BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF019K03

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 104   5e-25   
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                 104   6e-25   
gb|AAB17186.1|  plasma membrane H+-ATPase                               107   2e-24   Solanum lycopersicum
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                107   2e-24   
emb|CDP02997.1|  unnamed protein product                                100   5e-24   Coffea canephora [robusta coffee]
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      105   7e-24   Solanum tuberosum [potatoes]
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                 99.4    9e-24   Citrus sinensis [apfelsine]
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                100   9e-24   Sesamum indicum [beniseed]
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like           98.6    1e-23   Elaeis guineensis
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           103   1e-23   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                103   2e-23   
emb|CAN64375.1|  hypothetical protein VITISV_014422                   97.8    2e-23   Vitis vinifera
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4              97.8    2e-23   Vitis vinifera
ref|XP_010094202.1|  Plasma membrane ATPase 4                           101   2e-23   Morus notabilis
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                103   2e-23   Nicotiana sylvestris
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           100   2e-23   Sesamum indicum [beniseed]
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     100   2e-23   Pyrus x bretschneideri [bai li]
ref|XP_011459045.1|  PREDICTED: plasma membrane ATPase 4-like iso...    103   3e-23   Fragaria vesca subsp. vesca
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     100   3e-23   Pyrus x bretschneideri [bai li]
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like iso...    103   3e-23   Fragaria vesca subsp. vesca
gb|KDO67285.1|  hypothetical protein CISIN_1g002203mg                   100   3e-23   Citrus sinensis [apfelsine]
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    100   3e-23   Prunus mume [ume]
ref|XP_010111939.1|  Plasma membrane ATPase 4                         99.8    3e-23   
emb|CAB69823.1|  plasma membrane H+ ATPase                              100   3e-23   Prunus persica
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg           99.8    3e-23   
ref|XP_011045013.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     107   4e-23   Populus euphratica
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4              99.8    4e-23   Nelumbo nucifera [Indian lotus]
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         100   5e-23   Jatropha curcas
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                102   5e-23   Vitis vinifera
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg           99.8    5e-23   Citrus clementina [clementine]
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like           99.8    5e-23   Citrus sinensis [apfelsine]
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                 99.4    5e-23   Citrus sinensis [apfelsine]
dbj|BAO45902.1|  plasma membrane H+-ATPase                            99.8    6e-23   Acacia mangium
gb|KDO67286.1|  hypothetical protein CISIN_1g002203mg                   100   6e-23   Citrus sinensis [apfelsine]
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                101   6e-23   Nicotiana tomentosiformis
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  101   6e-23   Phoenix dactylifera
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     106   6e-23   Populus euphratica
dbj|BAC77531.1|  plasma membrane H+-ATPase                              101   7e-23   Sesbania rostrata
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    101   7e-23   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                 99.0    8e-23   Citrus sinensis [apfelsine]
emb|CBI20766.3|  unnamed protein product                                101   8e-23   Vitis vinifera
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           100   9e-23   Cicer arietinum [garbanzo]
gb|KHG26452.1|  Plasma membrane ATPase 4                                102   1e-22   Gossypium arboreum [tree cotton]
gb|KJB22048.1|  hypothetical protein B456_004G027300                    103   1e-22   Gossypium raimondii
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             102   1e-22   Phaseolus vulgaris [French bean]
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    100   1e-22   Ricinus communis
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg           99.0    1e-22   Citrus clementina [clementine]
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg              96.3    1e-22   Erythranthe guttata [common monkey flower]
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  100   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like           97.1    1e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN22686.1|  Plasma membrane ATPase 4                                103   2e-22   Glycine soja [wild soybean]
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                   99.8    2e-22   Eucalyptus grandis [rose gum]
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           100   2e-22   Phoenix dactylifera
ref|XP_003610080.1|  Plasma membrane H+-ATPase                        98.6    2e-22   Medicago truncatula
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                100   2e-22   Phoenix dactylifera
ref|XP_002324397.1|  H+-ATPase family protein                           103   2e-22   
gb|AFM52333.1|  plasma membrane H+-ATPase                             97.8    2e-22   Malus baccata var. xiaojinensis
ref|XP_003610081.1|  Plasma membrane H+-ATPase                        98.2    2e-22   
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1               99.4    2e-22   
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4              99.4    3e-22   Eucalyptus grandis [rose gum]
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like           98.6    3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           104   3e-22   
emb|CBW30211.1|  Plasma membrane ATPase                               95.9    3e-22   Musa balbisiana [starchy banana]
emb|CBW30173.1|  Plasma membrane ATPase 4                             95.9    3e-22   Musa balbisiana [starchy banana]
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg              99.0    4e-22   Erythranthe guttata [common monkey flower]
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like           97.1    4e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           104   4e-22   
gb|AAB84202.2|  plasma membrane proton ATPase                           100   4e-22   Kosteletzkya pentacarpos [seashore mallow]
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4              97.1    5e-22   Prunus mume [ume]
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                99.0    5e-22   Elaeis guineensis
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like           95.9    6e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB65971.1|  hypothetical protein B456_010G123000                  98.2    6e-22   Gossypium raimondii
gb|KHN17608.1|  Plasma membrane ATPase 4                                101   6e-22   Glycine soja [wild soybean]
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    101   6e-22   Glycine max [soybeans]
dbj|BAA37150.1|  p-type H+-ATPase                                     97.1    6e-22   Vicia faba [broad bean]
dbj|BAD16684.1|  plasma membrane H+-ATPase                              101   6e-22   Daucus carota [carrots]
gb|KJB55190.1|  hypothetical protein B456_009G068100                  99.8    7e-22   Gossypium raimondii
gb|KJB55189.1|  hypothetical protein B456_009G068100                  99.8    7e-22   Gossypium raimondii
dbj|BAD16687.1|  plasma membrane H+-ATPase                              103   7e-22   Daucus carota [carrots]
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg           96.7    7e-22   Prunus persica
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                101   8e-22   Erythranthe guttata [common monkey flower]
gb|KJB66333.1|  hypothetical protein B456_010G136300                  92.8    9e-22   Gossypium raimondii
gb|KHF98166.1|  Plasma membrane ATPase 4                              97.4    9e-22   Gossypium arboreum [tree cotton]
gb|ACE77057.1|  plasma membrane proton pump                           97.4    9e-22   Cucumis sativus [cucumbers]
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4              97.4    9e-22   Cucumis melo [Oriental melon]
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          102   9e-22   Amborella trichopoda
dbj|BAF03589.1|  P-type H+-ATPase                                     98.2    1e-21   Zostera marina
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like         97.1    1e-21   
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...  97.4    1e-21   Glycine max [soybeans]
dbj|BAD16685.1|  plasma membrane H+-ATPase                            99.8    1e-21   Daucus carota [carrots]
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like           97.4    1e-21   Elaeis guineensis
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4              95.5    1e-21   Fragaria vesca subsp. vesca
gb|KHG28536.1|  Plasma membrane ATPase 4                              99.4    1e-21   Gossypium arboreum [tree cotton]
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like         98.2    1e-21   Sesamum indicum [beniseed]
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like         95.5    2e-21   Pyrus x bretschneideri [bai li]
gb|KEH35952.1|  plasma membrane H+-ATPase                               102   2e-21   Medicago truncatula
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like         94.0    2e-21   
gb|AAY42949.1|  plasma membrane H+ ATPase                               101   2e-21   Lupinus albus
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         101   2e-21   Jatropha curcas
ref|XP_003594954.1|  Plasma membrane ATPase                           96.3    2e-21   Medicago truncatula
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like         95.9    2e-21   Glycine max [soybeans]
gb|KHG19606.1|  ATPase 5, plasma membrane-type -like protein          96.7    2e-21   Gossypium arboreum [tree cotton]
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like         94.7    3e-21   Malus domestica [apple tree]
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g           95.9    3e-21   Phaseolus vulgaris [French bean]
gb|KHN15309.1|  Plasma membrane ATPase 4                              95.9    3e-21   Glycine soja [wild soybean]
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like           98.2    3e-21   Elaeis guineensis
emb|CAA59799.1|  H(+)-transporting ATPase                               100   4e-21   Phaseolus vulgaris [French bean]
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             100   4e-21   Phaseolus vulgaris [French bean]
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like         99.8    4e-21   Cicer arietinum [garbanzo]
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like           92.0    5e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                100   5e-21   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAD16688.1|  plasma membrane H+-ATPase                            98.6    5e-21   Daucus carota [carrots]
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...  97.8    6e-21   
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4              91.7    6e-21   Eucalyptus grandis [rose gum]
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          100   6e-21   Medicago truncatula
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like         97.4    7e-21   Cucumis melo [Oriental melon]
ref|XP_002515334.1|  H(\+)-transporting atpase plant/fungi plasma...  99.8    7e-21   
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like         99.8    7e-21   Cicer arietinum [garbanzo]
emb|CAC29436.1|  P-type H+-ATPase                                     99.4    8e-21   Vicia faba [broad bean]
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like         99.0    8e-21   Populus euphratica
ref|XP_006382164.1|  H+-ATPase family protein                         98.6    9e-21   
gb|KEH39758.1|  plasma membrane H+-ATPase                             98.6    9e-21   Medicago truncatula
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like         94.4    1e-20   
gb|AFW04239.1|  plasma membrane H+-ATPase                             99.0    1e-20   Sesuvium portulacastrum [sea-purslane]
gb|KJB82762.1|  hypothetical protein B456_013G212200                  95.1    1e-20   Gossypium raimondii
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                    100   1e-20   Arabis alpina [alpine rockcress]
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like           95.1    2e-20   Phoenix dactylifera
gb|KJB82763.1|  hypothetical protein B456_013G212200                  95.1    2e-20   Gossypium raimondii
gb|AAY42950.1|  plasma membrane H+ ATPase                             94.7    2e-20   Lupinus albus
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                92.4    2e-20   Nelumbo nucifera [Indian lotus]
gb|AAB41898.1|  H+-transporting ATPase                                99.8    2e-20   Mesembryanthemum crystallinum
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...  98.6    2e-20   Glycine max [soybeans]
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g           98.2    2e-20   Phaseolus vulgaris [French bean]
gb|KJB54894.1|  hypothetical protein B456_009G053500                  95.1    2e-20   Gossypium raimondii
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg           98.2    2e-20   Capsella rubella
ref|NP_001190870.1|  H(+)-ATPase 2                                    97.8    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like         95.5    3e-20   Elaeis guineensis
gb|KGN62872.1|  hypothetical protein Csa_2G378540                     94.7    3e-20   Cucumis sativus [cucumbers]
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1   92.8    3e-20   Eucalyptus grandis [rose gum]
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like   97.8    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type        97.4    3e-20   Camelina sativa [gold-of-pleasure]
ref|NP_194748.1|  H(+)-ATPase 2                                       97.4    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002527322.1|  H(\+)-transporting atpase plant/fungi plasma...  92.4    3e-20   
gb|EPS65442.1|  hypothetical protein M569_09334                       93.6    4e-20   Genlisea aurea
gb|KEH39757.1|  plasma membrane H+-ATPase                             98.6    4e-20   Medicago truncatula
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg           97.4    4e-20   Eutrema salsugineum [saltwater cress]
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein         94.7    4e-20   
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...  97.1    4e-20   Glycine max [soybeans]
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2   92.4    4e-20   Eucalyptus grandis [rose gum]
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...  94.7    4e-20   Populus euphratica
dbj|BAJ34124.1|  unnamed protein product                              97.1    4e-20   Eutrema halophilum
pdb|3B8C|A  Chain A, Crystal Structure Of A Plasma Membrane Proto...  97.1    4e-20   
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...  94.7    5e-20   Phoenix dactylifera
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...  94.7    5e-20   Phoenix dactylifera
dbj|BAC77530.1|  plasma membrane H+-ATPase                            96.7    5e-20   Sesbania rostrata
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type        97.1    5e-20   Tarenaya hassleriana [spider flower]
ref|XP_006401213.1|  hypothetical protein EUTSA_v10015530mg           95.9    7e-20   
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like   96.3    8e-20   Camelina sativa [gold-of-pleasure]
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...  97.8    8e-20   Populus euphratica
gb|KEH39753.1|  plasma membrane H+-ATPase                             97.4    8e-20   Medicago truncatula
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like   96.3    9e-20   Tarenaya hassleriana [spider flower]
ref|XP_010414912.1|  PREDICTED: ATPase 1, plasma membrane-type-li...  96.7    9e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type        96.7    9e-20   
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg           96.7    9e-20   Capsella rubella
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg           96.3    9e-20   Eutrema salsugineum [saltwater cress]
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like   96.7    9e-20   
emb|CDY64741.1|  BnaCnng44750D                                        96.3    9e-20   Brassica napus [oilseed rape]
dbj|BAJ33915.1|  unnamed protein product                              96.3    1e-19   Eutrema halophilum
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...  96.7    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like         90.1    1e-19   
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type        96.3    1e-19   Brassica rapa
gb|AAY42948.1|  plasma membrane H+ ATPase                             95.5    1e-19   Lupinus albus
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...  97.4    1e-19   Tarenaya hassleriana [spider flower]
gb|EPS73574.1|  hypothetical protein M569_01174                       91.7    1e-19   Genlisea aurea
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                   97.1    1e-19   Morus notabilis
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like           91.3    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like   95.9    1e-19   Sesamum indicum [beniseed]
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like         95.1    1e-19   Cicer arietinum [garbanzo]
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like           93.6    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                 92.0    1e-19   Vicia faba [broad bean]
gb|KDP42000.1|  hypothetical protein JCGZ_27018                       92.0    1e-19   Jatropha curcas
gb|AEQ27822.1|  PM H+-ATPase R                                        95.9    1e-19   Eichhornia crassipes
gb|KHN16462.1|  Plasma membrane ATPase 4                              97.1    1e-19   Glycine soja [wild soybean]
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1    97.1    1e-19   Glycine max [soybeans]
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...  97.1    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_009386906.1|  PREDICTED: ATPase 3, plasma membrane-type-like   92.0    1e-19   
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like         97.1    2e-19   
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like         92.8    2e-19   Elaeis guineensis
gb|KHM99449.1|  ATPase 5, plasma membrane-type                        96.7    2e-19   Glycine soja [wild soybean]
ref|XP_007012006.1|  H(+)-ATPase 8                                    92.0    2e-19   
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380        93.2    2e-19   Amborella trichopoda
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...  96.3    2e-19   Glycine max [soybeans]
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like           96.3    3e-19   Oryza brachyantha
gb|KFK29576.1|  h(+)-atpase 2                                         94.4    3e-19   Arabis alpina [alpine rockcress]
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...  95.9    3e-19   Cicer arietinum [garbanzo]
gb|ABR18001.1|  unknown                                               95.9    3e-19   Picea sitchensis
emb|CDX82608.1|  BnaC07g02580D                                        94.7    3e-19   
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like   94.0    3e-19   Sesamum indicum [beniseed]
ref|XP_004508384.1|  PREDICTED: ATPase 8, plasma membrane-type-li...  95.9    4e-19   
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type        94.0    4e-19   Sesamum indicum [beniseed]
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like           94.4    4e-19   Vitis vinifera
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg              95.9    4e-19   Erythranthe guttata [common monkey flower]
gb|AAK31799.2|  plasma membrane H+ ATPase                             90.5    4e-19   Lilium longiflorum [Easter lily]
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type        94.4    4e-19   Brassica rapa
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type        94.0    4e-19   Brassica rapa
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like           90.5    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY67153.1|  BnaAnng23670D                                        94.0    4e-19   Brassica napus [oilseed rape]
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type        93.6    4e-19   Brassica rapa
gb|KEH32174.1|  plasma membrane H+-ATPase                             95.5    4e-19   Medicago truncatula
gb|AHK23067.1|  plasma membrane ATPase 4                              93.6    5e-19   Fagopyrum tataricum [Kangra buckwheat]
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like   94.4    5e-19   Tarenaya hassleriana [spider flower]
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like   95.5    5e-19   Tarenaya hassleriana [spider flower]
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like   94.0    5e-19   Sesamum indicum [beniseed]
ref|NP_200545.1|  H(+)-ATPase 3                                       95.5    5e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAL09726.1|  AT5g57350/MJB24_16                                    95.5    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like   95.5    5e-19   
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type        95.1    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type        95.1    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_002523524.1|  H(\+)-transporting atpase plant/fungi plasma...  91.3    6e-19   
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type        95.1    6e-19   Tarenaya hassleriana [spider flower]
gb|KGN52915.1|  hypothetical protein Csa_4G006220                     94.7    6e-19   Cucumis sativus [cucumbers]
ref|XP_007023381.1|  H(+)-ATPase 9                                    95.1    6e-19   
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...  95.1    6e-19   
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                 93.6    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179486.1|  H(+)-ATPase 1                                       93.6    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg           95.1    6e-19   Eutrema salsugineum [saltwater cress]
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type        94.7    6e-19   Cucumis melo [Oriental melon]
emb|CDX93092.1|  BnaA03g38140D                                        95.1    7e-19   
emb|CDY50939.1|  BnaC03g74390D                                        95.1    7e-19   Brassica napus [oilseed rape]
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                  95.1    7e-19   Arabis alpina [alpine rockcress]
