sbjct  108  DEEEWGEGMKTNLNGTWLVSKHVCRRM  134



>ref|XP_010091025.1| hypothetical protein L484_005062 [Morus notabilis]
 gb|EXB41836.1| hypothetical protein L484_005062 [Morus notabilis]
Length=123

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 66/111 (59%), Gaps = 27/111 (24%)
 Frame = +3

Query  33   RHLEPWRELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGV--  206
              LEPW +L+GKV                     GC VIA  RRVDRLKSL D+IN V  
Sbjct  5    HQLEPWHDLSGKV---------------------GCHVIATTRRVDRLKSLYDQINNVVL  43

Query  207  ---GSGTPLRAVAIELDVSADGPAIE-AAVQRAWDAFGRIDALINNAGVRG  347
                S   LR V +ELDV ADGP IE + VQ+AW+AFGRIDALINNAG RG
Sbjct  44   PTQSSSVDLRGVVVELDVCADGPTIEKSVVQKAWEAFGRIDALINNAGFRG  94



>ref|WP_016208602.1| short-chain dehydrogenase/reductase SDR [Clostridium sartagoforme]
 gb|EOR20481.1| short-chain dehydrogenase/reductase SDR [Clostridium sartagoforme 
AAU1]
Length=255

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 90/140 (64%), Gaps = 10/140 (7%)
 Frame = +3

Query  54   ELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLRAV  233
            EL GK+A+VTGASSG+GR+ +L  A  G  V   ARRV++++SL  EI  +G    + ++
Sbjct  3    ELNGKIAVVTGASSGLGRDAALAYANEGANVCVLARRVEKIESLAKEIKNLG----VESI  58

Query  234  AIELDVSADGPAIEAAVQRAWDAFGRIDALINNAG--VRGRVHTPLDLTEEEWNDLTKTN  407
            AI+ DV+ +   I+ AV+   + FGRID L+NNAG  VRG V T   L+EE+W+    TN
Sbjct  59   AIKCDVTKE-EEIKTAVEAIINRFGRIDILLNNAGIAVRGGVDT---LSEEDWDKSMDTN  114

Query  408  LTGTWLVSKYVCLRMCNAKF  467
            + G +LVSKYV   M N  +
Sbjct  115  VKGIYLVSKYVIPIMKNQNY  134



>ref|WP_008679993.1| short-chain dehydrogenase [Clostridium sp. 7_2_43FAA]
 gb|EEH97154.2| hypothetical protein CSBG_00780 [Clostridium sp. 7_2_43FAA]
Length=255

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 89/135 (66%), Gaps = 10/135 (7%)
 Frame = +3

Query  54   ELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLRAV  233
            +L GK+A+VTGASSG+GR+ +L  AK G  V   ARR+++++SL  EI  +G    + ++
Sbjct  3    DLKGKIAVVTGASSGLGRDAALAYAKEGANVCVLARRIEKIESLAKEIEALG----VESI  58

Query  234  AIELDVSADGPAIEAAVQRAWDAFGRIDALINNAG--VRGRVHTPLDLTEEEWNDLTKTN  407
            AI+ DV+ +   ++ AV+   + FGR+D L+NNAG  VRG V T   L+EEEW+    TN
Sbjct  59   AIKCDVTNE-EEVKVAVETIVNKFGRVDILLNNAGIAVRGGVET---LSEEEWDKSMDTN  114

Query  408  LTGTWLVSKYVCLRM  452
            + G +LVSKYV   M
Sbjct  115  VKGIYLVSKYVIPVM  129



>ref|WP_010074325.1| short-chain dehydrogenase [Clostridium cellulovorans]
 gb|ADL53967.1| short-chain dehydrogenase/reductase SDR [Clostridium cellulovorans 
743B]
Length=255

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 88/134 (66%), Gaps = 8/134 (6%)
 Frame = +3

Query  54   ELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLRAV  233
            EL GKVA+VTGASSG+G++ +L  AK G  V   ARRV++++ +  E+  +G    ++A+
Sbjct  3    ELNGKVAVVTGASSGLGKDAALAYAKEGVNVALLARRVEKIEEIAKEVESLG----VKAI  58

Query  234  AIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLD-LTEEEWNDLTKTNL  410
            AI+ DV+ +   ++ A++   + FGRID L+NNAGV    H  +D L+EEEWN +   N+
Sbjct  59   AIKCDVAKE-EEVKVAIETIVNEFGRIDILLNNAGVTA--HGGVDSLSEEEWNKVMDINV  115