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                  93.6    7e-19   Arabis alpina [alpine rockcress]
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like   94.7    7e-19   Cucumis sativus [cucumbers]
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...  94.7    7e-19   
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type        92.8    8e-19   Cucumis melo [Oriental melon]
emb|CDP14278.1|  unnamed protein product                              95.1    8e-19   Coffea canephora [robusta coffee]
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                      89.0    1e-18   Lilium longiflorum [Easter lily]
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg           94.4    1e-18   Capsella rubella
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4              94.4    1e-18   
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type        94.4    1e-18   
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like   94.0    1e-18   Cucumis melo [Oriental melon]
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like           94.0    1e-18   Setaria italica
ref|XP_004139271.1|  PREDICTED: ATPase 8, plasma membrane-type-like   94.0    1e-18   
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                  94.0    2e-18   Arabis alpina [alpine rockcress]
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...  88.6    2e-18   
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...  88.6    2e-18   Eucalyptus grandis [rose gum]
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like         90.5    2e-18   
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...  90.5    2e-18   
gb|ABW25091.1|  plasma membrane proton pump                           90.1    2e-18   Cucumis sativus [cucumbers]
gb|KDP38637.1|  hypothetical protein JCGZ_03990                       88.6    2e-18   Jatropha curcas
gb|KGN60742.1|  hypothetical protein Csa_2G009310                     93.2    2e-18   Cucumis sativus [cucumbers]
gb|KCW89137.1|  hypothetical protein EUGRSUZ_A01453                   93.6    2e-18   Eucalyptus grandis [rose gum]
emb|CDY47940.1|  BnaA02g08160D                                        92.8    2e-18   Brassica napus [oilseed rape]
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type        92.4    2e-18   Brassica rapa
emb|CDY38294.1|  BnaA10g11420D                                        92.4    2e-18   Brassica napus [oilseed rape]
emb|CDY62140.1|  BnaCnng39300D                                        93.2    2e-18   Brassica napus [oilseed rape]
emb|CDY25913.1|  BnaC09g32850D                                        92.4    2e-18   Brassica napus [oilseed rape]
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type        92.8    3e-18   Prunus mume [ume]
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like   89.0    3e-18   Populus euphratica
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like           93.2    3e-18   Cicer arietinum [garbanzo]
ref|XP_009150710.1|  PREDICTED: ATPase 1, plasma membrane-type-like   92.8    3e-18   Brassica rapa
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg           93.2    3e-18   Eutrema salsugineum [saltwater cress]
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type        93.2    3e-18   Nicotiana sylvestris
gb|KFK27283.1|  h(+)-atpase 3                                         93.2    3e-18   Arabis alpina [alpine rockcress]
gb|AAR32129.2|  proton P-ATPase                                       93.2    3e-18   Nicotiana tabacum [American tobacco]
ref|XP_011468858.1|  PREDICTED: ATPase 8, plasma membrane-type-li...  91.3    3e-18   Fragaria vesca subsp. vesca
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like   93.2    3e-18   Sesamum indicum [beniseed]
ref|XP_004287218.1|  PREDICTED: ATPase 8, plasma membrane-type-li...  91.3    3e-18   Fragaria vesca subsp. vesca
emb|CDY14186.1|  BnaA08g13170D                                        92.8    3e-18   Brassica napus [oilseed rape]
ref|NP_189850.1|  H(+)-ATPase 8                                       92.8    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178762.1|  H(+)-ATPase 6                                       92.8    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like   92.8    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type        92.8    4e-18   Camelina sativa [gold-of-pleasure]
gb|KGN65469.1|  hypothetical protein Csa_1G423270                     89.4    4e-18   Cucumis sativus [cucumbers]
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg           92.8    4e-18   Capsella rubella
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1     92.8    4e-18   
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like   90.5    4e-18   Cucumis sativus [cucumbers]
ref|XP_010468541.1|  PREDICTED: ATPase 6, plasma membrane-type-like   92.4    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4              90.5    4e-18   Elaeis guineensis
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg              90.9    4e-18   Erythranthe guttata [common monkey flower]
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2     92.8    4e-18   
ref|XP_002324564.1|  ATPase 6 family protein                          88.2    4e-18   
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein   92.8    4e-18   
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836           92.4    4e-18   
gb|AEO22063.1|  plasma membrane H+-ATPase                             92.4    4e-18   
dbj|BAL41366.1|  plasma membrane H+-ATPase                            92.4    5e-18   
gb|KGN65225.1|  hypothetical protein Csa_1G267210                     90.1    5e-18   
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg           92.4    5e-18   
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like         90.5    6e-18   
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like   90.1    6e-18   
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type        92.4    6e-18   
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type        90.5    6e-18   
gb|KHN18251.1|  ATPase 8, plasma membrane-type                        92.0    6e-18   
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...  92.0    6e-18   
ref|NP_001185450.1|  H(+)-ATPase 9                                    92.0    7e-18   
ref|XP_006597964.1|  PREDICTED: ATPase 8, plasma membrane-type-like   92.0    7e-18   
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg           92.0    7e-18   
gb|KHN22097.1|  ATPase 8, plasma membrane-type                        92.0    7e-18   
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...  92.0    7e-18   
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type        92.0    7e-18   
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type        92.0    8e-18   
ref|NP_178181.1|  H(+)-ATPase 9                                       92.0    8e-18   
gb|KHN18583.1|  ATPase 8, plasma membrane-type                        92.0    8e-18   
gb|KJB70727.1|  hypothetical protein B456_011G089100                  86.3    8e-18   
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...  91.7    8e-18   
ref|NP_001105470.1|  plasma-membrane H+ATPase2                        91.7    9e-18   
emb|CBI35956.3|  unnamed protein product                              89.7    9e-18   
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240        91.7    9e-18   
ref|XP_007138427.1|  hypothetical protein PHAVU_009G208000g           91.7    9e-18   
gb|EPS57651.1|  hypothetical protein M569_17165                       90.5    1e-17   
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4              89.0    1e-17   
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                91.7    1e-17   
gb|ACL54575.1|  unknown                                               91.7    1e-17   
gb|KJB56561.1|  hypothetical protein B456_009G125200                  90.5    1e-17   
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...  88.6    1e-17   
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type        91.7    1e-17   
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...  88.6    1e-17   
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                91.3    1e-17   
emb|CDX72218.1|  BnaC07g42400D                                        89.0    1e-17   
gb|ABA18090.1|  putative plasma membrane ATPase                       91.3    1e-17   
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg           91.3    1e-17   
ref|XP_008677658.1|  PREDICTED: uncharacterized protein LOC100383...  88.6    1e-17   
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...  90.1    1e-17   
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like   89.4    1e-17   
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like   91.3    1e-17   
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like   90.1    1e-17   
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...  90.1    1e-17   
gb|EPS63245.1|  hypothetical protein M569_11541                       91.3    1e-17   
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type        91.3    1e-17   
emb|CDX72217.1|  BnaC07g42390D                                        89.4    1e-17   
emb|CDY51650.1|  BnaAnng10900D                                        89.4    1e-17   
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                  91.3    1e-17   
gb|ABA18112.1|  putative plasma membrane ATPase                       91.3    1e-17   
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063           91.3    1e-17   
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg           88.2    2e-17   
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type        89.7    2e-17   
ref|XP_010430916.1|  PREDICTED: ATPase 8, plasma membrane-type-like   87.8    2e-17   
dbj|BAA08134.1|  putative plasma membrane H+-ATPase                   90.1    2e-17   
gb|AAV71150.1|  plasma membrane H+-ATPase                             90.5    2e-17   
gb|EMT26270.1|  Plasma membrane ATPase                                90.5    2e-17   
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...  90.5    2e-17   
ref|XP_002452983.1|  hypothetical protein SORBIDRAFT_04g036040        87.4    2e-17   
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like   90.5    2e-17   
gb|EMS60594.1|  Plasma membrane ATPase                                90.5    2e-17   
dbj|BAD19091.1|  putative H+-exporting ATPase                         87.8    2e-17   
ref|XP_010472893.1|  PREDICTED: ATPase 9, plasma membrane-type is...  90.5    2e-17   
ref|XP_010496530.1|  PREDICTED: ATPase 8, plasma membrane-type-like   88.2    2e-17   
emb|CAD29312.1|  plasma membrane H+-ATPase                            87.4    3e-17   
gb|KEH37844.1|  plasma membrane H+-ATPase                             90.1    3e-17   
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g           90.1    3e-17   
gb|KEH19962.1|  plasma membrane H+-ATPase                             90.1    3e-17   
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg           90.1    3e-17   
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...  90.1    3e-17   
ref|XP_004136313.1|  PREDICTED: plasma membrane ATPase 4-like         90.1    3e-17   
ref|XP_010472895.1|  PREDICTED: ATPase 9, plasma membrane-type is...  90.1    3e-17   
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type        90.1    3e-17   
ref|XP_004168485.1|  PREDICTED: plasma membrane ATPase 4-like         90.1    3e-17   
ref|XP_010539792.1|  PREDICTED: ATPase 3, plasma membrane-type-like   90.1    3e-17   
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like   90.1    3e-17   
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like   86.3    3e-17   
ref|XP_002309321.1|  ATPase 6 family protein                          85.1    3e-17   
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type        87.0    4e-17   
emb|CDY56511.1|  BnaCnng30540D                                        89.0    4e-17   
ref|NP_001054118.1|  Os04g0656100                                     89.7    4e-17   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                        89.7    4e-17   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like   89.7    4e-17   
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type        84.7    5e-17   
gb|KGN60167.1|  hypothetical protein Csa_3G881800                     89.0    5e-17   
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like   89.4    5e-17   
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type        87.8    5e-17   
emb|CAN78639.1|  hypothetical protein VITISV_031738                   87.0    5e-17   
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...  89.4    5e-17   
emb|CAD29313.1|  plasma membrane H+-ATPase                            89.4    5e-17   
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...  89.4    6e-17   
ref|XP_011078615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...  89.4    6e-17   
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like   86.3    6e-17   
ref|XP_003564205.1|  PREDICTED: ATPase 6, plasma membrane-type-li...  87.4    7e-17   
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                  89.0    7e-17   
ref|XP_010429431.1|  PREDICTED: ATPase 5, plasma membrane-type-li...  88.6    7e-17   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                 89.0    8e-17   
emb|CDY51651.1|  BnaAnng10910D                                        89.0    8e-17   
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...  89.0    8e-17   
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2     84.0    8e-17   
ref|XP_002307856.1|  ATPase 6 family protein                          89.0    8e-17   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg           89.0    8e-17   
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...  89.0    8e-17   
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type        89.0    9e-17   
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1     84.0    9e-17   
ref|XP_010227956.1|  PREDICTED: ATPase 6, plasma membrane-type-li...  87.0    9e-17   
ref|XP_011034499.1|  PREDICTED: plasma membrane ATPase 4-like         88.6    9e-17   
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type        88.6    9e-17   
ref|XP_010417679.1|  PREDICTED: ATPase 9, plasma membrane-type-li...  88.6    9e-17   
gb|AAV49159.1|  plasma membrane proton ATPase 5                       88.6    1e-16   
ref|XP_009775735.1|  PREDICTED: ATPase 9, plasma membrane-type-like   88.6    1e-16   
ref|XP_009610942.1|  PREDICTED: ATPase 9, plasma membrane-type-like   88.6    1e-16   
emb|CDX76809.1|  BnaC08g33950D                                        83.6    1e-16   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like   88.6    1e-16   
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type        88.6    1e-16   
dbj|BAM20989.1|  plasma membrane H+-ATPase                            88.6    1e-16   
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3     83.6    1e-16   
ref|XP_008658955.1|  PREDICTED: uncharacterized protein LOC100501...  88.6    1e-16   
ref|XP_009117122.1|  PREDICTED: ATPase 5, plasma membrane-type        88.6    1e-16   
emb|CDY34767.1|  BnaA09g41340D                                        88.6    1e-16   
ref|XP_002437958.1|  hypothetical protein SORBIDRAFT_10g005500        88.6    1e-16   
ref|XP_002991931.1|  hypothetical protein SELMODRAFT_430150           88.6    1e-16   
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4     83.6    1e-16   
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like   85.1    1e-16   
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like         88.6    1e-16   
ref|XP_002979990.1|  hypothetical protein SELMODRAFT_419690           88.6    1e-16   
ref|XP_010914191.1|  PREDICTED: plasma membrane ATPase-like           88.2    1e-16   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like   88.2    2e-16   
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like   88.2    2e-16   
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like   85.9    2e-16   
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g           87.8    2e-16   
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like   84.7    2e-16   
gb|EAZ06139.1|  hypothetical protein OsI_28373                        85.9    2e-16   
ref|XP_002297804.2|  H+-ATPase family protein                         87.8    2e-16   
ref|XP_004159431.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 8, pl...  87.8    2e-16   
ref|NP_001048395.2|  Os02g0797300                                     87.8    2e-16   
dbj|BAD33363.1|  putative plasma membrane H+-ATPase                   85.9    2e-16   
emb|CDX67957.1|  BnaA07g19970D                                        87.4    2e-16   
emb|CAD29311.1|  plasma membrane H+-ATPase                            85.9    2e-16   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like   87.4    2e-16   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like   87.4    2e-16   
gb|KHN31888.1|  ATPase 9, plasma membrane-type                        85.1    3e-16   
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like   87.4    3e-16   
ref|XP_010431653.1|  PREDICTED: ATPase 9, plasma membrane-type-like   86.7    3e-16   
gb|EMT09250.1|  ATPase 8, plasma membrane-type                        82.8    3e-16   
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg           82.0    3e-16   
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like         87.0    4e-16   
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like   82.0    4e-16   
emb|CDY67606.1|  BnaAnng24780D                                        85.9    4e-16   
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...  87.0    4e-16   
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...  85.9    4e-16   
ref|XP_003573592.1|  PREDICTED: ATPase 2, plasma membrane-type-like   85.9    5e-16   
emb|CDY69631.1|  BnaCnng64550D                                        85.9    5e-16   
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g           86.7    5e-16   
gb|EYU19268.1|  hypothetical protein MIMGU_mgv1a024366mg              84.3    5e-16   
gb|EMS45119.1|  Plasma membrane ATPase 1                              86.7    5e-16   
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like   85.9    6e-16   
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...  85.9    6e-16   
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1              86.3    7e-16   
gb|KEH39623.1|  plasma membrane H+-ATPase                             86.3    7e-16   
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...  85.9    7e-16   
ref|XP_010313836.1|  PREDICTED: ATPase 9, plasma membrane-type-li...  85.9    7e-16   
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...  85.9    8e-16   
ref|XP_006350073.1|  PREDICTED: ATPase 8, plasma membrane-type-like   85.9    8e-16   
ref|XP_004251768.1|  PREDICTED: ATPase 9, plasma membrane-type-li...  85.9    8e-16   
gb|EEC69747.1|  hypothetical protein OsI_39279                        85.9    8e-16   
gb|EAZ21357.1|  hypothetical protein OsJ_37014                        85.9    8e-16   
tpg|DAA54787.1|  TPA: hypothetical protein ZEAMMB73_074525            85.5    9e-16   
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like         85.9    9e-16   
ref|NP_001067382.1|  Os12g0638700                                     85.9    9e-16   
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like         84.7    1e-15   
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like           85.5    1e-15   
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like           85.5    1e-15   
ref|XP_002304716.2|  H+-ATPase family protein                         85.5    1e-15   
ref|XP_003561110.1|  PREDICTED: plasma membrane ATPase 1-like         85.5    1e-15   
gb|EEC75974.1|  hypothetical protein OsI_13084                        85.5    1e-15   
dbj|BAK05828.1|  predicted protein                                    80.9    1e-15   
dbj|BAA01058.1|  H-ATPase                                             85.5    1e-15   
ref|XP_002444096.1|  hypothetical protein SORBIDRAFT_07g007610        85.5    1e-15   
ref|NP_001050947.1|  Os03g0689300                                     85.5    1e-15   
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1     85.5    1e-15   
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...  85.1    1e-15   
ref|XP_008644894.1|  PREDICTED: uncharacterized protein LOC100383...  85.1    1e-15   
gb|EMT26085.1|  Plasma membrane ATPase 1                              85.1    2e-15   
gb|KJB19306.1|  hypothetical protein B456_003G094300                  82.0    2e-15   
ref|XP_010691624.1|  PREDICTED: ATPase 9, plasma membrane-type is...  85.1    2e-15   
gb|KJB82864.1|  hypothetical protein B456_013G217900                  79.7    2e-15   
ref|NP_001182902.1|  uncharacterized protein LOC100501185             84.0    2e-15   
gb|KJB19305.1|  hypothetical protein B456_003G094300                  82.0    2e-15   
gb|KJB19302.1|  hypothetical protein B456_003G094300                  82.0    2e-15   
ref|XP_006651704.1|  PREDICTED: plasma membrane ATPase 1-like         84.7    2e-15   
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like         84.7    2e-15   
gb|KJB19307.1|  hypothetical protein B456_003G094300                  82.0    2e-15   
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070        84.3    2e-15   
gb|KJB19303.1|  hypothetical protein B456_003G094300                  81.6    2e-15   
dbj|BAK04567.1|  predicted protein                                    84.3    3e-15   
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like         80.9    3e-15   
dbj|BAJ92653.1|  predicted protein                                    84.3    3e-15   
dbj|BAM20990.1|  plasma membrane H+-ATPase                            84.3    3e-15   
ref|XP_010228253.1|  PREDICTED: plasma membrane ATPase 3-like iso...  84.3    3e-15   
gb|EMT29166.1|  ATPase 8, plasma membrane-type                        84.0    4e-15   
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...  82.4    4e-15   
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like         82.0    4e-15   
ref|XP_010228254.1|  PREDICTED: plasma membrane ATPase 3-like iso...  84.0    4e-15   
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like         84.0    4e-15   
gb|KHG12451.1|  ATPase 4, plasma membrane-type -like protein          80.9    5e-15   
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like         83.6    5e-15   
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like         83.6    5e-15   
dbj|BAM20991.1|  plasma membrane H+-ATPase                            83.6    5e-15   
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like  82.0    6e-15   
ref|XP_003578172.1|  PREDICTED: plasma membrane ATPase 1              83.2    6e-15   
dbj|BAC77532.1|  plasma membrane H+-ATPase                            82.8    6e-15   
ref|XP_010053511.1|  PREDICTED: ATPase 11, plasma membrane-type-like  83.2    7e-15   
ref|XP_004516704.1|  PREDICTED: interactor of constitutive active...  80.1    7e-15   
gb|EMS59303.1|  Plasma membrane ATPase                                82.8    7e-15   
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like  80.5    8e-15   
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg           80.5    8e-15   
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g           78.6    9e-15   



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   104 bits (260),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            E+AAIMAIALANGD
Sbjct  79   ESAAIMAIALANGD  92


 Score = 36.6 bits (83),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK I+LE+IKNETVDLEK
Sbjct  3    GDKGISLEEIKNETVDLEK  21



>ref|XP_007014222.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY31841.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=930

 Score =   104 bits (259),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            E+AAIMAIALANGD
Sbjct  79   ESAAIMAIALANGD  92


 Score = 36.6 bits (83),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK I+LE+IKNETVDLEK
Sbjct  3    GDKGISLEEIKNETVDLEK  21



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   107 bits (266),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 71/74 (96%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  17   LEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            E AAIMAIALANGD
Sbjct  77   EMAAIMAIALANGD  90


 Score = 32.0 bits (71),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            K+I+LE+IKNETVDLEK
Sbjct  3    KAISLEEIKNETVDLEK  19



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   107 bits (266),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 71/74 (96%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  17   LEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            E AAIMAIALANGD
Sbjct  77   EMAAIMAIALANGD  90


 Score = 32.0 bits (71),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            K+I+LE+IKNETVDLEK
Sbjct  3    KAISLEEIKNETVDLEK  19



>emb|CDP02997.1| unnamed protein product [Coffea canephora]
Length=954

 Score =   100 bits (249),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 68/73 (93%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  79   EAAAIMAIALANG  91


 Score = 37.0 bits (84),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 16/19 (84%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNETVDLEK
Sbjct  3    GDKAISLEEIKNETVDLEK  21



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   105 bits (261),  Expect(2) = 7e-24, Method: Composition-based stats.
 Identities = 71/74 (96%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  17   LEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANG+
Sbjct  77   EAAAIMAIALANGN  90


 Score = 32.0 bits (71),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            K+I+LE+IKNETVDLEK
Sbjct  3    KAISLEEIKNETVDLEK  19



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score = 99.4 bits (246),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGL+S EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  18   LERIPIEEVFEQLKCTREGLSSTEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  77

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANG+
Sbjct  78   EAAAVMAIALANGE  91


 Score = 37.7 bits (86),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +2

Query  293  MGDKSITLEQIKNETVDLEK  352
            MGDK+I+LE+IKNETVDLE+
Sbjct  1    MGDKAISLEEIKNETVDLER  20



>ref|XP_011069930.1| PREDICTED: plasma membrane ATPase 4 [Sesamum indicum]
Length=951

 Score =   100 bits (248),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 66/73 (90%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L K+PIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAA+MAIALANG
Sbjct  79   EAAAVMAIALANG  91


 Score = 37.0 bits (84),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNETVDLEK
Sbjct  3    GDKAISLEEIKNETVDLEK  21



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score = 98.6 bits (244),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L ++PIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  18   LERVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  77

Query  523  EaaaimaialaNG  561
            E AAIMAIALANG
Sbjct  78   EMAAIMAIALANG  90


 Score = 38.1 bits (87),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
 Frame = +2

Query  293  MGDKSITLEQIKNETVDLEK  352
            MGDK I+LE+IKNETVDLE+
Sbjct  1    MGDKGISLEEIKNETVDLER  20



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =   103 bits (258),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGLT+DEGANRLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTREGLTADEGANRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIVLANGD  92


 Score = 32.3 bits (72),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 13/18 (72%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            DK+I+LE+IKNE+VDLE+
Sbjct  4    DKAISLEEIKNESVDLER  21



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =   103 bits (257),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGLT+DEGANRLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTREGLTADEGANRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIVLANGD  92


 Score = 32.3 bits (72),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 13/18 (72%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            DK+I+LE+IKNE+VDLE+
Sbjct  4    DKAISLEEIKNESVDLER  21



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score = 97.8 bits (242),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC++EGLTS EG  RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIVLANGD  92


 Score = 37.7 bits (86),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDKSI+LE+IKNETVDLEK
Sbjct  3    GDKSISLEEIKNETVDLEK  21



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score = 97.8 bits (242),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC++EGLTS EG  RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIVLANGD  92


 Score = 37.7 bits (86),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDKSI+LE+IKNETVDLEK
Sbjct  3    GDKSISLEEIKNETVDLEK  21



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   101 bits (252),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGLTS+EGA+RLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTREGLTSEEGASRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIVLANGD  92


 Score = 33.9 bits (76),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 20/21 (95%), Gaps = 1/21 (5%)
 Frame = +2

Query  293  MG-DKSITLEQIKNETVDLEK  352
            MG DK+I+LE+IKNETVDLE+
Sbjct  1    MGEDKAISLEEIKNETVDLER  21



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =   103 bits (256),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEK ESK+LKFLGFMWNPLSWVM
Sbjct  17   LEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKNESKILKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANGD
Sbjct  77   EAAAVMAIALANGD  90


 Score = 32.3 bits (72),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            K+I+LE+IKNETVDLEK
Sbjct  3    KAISLEEIKNETVDLEK  19



>ref|XP_011079289.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=953

 Score =   100 bits (248),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L K+PIEEVFEQLKC+REGL+S+EGANR+QIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  18   LEKVPIEEVFEQLKCTREGLSSEEGANRIQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  77

Query  523  EaaaimaialaNG  561
            EAAA+MAI LANG
Sbjct  78   EAAALMAIVLANG  90


 Score = 35.4 bits (80),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +2

Query  293  MGDKSITLEQIKNETVDLEK  352
            MG  +I+LEQIKNETVDLEK
Sbjct  1    MGGDAISLEQIKNETVDLEK  20



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =   100 bits (250),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+REGLT +EGANRLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIVLANGD  92


 Score = 34.7 bits (78),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE+VDLE+
Sbjct  3    GDKAISLEEIKNESVDLER  21



>ref|XP_011459045.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=983

 Score =   103 bits (256),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGLTSDEG NRLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  20   LERIPIEEVFEQLKCTREGLTSDEGQNRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  80   EAAALMAIVLANGD  93


 Score = 32.0 bits (71),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G K+I+LE+IKNE+VDLE+
Sbjct  4    GTKAISLEEIKNESVDLER  22



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   100 bits (249),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+REGLT +EGANRLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIVLANGD  92


 Score = 34.7 bits (78),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE+VDLE+
Sbjct  3    GDKAISLEEIKNESVDLER  21



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=955

 Score =   103 bits (256),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGLTSDEG NRLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  20   LERIPIEEVFEQLKCTREGLTSDEGQNRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  80   EAAALMAIVLANGD  93


 Score = 32.0 bits (71),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G K+I+LE+IKNE+VDLE+
Sbjct  4    GTKAISLEEIKNESVDLER  22



>gb|KDO67285.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=847

 Score =   100 bits (248),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 67/73 (92%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESKVLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  79   EAAAIMAIALANG  91


 Score = 35.0 bits (79),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE+VDLE+
Sbjct  3    GDKAISLEEIKNESVDLER  21



>ref|XP_008219933.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Prunus 
mume]
Length=935

 Score =   100 bits (249),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 56/61 (92%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGLT DEGANRLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTREGLTGDEGANRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 34.7 bits (78),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE+VDLE+
Sbjct  3    GDKAISLEEIKNESVDLER  21



>ref|XP_010111939.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXC32057.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=928

 Score = 99.8 bits (247),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+R+GLTS+EGANRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LERIPMEEVFEQLKCTRQGLTSEEGANRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANGD
Sbjct  79   EAAALMAIALANGD  92


 Score = 35.0 bits (79),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 15/19 (79%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK ITLE+IKNE+VDLE+
Sbjct  3    GDKGITLEEIKNESVDLER  21



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   100 bits (248),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 67/73 (92%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGLT DEGANRLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTREGLTGDEGANRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAA+MAIALANG
Sbjct  79   EAAAVMAIALANG  91


 Score = 35.0 bits (79),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE+VDLE+
Sbjct  3    GDKAISLEEIKNESVDLER  21



>ref|XP_007225350.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
 gb|EMJ26549.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
Length=943

 Score = 99.8 bits (247),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 67/73 (92%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGLT DEGANRLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTREGLTGDEGANRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAA+MAIALANG
Sbjct  79   EAAAVMAIALANG  91


 Score = 35.0 bits (79),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE+VDLE+
Sbjct  3    GDKAISLEEIKNESVDLER  21



>ref|XP_011045013.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Populus euphratica]
Length=822

 Score =   107 bits (266),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGLTSDEGANRLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCSREGLTSDEGANRLQVFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIVLANGD  92


 Score = 27.7 bits (60),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             I+LE+IKNE+VDLE+
Sbjct  6    GISLEEIKNESVDLER  21



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score = 99.8 bits (247),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 56/61 (92%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 35.0 bits (79),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE+VDLE+
Sbjct  3    GDKAISLEEIKNESVDLER  21



>gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =   100 bits (249),  Expect(2) = 5e-23, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPI+EVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  17   LERIPIDEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  77   EAAAIMAIALANGD  90


 Score = 33.9 bits (76),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            KSITLE+IKNETVDLE+
Sbjct  3    KSITLEEIKNETVDLER  19



>ref|XP_002282619.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
Length=954

 Score =   102 bits (253),  Expect(2) = 5e-23, Method: Composition-based stats.
 Identities = 57/61 (93%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGLTSDEGA+RLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCSREGLTSDEGASRLQIFGPNKLEEKKESKVLKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 32.3 bits (72),  Expect(2) = 5e-23, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
             DKSI LE+IKNE+VDLE+
Sbjct  3    ADKSIGLEEIKNESVDLER  21



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score = 99.8 bits (247),  Expect(2) = 5e-23, Method: Composition-based stats.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESKVLKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 34.7 bits (78),  Expect(2) = 5e-23, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE+VDLE+
Sbjct  3    GDKAISLEEIKNESVDLER  21



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score = 99.8 bits (247),  Expect(2) = 5e-23, Method: Composition-based stats.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 34.7 bits (78),  Expect(2) = 5e-23, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE+VDLE+
Sbjct  3    GDKAISLEEIKNESVDLER  21



>gb|KDO67283.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
 gb|KDO67284.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=883

 Score = 99.4 bits (246),  Expect(2) = 5e-23, Method: Composition-based stats.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESKVLKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 35.0 bits (79),  Expect(2) = 5e-23, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE+VDLE+
Sbjct  3    GDKAISLEEIKNESVDLER  21



>dbj|BAO45902.1| plasma membrane H+-ATPase [Acacia mangium]
Length=954

 Score = 99.8 bits (247),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP++EVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LERIPVDEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  79   EAAAIMAIALANGD  92


 Score = 34.7 bits (78),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE VDLE+
Sbjct  3    GDKAISLEEIKNEAVDLER  21



>gb|KDO67286.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=675

 Score =   100 bits (248),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 67/73 (92%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESKVLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  79   EAAAIMAIALANG  91


 Score = 33.9 bits (76),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE+VDLE+
Sbjct  3    GDKAISLEEIKNESVDLER  21



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   101 bits (252),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEK ESKLLKFLGFMWNPLSWVM
Sbjct  17   LEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKNESKLLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANG+
Sbjct  77   EAAAIMAIALANGN  90


 Score = 32.3 bits (72),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            K+I+LE+IKNETVDLEK
Sbjct  3    KAISLEEIKNETVDLEK  19



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   101 bits (251),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L ++PIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  19   LERVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            E AAIMAIALANGD
Sbjct  79   EMAAIMAIALANGD  92


 Score = 32.7 bits (73),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK I+L++IKNETVDLE+
Sbjct  3    GDKPISLDEIKNETVDLER  21



>ref|XP_011045011.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Populus euphratica]
Length=954

 Score =   106 bits (264),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGLTSDEGANRLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCSREGLTSDEGANRLQVFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIVLANGD  92


 Score = 27.7 bits (60),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 11/15 (73%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+LE+IKNE+VDLE+
Sbjct  7    ISLEEIKNESVDLER  21



>dbj|BAC77531.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=954

 Score =   101 bits (252),  Expect(2) = 7e-23, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  79   EAAAIMAIALANGD  92


 Score = 32.0 bits (71),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
            SITLE+IKNETVDLE+
Sbjct  6    SITLEEIKNETVDLER  21



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   101 bits (252),  Expect(2) = 7e-23, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL++DEGA+RLQIFGPNKLEEK ESK+LKFLGFMWNPLSWVM
Sbjct  17   LEKIPIEEVFEQLKCTREGLSADEGASRLQIFGPNKLEEKNESKILKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANGD
Sbjct  77   EAAAVMAIALANGD  90


 Score = 32.3 bits (72),  Expect(2) = 7e-23, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            K+I+LE+IKNETVDLEK
Sbjct  3    KAISLEEIKNETVDLEK  19



>gb|KDO67282.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=923

 Score = 99.0 bits (245),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESKVLKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 34.7 bits (78),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE+VDLE+
Sbjct  3    GDKAISLEEIKNESVDLER  21



>emb|CBI20766.3| unnamed protein product [Vitis vinifera]
Length=862

 Score =   101 bits (252),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 57/61 (93%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGLTSDEGA+RLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCSREGLTSDEGASRLQIFGPNKLEEKKESKVLKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 32.0 bits (71),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
             DKSI LE+IKNE+VDLE+
Sbjct  3    ADKSIGLEEIKNESVDLER  21



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =   100 bits (249),  Expect(2) = 9e-23, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIGLANGD  92


 Score = 33.1 bits (74),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
             +KSI+LE+IKNETVDLE+
Sbjct  3    ANKSISLEEIKNETVDLER  21



>gb|KHG26452.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   102 bits (255),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKCSREGL+S+EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  16   LEKIPIEEVFEQLKCSREGLSSEEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  76   EAAAIMAIALANGD  89


 Score = 30.4 bits (67),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
            +I+LE+IKNETVDLEK
Sbjct  3    AISLEEIKNETVDLEK  18



>gb|KJB22048.1| hypothetical protein B456_004G027300 [Gossypium raimondii]
Length=951

 Score =   103 bits (257),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 69/74 (93%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL+SDEG NRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  16   LEKIPIEEVFEQLKCTREGLSSDEGVNRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  76   EAAAIMAIALANGD  89


 Score = 30.0 bits (66),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             I+LE+IKNETVDLEK
Sbjct  3    GISLEEIKNETVDLEK  18



>ref|XP_007154742.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
 gb|ESW26736.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
Length=953

 Score =   102 bits (254),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 69/74 (93%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVF+QLKCSREGL+ DEGANRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  20   LERIPIEEVFQQLKCSREGLSGDEGANRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  80   EAAAIMAIALANGD  93