Query  411  TGTWLVSKYVCLRM  452
             G +LVSKYV   M
Sbjct  116  KGIYLVSKYVIPVM  129



>ref|WP_029011209.1| 2-deoxy-D-gluconate 3-dehydrogenase [Azospirillum halopraeferens]
Length=256

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 81/127 (64%), Gaps = 6/127 (5%)
 Frame = +3

Query  54   ELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLRAV  233
            +LTGK A+VTGASSG+GR  +L LA AG +V  AARRVD L+ LCD I   G      AV
Sbjct  7    DLTGKAALVTGASSGLGRHFALVLALAGAKVAVAARRVDALEELCDTIMEAGG----EAV  62

Query  234  AIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLT  413
            A+ +DV+ D  ++ AAV+ A    G ID LINNAGV     + LDL E  W+ +  TNL 
Sbjct  63   AVPMDVT-DAASVSAAVEDASVGLGGIDILINNAGVT-DTRSVLDLDEAAWDRVMDTNLK  120

Query  414  GTWLVSK  434
            G +LV++
Sbjct  121  GAFLVAR  127



>ref|WP_014188226.1| 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase [Azospirillum lipoferum]
 emb|CBS88772.1| putative 3-oxoacyl-(acyl-carrier-protein) reductase [Azospirillum 
lipoferum 4B]
Length=259

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 83/133 (62%), Gaps = 6/133 (5%)
 Frame = +3

Query  54   ELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLRAV  233
            +LTG+ A+VTGASSG+GR  +  LAKAG RV  AARR D L      I   G GT   A 
Sbjct  6    DLTGRTALVTGASSGLGRHFAGVLAKAGARVALAARRTDALAETKAAIEAAG-GT---AQ  61

Query  234  AIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVRGRVHTPLDLTEEEWNDLTKTNLT  413
             + +DV+ D  ++ AAV +AWD  GRID L+NNAGV       LD++EEEW+ +  TNLT
Sbjct  62   VVAMDVT-DAGSVSAAVAQAWDGHGRIDILVNNAGVTA-TRPFLDMSEEEWDRVIDTNLT  119

Query  414  GTWLVSKYVCLRM  452
            G   V++ V  RM
Sbjct  120  GCARVARAVAQRM  132



>ref|WP_029453556.1| short-chain dehydrogenase [Clostridium algidicarnis]
Length=255

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 87/140 (62%), Gaps = 10/140 (7%)
 Frame = +3

Query  54   ELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLRAV  233
            +LTGKVA++TGASSGIG + +  LA+ G  +   ARR D+L+ LC EI  +G     + +
Sbjct  6    DLTGKVAVITGASSGIGVQFAKALAEQGADIAILARRYDKLEPLCKEIESIGR----KVL  61

Query  234  AIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGVR--GRVHTPLDLTEEEWNDLTKTN  407
            A++ DV+ +   ++ A++   D FG+ID L+NNAGV   G V T   L E EW+ +  TN
Sbjct  62   AVKCDVTKE-EDVKLAIKSIIDKFGKIDILMNNAGVTSVGSVDT---LEETEWDRIIDTN  117

Query  408  LTGTWLVSKYVCLRMCNAKF  467
            L G +L+SK+V   M   K+
Sbjct  118  LKGVFLMSKHVVPHMKEQKY  137



>ref|WP_036097343.1| short-chain dehydrogenase [Listeria floridensis]
 gb|EUJ31660.1| short-chain dehydrogenase/reductase SDR [Listeria floridensis 
FSL S10-1187]
Length=258

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 83/140 (59%), Gaps = 10/140 (7%)
 Frame = +3

Query  54   ELTGKVAMVTGASSGIGREISLDLAKAGCRVIAAARRVDRLKSLCDEINGVGSGTPLRAV  233
            +LTGKVA+VTGASSG+GR+ +L  A  G  V   ARR D+L  L  EI   G     +AV
Sbjct  6    DLTGKVAVVTGASSGLGRDAALSYADYGADVALLARRKDKLDELAKEITAKGR----KAV  61

Query  234  AIELDVSADGPAIEAAVQRAWDAFGRIDALINNAGV--RGRVHTPLDLTEEEWNDLTKTN  407
            AI  DV  D  +++AA +    AF ++D L+NNAGV  RG VH   +L  E+W      N
Sbjct  62   AIACDV-GDEESVKAASEEILKAFSKVDILLNNAGVAFRGAVH---ELPTEDWEKSMDIN  117

Query  408  LTGTWLVSKYVCLRMCNAKF  467
            + G +L+SKY+  +M   K+
Sbjct  118  VKGIYLMSKYIVPQMKEQKY  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000