 Score = 30.8 bits (68),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
            +ITL+QIKNETVDLE+
Sbjct  7    AITLDQIKNETVDLER  22



>ref|XP_002532086.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF30300.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=952

 Score =   100 bits (250),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPI+EVFEQLKC+REGL+SDEG NRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  17   LERIPIDEVFEQLKCTREGLSSDEGTNRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  77   EAAAIMAIALANGD  90


 Score = 32.3 bits (72),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            KSI+LE+IKNETVDLE+
Sbjct  3    KSISLEEIKNETVDLER  19



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score = 99.0 bits (245),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGL+S EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTREGLSSTEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANG+
Sbjct  79   EAAAVMAIALANGE  92


 Score = 33.9 bits (76),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 20/21 (95%), Gaps = 1/21 (5%)
 Frame = +2

Query  293  MGDK-SITLEQIKNETVDLEK  352
            MGDK +I+LE+IKNETVDLE+
Sbjct  1    MGDKTAISLEEIKNETVDLER  21



>gb|EYU37313.1| hypothetical protein MIMGU_mgv1a000870mg [Erythranthe guttata]
Length=954

 Score = 96.3 bits (238),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L K+PIEEVFEQLKC+REGL++DEG +RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LEKVPIEEVFEQLKCTREGLSADEGESRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  79   EAAAIMAIALANG  91


 Score = 37.0 bits (84),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNETVDLEK
Sbjct  3    GDKAISLEEIKNETVDLEK  21



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   100 bits (249),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L ++PIEEVFEQLKC+REGLTS EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERVPIEEVFEQLKCTREGLTSQEGANRLQIFGPNKLEEKKESKVLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            E AA+MAIALANG
Sbjct  79   EMAAVMAIALANG  91


 Score = 32.3 bits (72),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G+K+I+LE+IKNE VDLE+
Sbjct  3    GNKAISLEEIKNENVDLER  21



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score = 97.1 bits (240),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP++EVFEQLKC+REGL+S EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPVDEVFEQLKCTREGLSSAEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            E AA+MAIALANG
Sbjct  79   EMAAVMAIALANG  91


 Score = 35.8 bits (81),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 15/19 (79%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNETVDLE+
Sbjct  3    GDKAISLEEIKNETVDLER  21



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   103 bits (256),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVF+QLKC+REGL+SDEGANRLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  20   LERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANGD
Sbjct  80   EAAAVMAIALANGD  93


 Score = 29.3 bits (64),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
            +I+LE+IKNETVDLE+
Sbjct  7    AISLEEIKNETVDLER  22



>gb|KCW80694.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=815

 Score = 99.8 bits (247),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIP+EEVFEQLKC+REGL+SDEGA+RLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKIPVEEVFEQLKCTREGLSSDEGAHRLQVFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 32.3 bits (72),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 14/18 (78%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            +K+I+LE+IKNETVDLEK
Sbjct  4    NKAISLEEIKNETVDLEK  21



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   100 bits (249),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 56/61 (92%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLTSDEGA+RLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFQQLKCTREGLTSDEGAHRLQIFGPNKLEEKKESKVLKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 32.0 bits (71),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G  +I+LE+IKNETVDLEK
Sbjct  3    GGTAISLEEIKNETVDLEK  21



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score = 98.6 bits (244),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKK+SK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKDSKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANG+
Sbjct  79   EAAALMAIGLANGN  92


 Score = 33.9 bits (76),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            KSI+LEQIKNETVDLE+
Sbjct  5    KSISLEQIKNETVDLER  21



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   100 bits (249),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            E+AA+MAIALANG
Sbjct  79   ESAAVMAIALANG  91


 Score = 32.0 bits (71),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G  +I+LE+IKNETVDLE+
Sbjct  3    GGSTISLEEIKNETVDLER  21



>ref|XP_002324397.1| H+-ATPase family protein [Populus trichocarpa]
 gb|EEF02962.1| H+-ATPase family protein [Populus trichocarpa]
Length=954

 Score =   103 bits (258),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGLTSDEGA RLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCSREGLTSDEGATRLQVFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIVLANGD  92


 Score = 28.1 bits (61),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             I+LE+IKNE+VDLE+
Sbjct  6    GISLEEIKNESVDLER  21



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score = 97.8 bits (242),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+REGLT +EGANRLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAA+MAIALANG
Sbjct  79   EAAALMAIALANG  91


 Score = 34.3 bits (77),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE+VDLE+
Sbjct  3    GDKAISLEEIKNESVDLER  21



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score = 98.2 bits (243),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKK+SK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKDSKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANG+
Sbjct  79   EAAALMAIGLANGN  92


 Score = 33.5 bits (75),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            KSI+LEQIKNETVDLE+
Sbjct  5    KSISLEQIKNETVDLER  21



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score = 99.4 bits (246),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+R GLT++EGANRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTRAGLTTEEGANRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  79   EAAAIMAIALANGD  92


 Score = 32.3 bits (72),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK I+L++IKNE+VDLE+
Sbjct  3    GDKGISLDEIKNESVDLER  21



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score = 99.4 bits (246),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIP+EEVFEQLKC+REGL+SDEGA+RLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKIPVEEVFEQLKCTREGLSSDEGAHRLQVFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAA+MAIALANG
Sbjct  79   EAAALMAIALANG  91


 Score = 32.3 bits (72),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 14/18 (78%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            +K+I+LE+IKNETVDLEK
Sbjct  4    NKAISLEEIKNETVDLEK  21



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score = 98.6 bits (244),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 55/61 (90%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC++EGLTS EGA+RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFEQLKCTKEGLTSQEGADRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 33.5 bits (75),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+ +LE++KNETVDLEK
Sbjct  3    GDKASSLEELKNETVDLEK  21



>ref|XP_010669283.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669284.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
Length=952

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKCSREGL+S+EGANRLQIFGPNKLEEK ESK LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFEQLKCSREGLSSEEGANRLQIFGPNKLEEKSESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIVLANGD  92



>emb|CBW30211.1| Plasma membrane ATPase [Musa balbisiana]
Length=954

 Score = 95.9 bits (237),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFE+LKC+++GL+S+EGA+RLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            E AAIMAIALANGD
Sbjct  79   EMAAIMAIALANGD  92


 Score = 35.8 bits (81),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G+K+ITLE+IKNETVDLE+
Sbjct  3    GNKAITLEEIKNETVDLER  21



>emb|CBW30173.1| Plasma membrane ATPase 4 [Musa balbisiana]
Length=954

 Score = 95.9 bits (237),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFE+LKC+++GL+S+EGA+RLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            E AAIMAIALANGD
Sbjct  79   EMAAIMAIALANGD  92


 Score = 35.8 bits (81),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G+K+ITLE+IKNETVDLE+
Sbjct  3    GNKAITLEEIKNETVDLER  21



>gb|EYU20899.1| hypothetical protein MIMGU_mgv1a000880mg [Erythranthe guttata]
Length=952

 Score = 99.0 bits (245),  Expect(2) = 4e-22, Method: Composition-based stats.
 Identities = 66/73 (90%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L K+PIEEVFEQLKC+REGL+SDEGANRL++FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  17   LEKVPIEEVFEQLKCNREGLSSDEGANRLELFGPNKLEEKKESKVLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  77   EAAAIMAIALANG  89


 Score = 32.3 bits (72),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            DK+++LE IKNETVDLEK
Sbjct  2    DKALSLEGIKNETVDLEK  19



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score = 97.1 bits (240),  Expect(2) = 4e-22, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFE+LKC+++GL+S+EGA+RLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            E AA+MAIALANGD
Sbjct  79   EMAAVMAIALANGD  92


 Score = 34.3 bits (77),  Expect(2) = 4e-22, Method: Composition-based stats.
 Identities = 15/19 (79%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G+K+ITLE IKNETVDLE+
Sbjct  3    GNKAITLEDIKNETVDLER  21



>ref|XP_009368031.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=948

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 67/76 (88%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  337  C*LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSW  516
            C   +IPIEEVFEQLKC+REGLT+DEGANRLQ+FGPNKLEEKKESKLLKFLGFMWNPLSW
Sbjct  7    CSQERIPIEEVFEQLKCTREGLTADEGANRLQVFGPNKLEEKKESKLLKFLGFMWNPLSW  66

Query  517  VMEaaaimaialaNGD  564
            VMEAAA+MAI LANGD
Sbjct  67   VMEAAALMAIVLANGD  82



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =   100 bits (248),  Expect(2) = 4e-22, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANG+
Sbjct  79   EAAAIMAIALANGE  92


 Score = 30.8 bits (68),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            K I+LE+I+NETVDLEK
Sbjct  5    KGISLEEIRNETVDLEK  21



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score = 97.1 bits (240),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGL+ +EGA RL+IFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  20   LERIPIEEVFEQLKCSREGLSGEEGAQRLEIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  80   EAAAIMAIALANGD  93


 Score = 33.9 bits (76),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            DK+I+LE+IKNETVDLE+
Sbjct  5    DKAISLEEIKNETVDLER  22



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score = 99.0 bits (245),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 55/61 (90%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTQEGLTSEEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 32.0 bits (71),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G  +I+LE+IKNETVDLE+
Sbjct  3    GGSAISLEEIKNETVDLER  21



>ref|XP_009397034.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score = 95.9 bits (237),  Expect(2) = 6e-22, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGL+  EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTREGLSLTEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            E AAIMAIALANG
Sbjct  79   EMAAIMAIALANG  91


 Score = 35.0 bits (79),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+L++IKNETVDLE+
Sbjct  3    GDKAISLDEIKNETVDLER  21



>gb|KJB65971.1| hypothetical protein B456_010G123000 [Gossypium raimondii]
Length=957

 Score = 98.2 bits (243),  Expect(2) = 6e-22, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGL+++EG NRLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTREGLSTEEGNNRLQVFGPNKLEEKKESKVLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  79   EAAAIMAIALANGD  92


 Score = 32.3 bits (72),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G+K I+LE+IKNE+VDLE+
Sbjct  3    GEKGISLEEIKNESVDLER  21



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   101 bits (251),  Expect(2) = 6e-22, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVF+QLKC+REGL+SDEGANRLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  20   LERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANG+
Sbjct  80   EAAAIMAIALANGN  93


 Score = 29.3 bits (64),  Expect(2) = 6e-22, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
            +I+LE+IKNETVDLE+
Sbjct  7    AISLEEIKNETVDLER  22



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   101 bits (251),  Expect(2) = 6e-22, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVF+QLKC+REGL+SDEGANRLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  20   LERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANG+
Sbjct  80   EAAAIMAIALANGN  93


 Score = 29.3 bits (64),  Expect(2) = 6e-22, Method: Composition-based stats.
 Identities = 12/16 (75%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
            +I+LE+IKNETVDLE+
Sbjct  7    AISLEEIKNETVDLER  22



>dbj|BAA37150.1| p-type H+-ATPase [Vicia faba]
Length=952

 Score = 97.1 bits (240),  Expect(2) = 6e-22, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IP+EEVFEQLKC++EGL+ +EGANRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  19   LEHIPVEEVFEQLKCTKEGLSLEEGANRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIGLANGD  92


 Score = 33.5 bits (75),  Expect(2) = 6e-22, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLE  349
            +KSITLE+IKNETVDLE
Sbjct  4    NKSITLEEIKNETVDLE  20



>dbj|BAD16684.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   101 bits (252),  Expect(2) = 6e-22, Method: Composition-based stats.
 Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  15   LEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  74

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANG+
Sbjct  75   EAAAIMAIALANGN  88


 Score = 28.9 bits (63),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             ++LE+IKNETVDLEK
Sbjct  2    GLSLEEIKNETVDLEK  17



>gb|KJB55190.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=954

 Score = 99.8 bits (247),  Expect(2) = 7e-22, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+R GLTS+EGANRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTRGGLTSEEGANRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANGD
Sbjct  79   EAAALMAIALANGD  92


 Score = 30.4 bits (67),  Expect(2) = 7e-22, Method: Composition-based stats.
 Identities = 12/18 (67%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            D+ I+LE+IKNE+VDLE+
Sbjct  4    DRGISLEEIKNESVDLER  21



>gb|KJB55189.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=956

 Score = 99.8 bits (247),  Expect(2) = 7e-22, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+R GLTS+EGANRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTRGGLTSEEGANRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANGD
Sbjct  79   EAAALMAIALANGD  92


 Score = 30.4 bits (67),  Expect(2) = 7e-22, Method: Composition-based stats.
 Identities = 12/18 (67%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            D+ I+LE+IKNE+VDLE+
Sbjct  4    DRGISLEEIKNESVDLER  21



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =   103 bits (257),  Expect(2) = 7e-22, Method: Composition-based stats.
 Identities = 69/74 (93%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL+ DEGANRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFEQLKCTREGLSGDEGANRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAI LANGD
Sbjct  74   EAAAIMAIVLANGD  87


 Score = 26.9 bits (58),  Expect(2) = 7e-22, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score = 96.7 bits (239),  Expect(2) = 7e-22, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGL  +EGA RL+IFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  20   LERIPIEEVFEQLKCSREGLNGEEGAQRLEIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  80   EAAAIMAIALANGD  93


 Score = 33.9 bits (76),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            DK+I+LE+IKNETVDLE+
Sbjct  5    DKAISLEEIKNETVDLER  22



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   101 bits (251),  Expect(2) = 8e-22, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+REGLTS+EG NRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTREGLTSEEGQNRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIVLANGD  92


 Score = 29.3 bits (64),  Expect(2) = 8e-22, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            K +TLE+IKNE VDLE+
Sbjct  5    KGLTLEEIKNEAVDLER  21



>gb|KJB66333.1| hypothetical protein B456_010G136300 [Gossypium raimondii]
Length=949

 Score = 92.8 bits (229),  Expect(2) = 9e-22, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVF+QLKC+R GLTS+EG  RLQIFGPNKLEEKKE+KLLKFLGFMWNPLSWVM
Sbjct  18   LERIPVEEVFQQLKCTRNGLTSEEGQKRLQIFGPNKLEEKKENKLLKFLGFMWNPLSWVM  77

Query  523  EaaaimaialaNG  561
            E AAIMAIALANG
Sbjct  78   EFAAIMAIALANG  90


 Score = 37.4 bits (85),  Expect(2) = 9e-22, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
 Frame = +2

Query  293  MGDKSITLEQIKNETVDLEK  352
            M DKSI+LE+IKNETVDLE+
Sbjct  1    MADKSISLEEIKNETVDLER  20



>gb|KHF98166.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=663

 Score = 97.4 bits (241),  Expect(2) = 9e-22, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGL+++EG NRLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCSREGLSTEEGNNRLQVFGPNKLEEKKESKVLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  79   EAAAIMAIALANGD  92


 Score = 32.3 bits (72),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G+K I+LE+IKNE+VDLE+
Sbjct  3    GEKGISLEEIKNESVDLER  21



>gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score = 97.4 bits (241),  Expect(2) = 9e-22, Method: Composition-based stats.
 Identities = 67/73 (92%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  79   EAAAIMAIALANG  91


 Score = 32.7 bits (73),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 1/21 (5%)
 Frame = +2

Query  293  MG-DKSITLEQIKNETVDLEK  352
            MG D ++TLE+IKNETVDLEK
Sbjct  1    MGNDTALTLEEIKNETVDLEK  21



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score = 97.4 bits (241),  Expect(2) = 9e-22, Method: Composition-based stats.
 Identities = 67/73 (92%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  79   EAAAIMAIALANG  91


 Score = 32.7 bits (73),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 1/21 (5%)
 Frame = +2

Query  293  MG-DKSITLEQIKNETVDLEK  352
            MG D ++TLE+IKNETVDLEK
Sbjct  1    MGNDTALTLEEIKNETVDLEK  21



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   102 bits (254),  Expect(2) = 9e-22, Method: Composition-based stats.
 Identities = 66/73 (90%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVFEQLKCS+EGLTSDEGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  15   LEHIPIEEVFEQLKCSKEGLTSDEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  74

Query  523  EaaaimaialaNG  561
            E AA+MAI LANG
Sbjct  75   EMAALMAIVLANG  87


 Score = 27.7 bits (60),  Expect(2) = 9e-22, Method: Composition-based stats.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLE  349
            I+LEQIKNE VDLE
Sbjct  3    ISLEQIKNEAVDLE  16



>dbj|BAF03589.1| P-type H+-ATPase [Zostera marina]
Length=964

 Score = 98.2 bits (243),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKCSREGL+ +EGA+RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  18   LERIPVEEVFEQLKCSREGLSGEEGASRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  77

Query  523  EaaaimaialaNGD  564
            E AAIMAIALANGD
Sbjct  78   EMAAIMAIALANGD  91


 Score = 32.0 bits (71),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  293  MGDKSITLEQIKNETVDLEK  352
            M +K I LE+IKNETVDLE+
Sbjct  1    MENKGINLEEIKNETVDLER  20



>ref|XP_004148326.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
 ref|XP_004163698.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=954

 Score = 97.1 bits (240),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 67/73 (92%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  79   EAAAIMAIALANG  91


 Score = 32.7 bits (73),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 1/21 (5%)
 Frame = +2

Query  293  MG-DKSITLEQIKNETVDLEK  352
            MG D ++TLE+IKNETVDLEK
Sbjct  1    MGNDTALTLEEIKNETVDLEK  21



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score = 97.4 bits (241),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  20   LERIPIEEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANG+
Sbjct  80   EAAAIMAIALANGE  93


 Score = 32.3 bits (72),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 19/20 (95%), Gaps = 1/20 (5%)
 Frame = +2

Query  296  GDK-SITLEQIKNETVDLEK  352
            GDK +ITLE+IKNETVDLE+
Sbjct  3    GDKGTITLEEIKNETVDLER  22



>dbj|BAD16685.1| plasma membrane H+-ATPase [Daucus carota]
Length=951

 Score = 99.8 bits (247),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL++DEGANRL+IFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  15   LEKIPIEEVFEQLKCTREGLSTDEGANRLEIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  74

Query  523  E  525
            E
Sbjct  75   E  75


 Score = 30.0 bits (66),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             I+LE+IKNETVDLEK
Sbjct  2    GISLEEIKNETVDLEK  17



>ref|XP_010914190.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=957

 Score = 97.4 bits (241),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+REGL+++EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTREGLSAEEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 32.0 bits (71),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G++ I+LE+IKNETVDLE+
Sbjct  3    GEQGISLEEIKNETVDLER  21



>ref|XP_004296457.1| PREDICTED: plasma membrane ATPase 4 [Fragaria vesca subsp. vesca]
Length=955

 Score = 95.5 bits (236),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVF QLKCSREGL+S EGA RL+IFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  20   LERIPIEEVFAQLKCSREGLSSAEGAQRLEIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  80   EAAAIMAIALANGD  93


 Score = 33.9 bits (76),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            DK+I+LE+IKNETVDLE+
Sbjct  5    DKAISLEEIKNETVDLER  22



>gb|KHG28536.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score = 99.4 bits (246),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL+SDEG NR+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  16   LEKIPIEEVFEQLKCTREGLSSDEGVNRIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANG+
Sbjct  76   EAAAIMAIALANGE  89


 Score = 30.0 bits (66),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             I+LE+IKNETVDLEK
Sbjct  3    GISLEEIKNETVDLEK  18



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score = 98.2 bits (243),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC++EGLTS+EG NRL+IFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTKEGLTSEEGENRLKIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  79   EAAALMAIVLANGD  92


 Score = 31.2 bits (69),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (86%), Gaps = 1/21 (5%)
 Frame = +2

Query  293  MG-DKSITLEQIKNETVDLEK  352
            MG +K ITLE+IKNE VDLE+
Sbjct  1    MGSNKGITLEEIKNEAVDLER  21



>ref|XP_009347012.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=955

 Score = 95.5 bits (236),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKCS+EGL+S+EGA RL+IFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  20   LERIPVEEVFEQLKCSKEGLSSEEGAQRLEIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANG+
Sbjct  80   EAAAVMAIALANGE  93


 Score = 33.9 bits (76),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            DK+I+LE+IKNETVDLE+
Sbjct  5    DKAISLEEIKNETVDLER  22



>gb|KEH35952.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 67/79 (85%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  325  QE*DC*LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWN  504
            Q   C + +IP+EEVFEQLKCSR GLTSDEGANRLQ+FGPNKLEEK+ESK LKFLGFMWN
Sbjct  9    QRNSCVIERIPVEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKRESKFLKFLGFMWN  68

Query  505  PLSWVMEaaaimaialaNG  561
            PLSWVMEAAAIMAIALANG
Sbjct  69   PLSWVMEAAAIMAIALANG  87



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score = 94.0 bits (232),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC++EGLT +EGA+RLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTKEGLTGEEGASRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAA+MAIALANG
Sbjct  79   EAAALMAIALANG  91


 Score = 34.7 bits (78),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+I+LE+IKNE+VDLE+
Sbjct  3    GDKAISLEEIKNESVDLER  21



>gb|AAY42949.1| plasma membrane H+ ATPase [Lupinus albus]
Length=951

 Score =   101 bits (252),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 68/74 (92%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP++EVFEQLKCSREGLTSDEGA+RLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  16   LERIPVDEVFEQLKCSREGLTSDEGASRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  76   EAAAIMAIALANGD  89


 Score = 26.9 bits (58),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+LE+IKNE VDLE+
Sbjct  4    ISLEEIKNENVDLER  18



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =   101 bits (251),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGL+S+EGANRLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTREGLSSEEGANRLQVFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANGD
Sbjct  79   EAAALMAIALANGD  92


 Score = 27.7 bits (60),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 11/15 (73%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+LE+IKNE+VDLE+
Sbjct  7    ISLEEIKNESVDLER  21



>ref|XP_003594954.1| Plasma membrane ATPase [Medicago truncatula]
 gb|AES65205.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score = 96.3 bits (238),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGL+S EG NR+QIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  21   LERIPIEEVFEQLKCTREGLSSTEGENRIQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  80

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANG+
Sbjct  81   EAAALMAIALANGE  94


 Score = 32.3 bits (72),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 19/20 (95%), Gaps = 1/20 (5%)
 Frame = +2

Query  296  GDK-SITLEQIKNETVDLEK  352
            GDK SI+L+QIKNETVDLE+
Sbjct  4    GDKGSISLDQIKNETVDLER  23



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score = 95.9 bits (237),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPI+EVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  20   LERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANG+
Sbjct  80   EAAAIMAIALANGE  93


 Score = 33.1 bits (74),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 19/20 (95%), Gaps = 1/20 (5%)
 Frame = +2

Query  296  GDK-SITLEQIKNETVDLEK  352
            GDK +ITLE+IKNETVDLE+
Sbjct  3    GDKGTITLEEIKNETVDLER  22



>gb|KHG19606.1| ATPase 5, plasma membrane-type -like protein [Gossypium arboreum]
Length=659

 Score = 96.7 bits (239),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+R GLTS+EG NRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTRGGLTSEEGTNRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANGD
Sbjct  79   EAAALMAIALANGD  92


 Score = 32.0 bits (71),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 1/21 (5%)
 Frame = +2

Query  293  MG-DKSITLEQIKNETVDLEK  352
            MG DK I+LE+IKNE+VDLE+
Sbjct  1    MGNDKGISLEEIKNESVDLER  21



>ref|XP_008372282.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=955

 Score = 94.7 bits (234),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVF QLKCSREGL+S+EG  RL+IFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  20   LERIPIEEVFGQLKCSREGLSSEEGGQRLEIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  80   EAAAIMAIALANGD  93


 Score = 33.9 bits (76),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            DK+I+LE+IKNETVDLE+
Sbjct  5    DKAISLEEIKNETVDLER  22



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score = 95.9 bits (237),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPI+EVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  20   LERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANG+
Sbjct  80   EAAAIMAIALANGE  93


 Score = 32.3 bits (72),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 19/20 (95%), Gaps = 1/20 (5%)
 Frame = +2

Query  296  GDK-SITLEQIKNETVDLEK  352
            GDK +ITLE+I+NETVDLE+
Sbjct  3    GDKGTITLEEIRNETVDLER  22



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score = 95.9 bits (237),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPI+EVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  20   LERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANG+
Sbjct  80   EAAAIMAIALANGE  93


 Score = 32.3 bits (72),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 16/20 (80%), Positives = 19/20 (95%), Gaps = 1/20 (5%)
 Frame = +2

Query  296  GDK-SITLEQIKNETVDLEK  352
            GDK +ITLE+IKNETVDLE+
Sbjct  3    GDKGTITLEEIKNETVDLER  22



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score = 98.2 bits (243),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVF+QLKC+REGLTSDEGA+RLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LENIPIEEVFQQLKCTREGLTSDEGAHRLQLFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            E+AAIMAIALANG
Sbjct  79   ESAAIMAIALANG  91


 Score = 30.0 bits (66),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 13/18 (72%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLE  349
            G  +I+LE+IKNETVDLE
Sbjct  3    GGTAISLEEIKNETVDLE  20



>emb|CAA59799.1| H(+)-transporting ATPase [Phaseolus vulgaris]
Length=951

 Score =   100 bits (250),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 68/73 (93%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSR GLTSDEGANRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPIEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  76   EAAAIMAIALANG  88


 Score = 27.3 bits (59),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+LE+IKNE VDLE+
Sbjct  4    ISLEEIKNENVDLER  18



>ref|XP_007161308.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
 gb|ESW33302.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
Length=951

 Score =   100 bits (250),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 68/73 (93%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSR GLTSDEGANRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPIEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  76   EAAAIMAIALANG  88


 Score = 27.3 bits (59),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+LE+IKNE VDLE+
Sbjct  4    ISLEEIKNENVDLER  18



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score = 99.8 bits (247),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 67/73 (92%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSR+GLTS+EGANRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPIEEVFEQLKCSRQGLTSEEGANRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  76   EAAAIMAIALANG  88


 Score = 28.1 bits (61),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             I+LE+IKNE+VDLE+
Sbjct  3    GISLEEIKNESVDLER  18



>ref|XP_009417440.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score = 92.0 bits (227),  Expect(2) = 5e-21, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVF QLKCSREGL+S EG  RLQIFGPNKLEEK ESK LKFLGFMWNPLSWVM
Sbjct  22   LERIPVEEVFAQLKCSREGLSSPEGEQRLQIFGPNKLEEKTESKFLKFLGFMWNPLSWVM  81

Query  523  EaaaimaialaNG  561
            E AAIMAIAL NG
Sbjct  82   EIAAIMAIALDNG  94


 Score = 35.4 bits (80),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GD SI+LEQIKNE+VDLE+
Sbjct  6    GDGSISLEQIKNESVDLER  24



>ref|XP_010688454.1| PREDICTED: plasma membrane ATPase 4 [Beta vulgaris subsp. vulgaris]
Length=953

 Score =   100 bits (249),  Expect(2) = 5e-21, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVFEQLKCSREGLTS EGA+RLQIFGPNKLEEK E+K LKFLGFMWNPLSWVM
Sbjct  17   LENIPIEEVFEQLKCSREGLTSQEGADRLQIFGPNKLEEKTENKFLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  77   EAAAIMAIALANGD  90


 Score = 27.3 bits (59),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLE  349
            K+I LE IKNE VDLE
Sbjct  3    KAINLEDIKNEAVDLE  18



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score = 98.6 bits (244),  Expect(2) = 5e-21, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+REGL++DEG NRL+IFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  15   LEKIPIEEVFEQLKCTREGLSADEGTNRLEIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  74

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANG+
Sbjct  75   EAAAIMAIALANGN  88


 Score = 28.9 bits (63),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             ++LE+IKNETVDLEK
Sbjct  2    GLSLEEIKNETVDLEK  17



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score = 97.8 bits (242),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVFEQLKC+REGLTS+EGA+RLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  20   LEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNG  561
            EAAA+MAI LANG
Sbjct  80   EAAALMAIVLANG  92


 Score = 29.6 bits (65),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLE  349
            K+ITLE+IKNE VDLE
Sbjct  6    KAITLEEIKNEAVDLE  21



>ref|XP_010048663.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
Length=954

 Score = 91.7 bits (226),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+  GLT+ EG +RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFEQLKCTPNGLTTQEGESRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANG+
Sbjct  79   EAAALMAIVLANGE  92


 Score = 35.4 bits (80),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 16/18 (89%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            DK I+LEQIKNETVDLEK
Sbjct  4    DKGISLEQIKNETVDLEK  21



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   100 bits (248),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 66/73 (90%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKCSR GLTSDEGANRLQ+FGPNKLEEK+ESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPVEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKRESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  76   EAAAIMAIALANG  88


 Score = 26.9 bits (58),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+LE+IKNE VDLE+
Sbjct  4    ISLEEIKNENVDLER  18



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score = 97.4 bits (241),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 64/73 (88%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVFEQLKC+REGLTS+EGA+RLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  20   LEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKESKILKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNG  561
            EAAA+MAI LANG
Sbjct  80   EAAALMAIVLANG  92


 Score = 29.6 bits (65),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLE  349
            K+ITLE+IKNE VDLE
Sbjct  6    KAITLEEIKNEAVDLE  21



>ref|XP_002515334.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF46783.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=734

 Score = 99.8 bits (247),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSREGL+S+EG NRLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCSREGLSSEEGTNRLQVFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  79   EAAAIMAIALANGD  92


 Score = 27.7 bits (60),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 11/15 (73%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+LE+IKNE+VDLE+
Sbjct  7    ISLEEIKNESVDLER  21



>ref|XP_004501246.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score = 99.8 bits (247),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKCSREGLTS+EG+NRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPVEEVFEQLKCSREGLTSEEGSNRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAA+MAIALANG
Sbjct  76   EAAALMAIALANG  88


 Score = 27.3 bits (59),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             I+LE+IKNE VDLE+
Sbjct  3    GISLEEIKNENVDLER  18



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score = 99.4 bits (246),  Expect(2) = 8e-21, Method: Composition-based stats.
 Identities = 66/73 (90%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKCS+EGL+SDEGANRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPVEEVFEQLKCSKEGLSSDEGANRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  76   EAAAIMAIALANG  88


 Score = 27.3 bits (59),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             I+LE+IKNE VDLE+
Sbjct  3    GISLEEIKNENVDLER  18



>ref|XP_011031360.1| PREDICTED: plasma membrane ATPase 4-like [Populus euphratica]
Length=955

 Score = 99.0 bits (245),  Expect(2) = 8e-21, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+REGL++DEGA+RLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPMEEVFEQLKCTREGLSADEGASRLQVFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANGD
Sbjct  79   EAAALMAIALANGD  92


 Score = 28.1 bits (61),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             I+LE+IKNE+VDLE+
Sbjct  6    GISLEEIKNESVDLER  21



>ref|XP_006382164.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP59961.1| H+-ATPase family protein [Populus trichocarpa]
Length=955

 Score = 98.6 bits (244),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+REGL++DEGA+RLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPMEEVFEQLKCTREGLSADEGASRLQVFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANGD
Sbjct  79   EAAALMAIALANGD  92


 Score = 28.1 bits (61),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             I+LE+IKNE+VDLE+
Sbjct  6    GISLEEIKNESVDLER  21



>gb|KEH39758.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score = 98.6 bits (244),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 66/73 (90%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPI+EVFEQLKCSR+GLTS+EGANRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPIDEVFEQLKCSRQGLTSEEGANRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  76   EAAAIMAIALANG  88


 Score = 28.1 bits (61),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             I+LE+IKNE+VDLE+
Sbjct  3    GISLEEIKNESVDLER  18



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score = 94.4 bits (233),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+R+GLT++EG  RLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTRQGLTTEEGEQRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            E AA+MAI LANG
Sbjct  79   EIAALMAIGLANG  91


 Score = 32.0 bits (71),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G+K+I+LE+IKNE VDLE+
Sbjct  3    GNKNISLEEIKNENVDLER  21



>gb|AFW04239.1| plasma membrane H+-ATPase [Sesuvium portulacastrum]
Length=953

 Score = 99.0 bits (245),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 56/61 (92%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVFEQLKCSREGLTSDEGANRL +FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  17   LENIPIEEVFEQLKCSREGLTSDEGANRLNLFGPNKLEEKKESKFLKFLGFMWNPLSWVM  76

Query  523  E  525
            E
Sbjct  77   E  77


 Score = 27.3 bits (59),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLE  349
            K+I LE IKNE VDLE
Sbjct  3    KAINLEDIKNEAVDLE  18



>gb|KJB82762.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=758

 Score = 95.1 bits (235),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 52/61 (85%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGL++ EG NRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTREGLSTQEGNNRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 31.2 bits (69),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G+K I+L++IKNE+VDLE+
Sbjct  3    GNKGISLDEIKNESVDLER  21



>gb|KFK27866.1| hypothetical protein AALP_AA8G439300 [Arabis alpina]
Length=949

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIP+EEVF+QLKCSREGL+S+EG NRLQIFGPNKLEEK+E+K+LKFLGFMWNPLSWVM
Sbjct  17   LEKIPVEEVFQQLKCSREGLSSEEGRNRLQIFGPNKLEEKEENKILKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAAIMAI LANGD
Sbjct  77   EAAAIMAIVLANGD  90



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score = 95.1 bits (235),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+REGL++ EG NRLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTREGLSASEGENRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            E AAIMAIALANG
Sbjct  79   EMAAIMAIALANG  91


 Score = 30.8 bits (68),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GD +I+L++IKNE VDLE+
Sbjct  3    GDNAISLDEIKNEAVDLER  21



>gb|KJB82763.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=954

 Score = 95.1 bits (235),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGL++ EG NRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLKCTREGLSTQEGNNRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  79   EAAAIMAIALANG  91


 Score = 30.4 bits (67),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G+K I+L++IKNE+VDLE+
Sbjct  3    GNKGISLDEIKNESVDLER  21



>gb|AAY42950.1| plasma membrane H+ ATPase [Lupinus albus]
Length=953

 Score = 94.7 bits (234),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L ++PIEEVF+QLKC++EGL+S EGANRL+IFGPNKLEEKK+SK LKFLGFMWNPLSWVM
Sbjct  19   LERVPIEEVFQQLKCTKEGLSSGEGANRLEIFGPNKLEEKKDSKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            E AAIMA+ALANG+
Sbjct  79   ELAAIMAVALANGE  92


 Score = 30.8 bits (68),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            K I+LE+IKNETVDLE+
Sbjct  5    KGISLEEIKNETVDLER  21



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score = 92.4 bits (228),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP++EVFEQLKC++EGLT++EG  RLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPVQEVFEQLKCTKEGLTTEEGEQRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            E AAIMAIALANG
Sbjct  79   EIAAIMAIALANG  91


 Score = 33.5 bits (75),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G+KSI+LE+IKNE VDLE+
Sbjct  3    GNKSISLEEIKNENVDLER  21



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+ LKCSREGL+S EGANRLQIFGPNKLEEKK+SK LKFLGFMWNPLSWVM
Sbjct  20   LEKIPIEEVFDSLKCSREGLSSAEGANRLQIFGPNKLEEKKDSKFLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNGD  564
            EAAA+MAI LANGD
Sbjct  80   EAAALMAIVLANGD  93



>ref|XP_003544641.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=951

 Score = 98.6 bits (244),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 67/73 (92%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSR GLTS+EGANRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPIEEVFEQLKCSRAGLTSEEGANRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  76   EAAAIMAIALANG  88


 Score = 26.9 bits (58),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+LE+IKNE VDLE+
Sbjct  4    ISLEEIKNENVDLER  18



>ref|XP_007137116.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
 gb|ESW09110.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
Length=951

 Score = 98.2 bits (243),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKCSR GLTSDEGA+RLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  16   LERIPVEEVFEQLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKVLKFLGFMWNPLSWVM  75

Query  523  E  525
            E
Sbjct  76   E  76


 Score = 27.3 bits (59),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             I+LE+IKNE VDLE+
Sbjct  3    GISLEEIKNENVDLER  18



>gb|KJB54894.1| hypothetical protein B456_009G053500 [Gossypium raimondii]
Length=952

 Score = 95.1 bits (235),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVF+QLKC+REGLTS+EG  RLQIFGPNKLEEK+ESK LKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFQQLKCTREGLTSEEGEKRLQIFGPNKLEEKEESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAAIMAI LANG
Sbjct  79   EAAAIMAIVLANG  91


 Score = 30.4 bits (67),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 13/15 (87%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+LEQIKNETVDLE+
Sbjct  7    ISLEQIKNETVDLER  21



>ref|XP_006282542.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
 gb|EOA15440.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
Length=948

 Score = 98.2 bits (243),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGLT+ EG +RLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCSREGLTTQEGDDRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            E AAIMAIALANGD
Sbjct  74   EMAAIMAIALANGD  87


 Score = 27.3 bits (59),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  3    SLEDIKNETVDLEK  16



>ref|NP_001190870.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 gb|AEE85732.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=981

 Score = 97.8 bits (242),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            E AAIMAIALANGD
Sbjct  74   EMAAIMAIALANGD  87


 Score = 27.3 bits (59),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  3    SLEDIKNETVDLEK  16



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score = 95.5 bits (236),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IP+EEVFEQLKCSREGLTS EG  RLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  16   LENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            E AAIMAI LANG
Sbjct  76   EIAAIMAIVLANG  88


 Score = 29.6 bits (65),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLE  349
            I+LEQIKNETVDLE
Sbjct  4    ISLEQIKNETVDLE  17



>gb|KGN62872.1| hypothetical protein Csa_2G378540 [Cucumis sativus]
Length=546

 Score = 94.7 bits (234),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVFEQLKC+REGLTS+EGA+RLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  20   LEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNG  561
            EAAA+MAI LANG
Sbjct  80   EAAALMAIVLANG  92


 Score = 30.0 bits (66),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%), Gaps = 1/20 (5%)
 Frame = +2

Query  296  GD-KSITLEQIKNETVDLEK  352
            GD K+ITLE+IKNE VDLE 
Sbjct  3    GDHKAITLEEIKNEAVDLEH  22



>ref|XP_010046966.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Eucalyptus grandis]
Length=990

 Score = 92.8 bits (229),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+ +GLT++EG  RL+IFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFEQLKCTPKGLTTEEGNTRLEIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  79   EAAAIMAIALANGD  92


 Score = 32.3 bits (72),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G  +I+LE+IKNETVDLEK
Sbjct  3    GAGAISLEEIKNETVDLEK  21



>ref|XP_010438207.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=948

 Score = 97.8 bits (242),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            E AAIMAIALANGD
Sbjct  74   EMAAIMAIALANGD  87


 Score = 27.3 bits (59),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  3    SLEDIKNETVDLEK  16



>ref|XP_010433017.1| PREDICTED: ATPase 2, plasma membrane-type [Camelina sativa]
Length=948

 Score = 97.4 bits (241),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            E AAIMAIALANGD
Sbjct  74   EMAAIMAIALANGD  87


 Score = 27.3 bits (59),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  3    SLEDIKNETVDLEK  16



>ref|NP_194748.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 sp|P19456.2|PMA2_ARATH RecName: Full=ATPase 2, plasma membrane-type; AltName: Full=Proton 
pump 2 [Arabidopsis thaliana]
 gb|AAA32751.1| H+-ATPase [Arabidopsis thaliana]
 emb|CAB52463.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 emb|CAB81012.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 gb|AAK59580.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AAN31920.1| putative H+-transporting ATPase type 2 [Arabidopsis thaliana]
 gb|AAN71968.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE85731.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=948

 Score = 97.4 bits (241),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            E AAIMAIALANGD
Sbjct  74   EMAAIMAIALANGD  87


 Score = 27.3 bits (59),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  3    SLEDIKNETVDLEK  16



>ref|XP_002527322.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF35074.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=733

 Score = 92.4 bits (228),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVF+QL C+REGL+SDEG  RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  18   LERIPVEEVFQQLNCTREGLSSDEGQKRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  77

Query  523  EaaaimaialaNG  561
            E AAIMAIALANG
Sbjct  78   EIAAIMAIALANG  90


 Score = 32.3 bits (72),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 14/20 (70%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  293  MGDKSITLEQIKNETVDLEK  352
            M  KS +LE+IKNETVDLE+
Sbjct  1    MAAKSFSLEEIKNETVDLER  20



>gb|EPS65442.1| hypothetical protein M569_09334 [Genlisea aurea]
Length=954

 Score = 93.6 bits (231),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 52/61 (85%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFE L+C+REGL+S+EG  RLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFENLRCTREGLSSEEGETRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 31.2 bits (69),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
            SI+LE+IKNETVDLEK
Sbjct  6    SISLEEIKNETVDLEK  21



>gb|KEH39757.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=820

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPI+EVFEQLKCSR+GLTS+EGANRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LERIPIDEVFEQLKCSRQGLTSEEGANRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79



>ref|XP_006412736.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
 gb|ESQ54189.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
Length=948

 Score = 97.4 bits (241),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 27.3 bits (59),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  3    SLEDIKNETVDLEK  16



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score = 94.7 bits (234),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 51/61 (84%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC++EGL+S+EGA+R+QIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  17   LERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  76

Query  523  E  525
            E
Sbjct  77   E  77


 Score = 29.6 bits (65),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            +K+ +LE+IKNETVDLE+
Sbjct  2    EKATSLEEIKNETVDLER  19



>ref|XP_003550136.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
 gb|KHN31599.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=951

 Score = 97.1 bits (240),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 66/73 (90%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKCSR GLTS+EG NRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPIEEVFEQLKCSRAGLTSEEGGNRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  76   EAAAIMAIALANG  88


 Score = 27.3 bits (59),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             I+LE+IKNE VDLE+
Sbjct  3    GISLEEIKNENVDLER  18



>ref|XP_010046967.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Eucalyptus grandis]
 gb|KCW78684.1| hypothetical protein EUGRSUZ_C00140 [Eucalyptus grandis]
Length=954

 Score = 92.4 bits (228),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVFEQLKC+ +GLT++EG  RL+IFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFEQLKCTPKGLTTEEGNTRLEIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  79   EAAAIMAIALANGD  92


 Score = 32.0 bits (71),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G  +I+LE+IKNETVDLEK
Sbjct  3    GAGAISLEEIKNETVDLEK  21



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score = 94.7 bits (234),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC++EGL+S+EGA+R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  17   LERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  77   EAAAIMAIALANG  89


 Score = 29.6 bits (65),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            +K+ +LE+IKNETVDLE+
Sbjct  2    EKATSLEEIKNETVDLER  19



>dbj|BAJ34124.1| unnamed protein product [Thellungiella halophila]
Length=948

 Score = 97.1 bits (240),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 27.3 bits (59),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  3    SLEDIKNETVDLEK  16



>pdb|3B8C|A Chain A, Crystal Structure Of A Plasma Membrane Proton Pump
 pdb|3B8C|B Chain B, Crystal Structure Of A Plasma Membrane Proton Pump
Length=885

 Score = 97.1 bits (240),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            E AAIMAIALANGD
Sbjct  74   EMAAIMAIALANGD  87


 Score = 27.3 bits (59),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  3    SLEDIKNETVDLEK  16



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score = 94.7 bits (234),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 64/73 (88%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IP+EEVFEQLKCSREGLTS EG  RLQIFGPNKLEEKKE KLLKFLGFMWNPLSWVM
Sbjct  16   LENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            E AAIMAI LANG
Sbjct  76   EIAAIMAIVLANG  88


 Score = 29.6 bits (65),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLE  349
            I+LEQIKNETVDLE
Sbjct  4    ISLEQIKNETVDLE  17



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score = 94.7 bits (234),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 64/73 (88%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IP+EEVFEQLKCSREGLTS EG  RLQIFGPNKLEEKKE KLLKFLGFMWNPLSWVM
Sbjct  16   LENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            E AAIMAI LANG
Sbjct  76   EIAAIMAIVLANG  88


 Score = 29.6 bits (65),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLE  349
            I+LEQIKNETVDLE
Sbjct  4    ISLEQIKNETVDLE  17



>dbj|BAC77530.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=951

 Score = 96.7 bits (239),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 65/73 (89%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKCSR GL+SDEGA+RLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPVEEVFEQLKCSRAGLSSDEGASRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  76   EAAAIMAIALANG  88


 Score = 27.3 bits (59),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
             I+LE+IKNE VDLE+
Sbjct  3    GISLEEIKNENVDLER  18



>ref|XP_010548606.1| PREDICTED: ATPase 2, plasma membrane-type [Tarenaya hassleriana]
Length=948

 Score = 97.1 bits (240),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 67/74 (91%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGL+S EG  RLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCSREGLSSREGEERLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 27.3 bits (59),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  3    SLEDIKNETVDLEK  16



>ref|XP_006401213.1| hypothetical protein EUTSA_v10015530mg [Eutrema salsugineum]
 gb|ESQ42666.1| hypothetical protein EUTSA_v10015530mg [Eutrema salsugineum]
Length=917

 Score = 95.9 bits (237),  Expect(2) = 7e-20, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF++LKCSREGL+  EG NRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  17   LEKIPIEEVFQELKCSREGLSGAEGENRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  77   EAAAIMAIALANGD  90


 Score = 28.1 bits (61),  Expect(2) = 7e-20, Method: Composition-based stats.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  6    SLEDIKNETVDLEK  19



>ref|XP_010451109.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=918

 Score = 96.3 bits (238),  Expect(2) = 8e-20, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            E AAIMAIALANGD
Sbjct  74   EMAAIMAIALANGD  87


 Score = 27.3 bits (59),  Expect(2) = 8e-20, Method: Composition-based stats.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  3    SLEDIKNETVDLEK  16



>ref|XP_011010708.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=951

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KI +EEVFEQLKC++ GLTSDEGANRLQIFGPNK+EEKKESK LKFLGFMWNPLSWVM
Sbjct  17   LEKILVEEVFEQLKCTKXGLTSDEGANRLQIFGPNKVEEKKESKFLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  77   EAAAIMAIALANGD  90



>gb|KEH39753.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score = 97.4 bits (241),  Expect(2) = 8e-20, Method: Composition-based stats.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +1

Query  334  DC*LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLS  513
            D  L ++PIEEVF+ LKCSR+GLTS+EGA+RLQ+FGPNKLEEK E+K LKFLGFMWNPLS
Sbjct  13   DVNLERVPIEEVFDHLKCSRQGLTSEEGASRLQVFGPNKLEEKSENKFLKFLGFMWNPLS  72

Query  514  WVMEaaaimaialaNGD  564
            WVMEAAAIMAIALANGD
Sbjct  73   WVMEAAAIMAIALANGD  89


 Score = 26.2 bits (56),  Expect(2) = 8e-20, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
            SI LEQ+KNE V+LE+
Sbjct  3    SINLEQMKNEDVNLER  18



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score = 96.3 bits (238),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 66/73 (90%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGLTS EG +R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCSREGLTSQEGEDRIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  74   EAAAIMAIALANG  86


 Score = 27.3 bits (59),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  3    SLEDIKNETVDLEK  16



>ref|XP_010414912.1| PREDICTED: ATPase 1, plasma membrane-type-like isoform X1 [Camelina 
sativa]
Length=980

 Score = 96.7 bits (239),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 26.6 bits (57),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>ref|XP_010489446.1| PREDICTED: ATPase 1, plasma membrane-type [Camelina sativa]
Length=949

 Score = 96.7 bits (239),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 26.9 bits (58),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>ref|XP_006296920.1| hypothetical protein CARUB_v10012913mg [Capsella rubella]
 gb|EOA29818.1| hypothetical protein CARUB_v10012913mg [Capsella rubella]
Length=949

 Score = 96.7 bits (239),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 26.9 bits (58),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>ref|XP_006409094.1| hypothetical protein EUTSA_v10022531mg [Eutrema salsugineum]
 gb|ESQ50547.1| hypothetical protein EUTSA_v10022531mg [Eutrema salsugineum]
Length=949

 Score = 96.3 bits (238),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 26.9 bits (58),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>ref|XP_010467735.1| PREDICTED: ATPase 1, plasma membrane-type-like [Camelina sativa]
Length=949

 Score = 96.7 bits (239),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 26.9 bits (58),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>emb|CDY64741.1| BnaCnng44750D [Brassica napus]
Length=949

 Score = 96.3 bits (238),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 26.9 bits (58),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>dbj|BAJ33915.1| unnamed protein product [Thellungiella halophila]
Length=949

 Score = 96.3 bits (238),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 26.9 bits (58),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>ref|XP_010414918.1| PREDICTED: ATPase 1, plasma membrane-type-like isoform X2 [Camelina 
sativa]
Length=949

 Score = 96.7 bits (239),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 26.6 bits (57),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>ref|XP_009381563.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=960

 Score = 90.1 bits (222),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L K+P+ EVFE LKC++EGLT++EG +RLQIFGPNKLEEK ESK LKFLGFMWNPLSWVM
Sbjct  25   LEKVPVSEVFEHLKCNQEGLTAEEGEDRLQIFGPNKLEEKTESKFLKFLGFMWNPLSWVM  84

Query  523  EaaaimaialaNG  561
            E AAIMAI LANG
Sbjct  85   EIAAIMAIVLANG  97


 Score = 33.1 bits (74),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 14/20 (70%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +2

Query  293  MGDKSITLEQIKNETVDLEK  352
            +G KS++LE IKNE+VDLEK
Sbjct  8    VGTKSVSLEDIKNESVDLEK  27



>ref|XP_009112568.1| PREDICTED: ATPase 1, plasma membrane-type [Brassica rapa]
 emb|CDY30294.1| BnaA09g09830D [Brassica napus]
Length=949

 Score = 96.3 bits (238),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 26.9 bits (58),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score = 95.5 bits (236),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC++EGL++ EGA+RL+IFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTKEGLSTQEGASRLEIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNGD  564
            E+AAIMAIALANGD
Sbjct  79   ESAAIMAIALANGD  92


 Score = 27.7 bits (60),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            K I LE+IKNE VDLE+
Sbjct  5    KGIPLEEIKNENVDLER  21



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score = 97.4 bits (241),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 64/73 (88%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIP+EEVF+QLKC+REGLT++EG NRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  15   LEKIPVEEVFQQLKCTREGLTTEEGENRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  74

Query  523  EaaaimaialaNG  561
            EA AIMAIALANG
Sbjct  75   EAPAIMAIALANG  87


 Score = 25.8 bits (55),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 11/14 (79%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNE VDLEK
Sbjct  4    SLENIKNEAVDLEK  17



>gb|EPS73574.1| hypothetical protein M569_01174, partial [Genlisea aurea]
Length=743

 Score = 91.7 bits (226),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L K+PIEEVFE+L+C+REGL+S+EG  RL IFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKVPIEEVFEKLRCTREGLSSEEGETRLHIFGPNKLEEKKESKILKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 31.6 bits (70),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            +SI+LE+IKNETVDLEK
Sbjct  5    ESISLEEIKNETVDLEK  21



>ref|XP_010103366.1| ATPase 8, plasma membrane-type [Morus notabilis]
 gb|EXB95573.1| ATPase 8, plasma membrane-type [Morus notabilis]
Length=948

 Score = 97.1 bits (240),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+REGLT DEG  RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPIEEVFEQLKCTREGLTKDEGEKRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  E  525
            E
Sbjct  76   E  76


 Score = 25.8 bits (55),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 10/15 (67%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+LE +KNE VDLE+
Sbjct  4    ISLEDVKNENVDLER  18



>ref|XP_009419963.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score = 91.3 bits (225),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVF QLKC+REGLT  EG  RLQIFGPNKLEEK+ESKLLKFLGFMWNPLSWVM
Sbjct  22   LERIPVEEVFAQLKCTREGLTDAEGEQRLQIFGPNKLEEKQESKLLKFLGFMWNPLSWVM  81

Query  523  EaaaimaialaNG  561
            E AAIMAI LANG
Sbjct  82   EIAAIMAIVLANG  94


 Score = 31.6 bits (70),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            G+ +I+LEQIKNE VDLE+
Sbjct  6    GNGTISLEQIKNEAVDLER  24



>ref|XP_011084023.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score = 95.9 bits (237),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVF++LKC+R+GLTSDEGA RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  17   LENIPIEEVFQELKCTRDGLTSDEGAKRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNG  561
            E AAIMAI LANG
Sbjct  77   ELAAIMAIVLANG  89


 Score = 26.9 bits (58),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLE  349
            S++LE I+NETVDLE
Sbjct  4    SMSLEDIRNETVDLE  18



>ref|XP_004487948.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=956

 Score = 95.1 bits (235),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPI+EVFEQLKC+REGL++ EG NR+QIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  21   LERIPIDEVFEQLKCTREGLSTAEGENRIQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  80

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANGD
Sbjct  81   EAAAVMAIALANGD  94


 Score = 27.3 bits (59),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
            S++L+ IKNETVDLE+
Sbjct  8    SLSLDNIKNETVDLER  23



>ref|XP_009381583.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score = 93.6 bits (231),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 52/61 (85%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQL+C++EGLTS+EGANR+QIFG NKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFEQLQCTKEGLTSEEGANRIQIFGQNKLEEKKESKVLKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79


 Score = 29.3 bits (64),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +2

Query  296  GDKSITLEQIKNETVDLEK  352
            GDK+ +LE ++NE VDLE+
Sbjct  3    GDKASSLEDLRNEAVDLER  21



>gb|AAB35314.2| plasma membrane H(+)-ATPase precursor [Vicia faba]
Length=956

 Score = 92.0 bits (227),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF QLKC+REGL+S EG +R+QIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LEKIPIEEVFAQLKCTREGLSSTEGESRIQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAA+MAIALANG
Sbjct  76   EAAAVMAIALANG  88


 Score = 30.4 bits (67),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
            +I+LEQIKNE+VDLEK
Sbjct  3    AISLEQIKNESVDLEK  18



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score = 92.0 bits (227),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVF+QL+C+REGL+S+EG  RLQIFGPNKLEEKKE+KLLKFLGFMWNPLSWVM
Sbjct  18   LERIPVEEVFQQLQCTREGLSSEEGQKRLQIFGPNKLEEKKENKLLKFLGFMWNPLSWVM  77

Query  523  E  525
            E
Sbjct  78   E  78


 Score = 30.8 bits (68),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  293  MGDKSITLEQIKNETVDLEK  352
            M  K+I+LE+IKNE VDLE+
Sbjct  1    MATKNISLEEIKNENVDLER  20



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score = 95.9 bits (237),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK+LKFL FMWNPLSWVM
Sbjct  15   LERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKILKFLLFMWNPLSWVM  74

Query  523  E  525
            E
Sbjct  75   E  75


 Score = 26.9 bits (58),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE+IKNETVDLE+
Sbjct  5    LEEIKNETVDLER  17



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 67/73 (92%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIP+EEVFE LKCSR GLTSDEGA+RLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  16   LEKIPVEEVFESLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  76   EAAAIMAIALANG  88



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 67/73 (92%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIP+EEVFE LKCSR GLTSDEGA+RLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  16   LEKIPVEEVFESLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  76   EAAAIMAIALANG  88



>ref|XP_010539421.1| PREDICTED: ATPase 2, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=950

 Score = 97.1 bits (240),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIP+EEVF+QLKC+REGLT++EG NRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  15   LEKIPVEEVFQQLKCTREGLTTEEGENRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  74

Query  523  E  525
            E
Sbjct  75   E  75


 Score = 25.8 bits (55),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 11/14 (79%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNE VDLEK
Sbjct  4    SLENIKNEAVDLEK  17



>ref|XP_009386906.1| PREDICTED: ATPase 3, plasma membrane-type-like [Musa acuminata 
subsp. malaccensis]
Length=180

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  349  KIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVMEa  528
            +IP++EVFEQLKC+REGL+S EGANRLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVME 
Sbjct  39   QIPVDEVFEQLKCTREGLSSAEGANRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVMEM  98

Query  529  aaimaialaNG  561
            AA+MAIALANG
Sbjct  99   AAVMAIALANG  109



>ref|XP_004138879.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=1038

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 64/70 (91%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +1

Query  352  IPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVMEaa  531
            IPIEEVFEQLKC+REGLTS+EGA+RLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVMEAA
Sbjct  106  IPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVMEAA  165

Query  532  aimaialaNG  561
            A+MAI LANG
Sbjct  166  ALMAIVLANG  175



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score = 92.8 bits (229),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IP++EVFEQLKCSREGLTS +G  RLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  16   LENIPVDEVFEQLKCSREGLTSADGEQRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            E AAIMAI LANG
Sbjct  76   EIAAIMAIVLANG  88


 Score = 29.6 bits (65),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLE  349
            I+LEQIKNETVDLE
Sbjct  4    ISLEQIKNETVDLE  17



>gb|KHM99449.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=940

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 65/71 (92%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  349  KIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVMEa  528
            +IPIEEVFEQLKCSR GLTS+EG NRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVMEA
Sbjct  7    RIPIEEVFEQLKCSRAGLTSEEGGNRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVMEA  66

Query  529  aaimaialaNG  561
            AAIMAIALANG
Sbjct  67   AAIMAIALANG  77



>ref|XP_007012006.1| H(+)-ATPase 8 [Theobroma cacao]
 gb|EOY29625.1| H(+)-ATPase 8 [Theobroma cacao]
Length=951

 Score = 92.0 bits (227),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+REGLT+ EG  RL+IFGPNKLEEKKE K LKFLGFMWNPLSWVM
Sbjct  19   LERIPVEEVFEQLKCTREGLTTAEGEKRLEIFGPNKLEEKKECKFLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            EAAAIMAI LANG
Sbjct  79   EAAAIMAIVLANG  91


 Score = 30.4 bits (67),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            D   +LEQIKNETVDLE+
Sbjct  4    DGDTSLEQIKNETVDLER  21



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score = 93.2 bits (230),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFE LKCS+EGL+S+EG  RLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LERIPIEEVFELLKCSKEGLSSEEGEQRLQIFGPNKLEEKKESKVLKFLGFMWNPLSWVM  78

Query  523  EaaaimaialaNG  561
            E AA+MAI LANG
Sbjct  79   EVAALMAIVLANG  91


 Score = 28.9 bits (63),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +2

Query  302  KSITLEQIKNETVDLEK  352
            K+I+LE+IKNE +DLE+
Sbjct  5    KAISLEEIKNEAIDLER  21



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 67/73 (92%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIP+EEVFE LKCS  GLTSDEGANRLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  16   LEKIPVEEVFESLKCSTAGLTSDEGANRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  76   EAAAIMAIALANG  88



>ref|XP_006652940.1| PREDICTED: plasma membrane ATPase-like [Oryza brachyantha]
Length=951

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVFEQLKC+REGLTSDEGA R+++FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LENIPIEEVFEQLKCTREGLTSDEGARRIEVFGPNKLEEKKESKVLKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNG  561
            E AAIMAIALANG
Sbjct  74   EMAAIMAIALANG  86



>gb|KFK29576.1| h(+)-atpase 2 [Arabis alpina]
Length=948

 Score = 94.4 bits (233),  Expect(2) = 3e-19, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGLT+ EG +R+ IFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCSREGLTTQEGEDRIVIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 27.3 bits (59),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  3    SLEDIKNETVDLEK  16



>ref|XP_004508383.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X1 [Cicer 
arietinum]
Length=949

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVF+QLKCSREGLTS EG NRLQIFGPNKLEEK ESK LKFLGFMWNPLSWVM
Sbjct  17   LENIPIEEVFKQLKCSREGLTSAEGENRLQIFGPNKLEEKTESKFLKFLGFMWNPLSWVM  76

Query  523  E  525
            E
Sbjct  77   E  77



>gb|ABR18001.1| unknown [Picea sitchensis]
Length=955

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQL+C+REGLTS+EG NRLQIFG NKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  21   LERIPIEEVFEQLRCTREGLTSNEGENRLQIFGFNKLEEKKESKFLKFLGFMWNPLSWVM  80

Query  523  EaaaimaialaNGD  564
            E AAIMAIALANGD
Sbjct  81   EIAAIMAIALANGD  94



>emb|CDX82608.1| BnaC07g02580D [Brassica napus]
Length=949

 Score = 94.7 bits (234),  Expect(2) = 3e-19, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG  R+Q+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEERIQLFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 26.9 bits (58),  Expect(2) = 3e-19, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>ref|XP_011084026.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score = 94.0 bits (232),  Expect(2) = 3e-19, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVF++LKCSR+GLTSDEGA RLQIFG NKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  17   LENIPIEEVFQELKCSRDGLTSDEGAKRLQIFGANKLEEKKESKFLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNG  561
            E AAIMAI LANG
Sbjct  77   ELAAIMAIVLANG  89


 Score = 27.7 bits (60),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLE  349
            S++LE IKNETVDLE
Sbjct  4    SLSLEDIKNETVDLE  18



>ref|XP_004508384.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X2 [Cicer 
arietinum]
Length=865

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVF+QLKCSREGLTS EG NRLQIFGPNKLEEK ESK LKFLGFMWNPLSWVM
Sbjct  17   LENIPIEEVFKQLKCSREGLTSAEGENRLQIFGPNKLEEKTESKFLKFLGFMWNPLSWVM  76

Query  523  E  525
            E
Sbjct  77   E  77



>ref|XP_011084025.1| PREDICTED: ATPase 8, plasma membrane-type [Sesamum indicum]
Length=949

 Score = 94.0 bits (232),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVF++LKCSR+GLTSDEGA RLQIFG NKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  17   LENIPIEEVFQELKCSRDGLTSDEGAKRLQIFGANKLEEKKESKFLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNG  561
            E AAIMAI LANG
Sbjct  77   ELAAIMAIVLANG  89


 Score = 27.3 bits (59),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLE  349
            +I+LE IKNETVDLE
Sbjct  4    NISLEDIKNETVDLE  18



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score = 94.4 bits (233),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+R+GLT++EG  RLQIFGPNKLEEK+ESKLLKFLGFMWNPLSWVM
Sbjct  15   LERIPVEEVFEQLKCTRDGLTTEEGEKRLQIFGPNKLEEKEESKLLKFLGFMWNPLSWVM  74

Query  523  EaaaimaialaNG  561
            EAAAIMAI LANG
Sbjct  75   EAAAIMAIVLANG  87


 Score = 26.9 bits (58),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE+IKNETVDLE+
Sbjct  5    LEEIKNETVDLER  17



>gb|EYU25317.1| hypothetical protein MIMGU_mgv1a000893mg [Erythranthe guttata]
Length=949

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVF QLKCS+EGLTSDEGA RL+IFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  15   LETIPIEEVFTQLKCSKEGLTSDEGAKRLEIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  74

Query  523  EaaaimaialaNG  561
            E+AAIMAI LANG
Sbjct  75   ESAAIMAIVLANG  87



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score = 90.5 bits (223),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVF QLKC++EGLT+ EG  RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  17   LERIPVEEVFTQLKCTKEGLTTAEGEQRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNG  561
            E AAIMAI LANG
Sbjct  77   EIAAIMAIVLANG  89


 Score = 30.8 bits (68),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
            SI+LE+IKNETVDLE+
Sbjct  4    SISLEEIKNETVDLER  19



>ref|XP_009102205.1| PREDICTED: ATPase 1, plasma membrane-type [Brassica rapa]
Length=949

 Score = 94.4 bits (233),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG  R+Q+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEERIQLFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 26.9 bits (58),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>ref|XP_009128001.1| PREDICTED: ATPase 2, plasma membrane-type [Brassica rapa]
 emb|CDY28167.1| BnaA01g06820D [Brassica napus]
Length=948

 Score = 94.0 bits (232),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC++EGLT+ EG  R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTKEGLTTQEGEERIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 27.3 bits (59),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  3    SLEDIKNETVDLEK  16



>ref|XP_009398632.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=952

 Score = 90.5 bits (223),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L ++PIEEVFEQLKC+++GLT+ EG  RLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  17   LERVPIEEVFEQLKCTKDGLTTGEGDKRLQIFGPNKLEEKKESKVLKFLGFMWNPLSWVM  76

Query  523  E  525
            E
Sbjct  77   E  77


 Score = 30.4 bits (67),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = +2

Query  299  DKSITLEQIKNETVDLEK  352
            D +I+LE IKNETVDLE+
Sbjct  2    DGNISLEAIKNETVDLER  19



>emb|CDY67153.1| BnaAnng23670D [Brassica napus]
Length=918

 Score = 94.0 bits (232),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC++EGLT+ EG  R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTKEGLTTQEGEERIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  74   EAAAIMAIALANGD  87


 Score = 26.9 bits (58),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE IKNETVDLEK
Sbjct  3    SLEDIKNETVDLEK  16



>ref|XP_009109000.1| PREDICTED: ATPase 2, plasma membrane-type [Brassica rapa]
Length=947

 Score = 93.6 bits (231),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 64/74 (86%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QL C+REGLT+ EG  R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  13   LEKIPIEEVFQQLNCTREGLTTQEGEERIQIFGPNKLEEKKESKILKFLGFMWNPLSWVM  72

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  73   EAAAIMAIALANGD  86


 Score = 27.7 bits (60),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            ++LE IKNETVDLEK
Sbjct  1    MSLEDIKNETVDLEK  15



>gb|KEH32174.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=948

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVF+QLKC+REGLTS EG NRLQIFGPNKLEEK ESKLLKFLGFMWNPLSWVM
Sbjct  17   LENIPIEEVFKQLKCTREGLTSAEGENRLQIFGPNKLEEKTESKLLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNG  561
            E AA+MAI LANG
Sbjct  77   EVAALMAIGLANG  89



>gb|AHK23067.1| plasma membrane ATPase 4 [Fagopyrum tataricum]
Length=965

 Score = 93.6 bits (231),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVFEQLKCSREGL+++EG +RL IFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  18   LEHIPIEEVFEQLKCSREGLSAEEGDSRLAIFGPNKLEEKKESKILKFLGFMWNPLSWVM  77

Query  523  EaaaimaialaNGD  564
            EAAAIMAIALANGD
Sbjct  78   EAAAIMAIALANGD  91


 Score = 27.3 bits (59),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 0/20 (0%)
 Frame = +2

Query  293  MGDKSITLEQIKNETVDLEK  352
            M  K + LE IKNE VDLE 
Sbjct  1    MAAKGLNLEDIKNEAVDLEH  20



>ref|XP_010545412.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=957

 Score = 94.4 bits (233),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 52/61 (85%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIP+EEVF+QLKC++EGLT+ EG NRLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  22   LEKIPVEEVFQQLKCTKEGLTTAEGENRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  81

Query  523  E  525
            E
Sbjct  82   E  82


 Score = 26.6 bits (57),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = +2

Query  311  TLEQIKNETVDLEK  352
            +LE I+NETVDLEK
Sbjct  11   SLEDIRNETVDLEK  24



>ref|XP_010525721.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGLT+ EG +RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCSREGLTTREGEDRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  73

Query  523  E  525
            E
Sbjct  74   E  74



>ref|XP_011084027.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score = 94.0 bits (232),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVF++LKCSR+GLTSDEGA RLQIFG NKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  17   LENIPIEEVFQELKCSRDGLTSDEGAKRLQIFGANKLEEKKESKFLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNG  561
            E AAIMAI LANG
Sbjct  77   ELAAIMAIVLANG  89


 Score = 26.6 bits (57),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLE  349
            +I+LE I+NETVDLE
Sbjct  4    NISLEDIRNETVDLE  18



>ref|NP_200545.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 ref|NP_001190559.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 sp|P20431.2|PMA3_ARATH RecName: Full=ATPase 3, plasma membrane-type; AltName: Full=Proton 
pump 3 [Arabidopsis thaliana]
 gb|AAA32750.1| ATPase [Arabidopsis thaliana]
 dbj|BAB09963.1| plasma membrane ATPase 3 [Arabidopsis thaliana]
 gb|AAL59975.1| putative plasma membrane proton pump ATPase 3 [Arabidopsis thaliana]
 gb|AED96889.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 gb|AED96890.1| H(+)-ATPase 3 [Arabidopsis thaliana]
Length=949

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  15   LEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  74

Query  523  E  525
            E
Sbjct  75   E  75



>gb|AAL09726.1| AT5g57350/MJB24_16 [Arabidopsis thaliana]
Length=949

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  15   LEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  74

Query  523  E  525
            E
Sbjct  75   E  75



>ref|XP_010483247.1| PREDICTED: ATPase 3, plasma membrane-type-like [Camelina sativa]
Length=949

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  15   LEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  74

Query  523  E  525
            E
Sbjct  75   E  75



>ref|XP_010443420.1| PREDICTED: ATPase 3, plasma membrane-type [Camelina sativa]
Length=949

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  15   LEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  74

Query  523  E  525
            E
Sbjct  75   E  75



>ref|XP_010452018.1| PREDICTED: ATPase 3, plasma membrane-type [Camelina sativa]
Length=949

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  15   LEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  74

Query  523  E  525
            E
Sbjct  75   E  75



>ref|XP_002523524.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF38863.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=747

 Score = 91.3 bits (225),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC++EGLT+ EG  RL+IFGPNKLEEKKE K LKFLGFMWNPLSWVM
Sbjct  16   LEKIPIEEVFQQLKCTKEGLTTAEGEKRLEIFGPNKLEEKKECKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            E+AAIMAI LANG
Sbjct  76   ESAAIMAIVLANG  88


 Score = 29.3 bits (64),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+LE+IKNET+DLEK
Sbjct  4    ISLEEIKNETIDLEK  18



>ref|XP_010533093.1| PREDICTED: ATPase 6, plasma membrane-type [Tarenaya hassleriana]
Length=949

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 64/73 (88%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKCSREGL+S+EG  RLQIFGPNKLEEK E+K LKFLGFMWNPLSWVM
Sbjct  17   LEKIPIEEVFQQLKCSREGLSSEEGRKRLQIFGPNKLEEKTENKFLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  77   EAAAIMAIALANG  89



>gb|KGN52915.1| hypothetical protein Csa_4G006220 [Cucumis sativus]
Length=890

 Score = 94.7 bits (234),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKCSREGL+S+EG  RLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAI LANG
Sbjct  76   EAAAIMAIVLANG  88


 Score = 25.8 bits (55),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 9/15 (60%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+L++IKNE +DLE+
Sbjct  4    ISLQEIKNENIDLER  18



>ref|XP_007023381.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26003.1| H(+)-ATPase 9 [Theobroma cacao]
Length=953

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC++EGLTS+EG  RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  18   LERIPIEEVFEQLKCTKEGLTSEEGHKRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  77

Query  523  E  525
            E
Sbjct  78   E  78



>ref|XP_009136182.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 6, plasma membrane-type 
[Brassica rapa]
Length=980

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIP++EVF+QLKCSREGL+S+EG NRLQIFG NKLEEK E+K LKFLGFMWNPLSWVM
Sbjct  17   LEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAAIMAI LANGD
Sbjct  77   EAAAIMAIVLANGD  90



>gb|AAA32813.1| plasma membrane proton pump H+ ATPase [Arabidopsis thaliana]
Length=949

 Score = 93.6 bits (231),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG +R+ IFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEDRIVIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANGD
Sbjct  74   EAAALMAIALANGD  87


 Score = 26.9 bits (58),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>ref|NP_179486.1| H(+)-ATPase 1 [Arabidopsis thaliana]
 sp|P20649.3|PMA1_ARATH RecName: Full=ATPase 1, plasma membrane-type; AltName: Full=Proton 
pump 1 [Arabidopsis thaliana]
 gb|AAC09030.1| plasma membrane proton ATPase (PMA) [Arabidopsis thaliana]
 gb|AAP40498.1| putative plasma membrane proton ATPase (PMA) [Arabidopsis thaliana]
 gb|AEC06832.1| H(+)-ATPase 1 [Arabidopsis thaliana]
Length=949

 Score = 93.6 bits (231),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG +R+ IFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEDRIVIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAA+MAIALANGD
Sbjct  74   EAAALMAIALANGD  87


 Score = 26.9 bits (58),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>ref|XP_006396088.1| hypothetical protein EUTSA_v10002390mg [Eutrema salsugineum]
 gb|ESQ36867.1| hypothetical protein EUTSA_v10002390mg [Eutrema salsugineum]
Length=949

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIP++EVF+QLKCSREGL+S+EG NRLQIFG NKLEEKKE+K+LKFLGFMWNPLSWVM
Sbjct  17   LEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKKENKVLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAAIMAI LANGD
Sbjct  77   EAAAIMAIVLANGD  90



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score = 94.7 bits (234),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKCSREGL+S+EG  RLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAI LANG
Sbjct  76   EAAAIMAIVLANG  88


 Score = 25.4 bits (54),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 9/15 (60%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+L++IKNE +DLE+
Sbjct  4    ISLQEIKNENIDLER  18



>emb|CDX93092.1| BnaA03g38140D [Brassica napus]
Length=949

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIP++EVF+QLKCSREGL+S+EG NRLQIFG NKLEEK E+K LKFLGFMWNPLSWVM
Sbjct  17   LEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAAIMAI LANGD
Sbjct  77   EAAAIMAIVLANGD  90



>emb|CDY50939.1| BnaC03g74390D [Brassica napus]
Length=949

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIP++EVF+QLKCSREGL+S+EG NRLQIFG NKLEEK E+K LKFLGFMWNPLSWVM
Sbjct  17   LEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAAIMAI LANGD
Sbjct  77   EAAAIMAIVLANGD  90



>gb|KFK39922.1| hypothetical protein AALP_AA3G306500 [Arabis alpina]
Length=949

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIP++EVF+QLKCSREGL+S+EG NRLQIFG NKLEEK E+K LKFLGFMWNPLSWVM
Sbjct  17   LEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNGD  564
            EAAAIMAI LANGD
Sbjct  77   EAAAIMAIVLANGD  90



>gb|KFK40274.1| hypothetical protein AALP_AA3G353600 [Arabis alpina]
Length=949

 Score = 93.6 bits (231),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGLT+ EG  R+ IFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LEKIPIEEVFQQLKCTREGLTTQEGEERIVIFGPNKLEEKKESKVLKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNGD  564
            EAAAIMAI LANGD
Sbjct  74   EAAAIMAIVLANGD  87


 Score = 26.9 bits (58),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = +2

Query  314  LEQIKNETVDLEK  352
            LE IKNETVDLEK
Sbjct  4    LEDIKNETVDLEK  16



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score = 94.7 bits (234),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKCSREGL+S+EG  RLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAI LANG
Sbjct  76   EAAAIMAIVLANG  88


 Score = 25.4 bits (54),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 9/15 (60%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+L++IKNE +DLE+
Sbjct  4    ISLQEIKNENIDLER  18



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score = 94.7 bits (234),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKCSREGL+S+EG  RLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            EAAAIMAI LANG
Sbjct  76   EAAAIMAIVLANG  88


 Score = 25.4 bits (54),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 9/15 (60%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            I+L++IKNE +DLE+
Sbjct  4    ISLQEIKNENIDLER  18



>ref|XP_008443886.1| PREDICTED: ATPase 8, plasma membrane-type [Cucumis melo]
Length=948

 Score = 92.8 bits (229),  Expect(2) = 8e-19, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC++EGLT+ EG  RLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  16   LERIPIEEVFEQLKCTKEGLTTAEGEKRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            E+AAIMAI LANG
Sbjct  76   ESAAIMAIVLANG  88


 Score = 27.3 bits (59),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 2/20 (10%)
 Frame = +2

Query  293  MGDKSITLEQIKNETVDLEK  352
            MGD  I+LE +KNE +DLE+
Sbjct  1    MGD--ISLEDVKNENIDLER  18



>emb|CDP14278.1| unnamed protein product [Coffea canephora]
Length=1297

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVF+QLKCSREGL+ +EGA RLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  17   LENIPIEEVFKQLKCSREGLSEEEGAKRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  76

Query  523  E  525
            E
Sbjct  77   E  77



>gb|ABO15469.2| plasma membrane H+-ATPase LilHA2 [Lilium longiflorum]
Length=954

 Score = 89.0 bits (219),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP++EVF QLKC++EGLT+ EG  RLQIFGPNKLEEK ESK LKFLGFMWNPLSWVM
Sbjct  20   LERIPVDEVFAQLKCTKEGLTAAEGEKRLQIFGPNKLEEKTESKFLKFLGFMWNPLSWVM  79

Query  523  EaaaimaialaNG  561
            E AAIMAI +ANG
Sbjct  80   EIAAIMAIVMANG  92


 Score = 30.8 bits (68),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
            SI+LE+IKNETVDLE+
Sbjct  7    SISLEEIKNETVDLER  22



>ref|XP_006282289.1| hypothetical protein CARUB_v10028575mg [Capsella rubella]
 gb|EOA15187.1| hypothetical protein CARUB_v10028575mg [Capsella rubella]
Length=949

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF+QLKC+REGL+  EG NRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM
Sbjct  15   LEKIPIEEVFQQLKCTREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLGFMWNPLSWVM  74

Query  523  E  525
            E
Sbjct  75   E  75



>ref|XP_008367709.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=956

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  337  C*LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSW  516
            C   +IP+EEVFEQLKC++EGLT +EGA+RLQ+FGPNKLEEKKESKLLKFLGFMWNPLSW
Sbjct  19   CSQERIPVEEVFEQLKCTKEGLTGEEGASRLQVFGPNKLEEKKESKLLKFLGFMWNPLSW  78

Query  517  VME  525
            VME
Sbjct  79   VME  81



>ref|XP_009104474.1| PREDICTED: ATPase 9, plasma membrane-type [Brassica rapa]
Length=954

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPIEEVF QL+C+REGLTSDEG  RL+IFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  19   LEKIPIEEVFTQLRCTREGLTSDEGHTRLEIFGPNKLEEKKESKVLKFLGFMWNPLSWVM  78

Query  523  E  525
            E
Sbjct  79   E  79



>ref|XP_008456775.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis melo]
Length=923

 Score = 94.0 bits (232),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+R GL+SDEG  RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPIEEVFEQLKCNRNGLSSDEGEKRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  E  525
            E
Sbjct  76   E  76


 Score = 25.4 bits (54),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +2

Query  305  SITLEQIKNETVDLEK  352
            +I+LE ++NE VDLE+
Sbjct  3    NISLEDVRNENVDLER  18



>ref|XP_004960134.1| PREDICTED: plasma membrane ATPase-like [Setaria italica]
Length=951

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L  IPIEEVFEQLKC+REGL+S+EGA RL+IFGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  14   LENIPIEEVFEQLKCTREGLSSNEGAQRLEIFGPNKLEEKKESKILKFLGFMWNPLSWVM  73

Query  523  EaaaimaialaNG  561
            E AAIMAIALANG
Sbjct  74   EMAAIMAIALANG  86



>ref|XP_004139271.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=923

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+R GL+SDEG  RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPIEEVFEQLKCNRNGLSSDEGEKRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  E  525
            E
Sbjct  76   E  76



>gb|KFK33846.1| hypothetical protein AALP_AA5G067500 [Arabis alpina]
Length=948

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKCS+EGL+SDEG  RL+IFGPNKLEEK E+K LKFLGFMWNPLSWVM
Sbjct  17   LERIPVEEVFEQLKCSKEGLSSDEGNKRLEIFGPNKLEEKSENKFLKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNG  561
            E+AAIMAI LANG
Sbjct  77   ESAAIMAIVLANG  89



>ref|XP_010049874.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=942

 Score = 88.6 bits (218),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+REGL++ EG  RLQIFG NKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  18   LERIPVEEVFEQLKCTREGLSTTEGGRRLQIFGLNKLEEKKESKFLKFLGFMWNPLSWVM  77

Query  523  EaaaimaialaNG  561
            EAAA+MAIALANG
Sbjct  78   EAAAVMAIALANG  90


 Score = 30.4 bits (67),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +2

Query  293  MGDKSITLEQIKNETVDLEK  352
            M    I+LEQIKNE++DLE+
Sbjct  1    MASGDISLEQIKNESIDLER  20



>ref|XP_010049873.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW82682.1| hypothetical protein EUGRSUZ_C04061 [Eucalyptus grandis]
Length=951

 Score = 88.6 bits (218),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+EEVFEQLKC+REGL++ EG  RLQIFG NKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  18   LERIPVEEVFEQLKCTREGLSTTEGGRRLQIFGLNKLEEKKESKFLKFLGFMWNPLSWVM  77

Query  523  EaaaimaialaNG  561
            EAAA+MAIALANG
Sbjct  78   EAAAVMAIALANG  90


 Score = 30.4 bits (67),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +2

Query  293  MGDKSITLEQIKNETVDLEK  352
            M    I+LEQIKNE++DLE+
Sbjct  1    MASGDISLEQIKNESIDLER  20



>ref|XP_004146327.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=953

 Score = 90.5 bits (223),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPI EVFEQLKC  EGLT+ EG NRLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  17   LEKIPIAEVFEQLKCGPEGLTTQEGENRLQLFGPNKLEEKKESKILKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  77   EAAAIMAIALANG  89


 Score = 28.5 bits (62),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            ++LE+IKNETVDLEK
Sbjct  5    LSLEEIKNETVDLEK  19



>ref|XP_004161788.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=953

 Score = 90.5 bits (223),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPI EVFEQLKC  EGLT+ EG NRLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  17   LEKIPIAEVFEQLKCGPEGLTTQEGENRLQLFGPNKLEEKKESKILKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  77   EAAAIMAIALANG  89


 Score = 28.5 bits (62),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            ++LE+IKNETVDLEK
Sbjct  5    LSLEEIKNETVDLEK  19



>gb|ABW25091.1| plasma membrane proton pump [Cucumis sativus]
Length=953

 Score = 90.1 bits (222),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L KIPI EVFEQLKC  EGLT+ EG NRLQ+FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  17   LEKIPIAEVFEQLKCGPEGLTTQEGENRLQLFGPNKLEEKKESKILKFLGFMWNPLSWVM  76

Query  523  EaaaimaialaNG  561
            EAAAIMAIALANG
Sbjct  77   EAAAIMAIALANG  89


 Score = 28.5 bits (62),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +2

Query  308  ITLEQIKNETVDLEK  352
            ++LE+IKNETVDLEK
Sbjct  5    LSLEEIKNETVDLEK  19



>gb|KDP38637.1| hypothetical protein JCGZ_03990 [Jatropha curcas]
Length=930

 Score = 88.6 bits (218),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IP+E+VF+QLKC++EGLT+ EG  RL+IFGPNKLEEKKE+K LKFLGFMWNPLSWVM
Sbjct  16   LERIPVEQVFQQLKCTKEGLTTAEGEKRLKIFGPNKLEEKKENKFLKFLGFMWNPLSWVM  75

Query  523  EaaaimaialaNG  561
            E+AAIMAI LANG
Sbjct  76   ESAAIMAIVLANG  88


 Score = 30.0 bits (66),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 14/20 (70%), Positives = 17/20 (85%), Gaps = 2/20 (10%)
 Frame = +2

Query  293  MGDKSITLEQIKNETVDLEK  352
            MGD  I++EQIKNE VDLE+
Sbjct  1    MGD--ISMEQIKNENVDLER  18



>gb|KGN60742.1| hypothetical protein Csa_2G009310 [Cucumis sativus]
Length=814

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  343  LGKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  522
            L +IPIEEVFEQLKC+R GL+SDEG  RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  16   LERIPIEEVFEQLKCNRNGLSSDEGEKRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVM  75

Query  523  E  525
            E
Sbjct  76   E  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920