BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF019E18

Length=545
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006345079.1|  PREDICTED: serine/threonine-protein kinase 1...    265   2e-84   Solanum tuberosum [potatoes]
ref|XP_004236087.1|  PREDICTED: probable serine/threonine-protein...    261   2e-83   Solanum lycopersicum
ref|XP_004241617.1|  PREDICTED: probable serine/threonine-protein...    256   4e-81   Solanum lycopersicum
ref|XP_011072928.1|  PREDICTED: probable serine/threonine-protein...    255   6e-81   Sesamum indicum [beniseed]
ref|XP_009766540.1|  PREDICTED: probable serine/threonine-protein...    254   2e-80   Nicotiana sylvestris
ref|XP_009607782.1|  PREDICTED: probable serine/threonine-protein...    252   9e-80   Nicotiana tomentosiformis
gb|EYU19016.1|  hypothetical protein MIMGU_mgv1a009372mg                252   9e-80   Erythranthe guttata [common monkey flower]
gb|EPS69990.1|  hypothetical protein M569_04770                         251   3e-79   Genlisea aurea
ref|XP_008356645.1|  PREDICTED: serine/threonine-protein kinase 1...    249   2e-78   Malus domestica [apple tree]
ref|XP_009337751.1|  PREDICTED: serine/threonine-protein kinase 1...    249   2e-78   Pyrus x bretschneideri [bai li]
ref|XP_006354740.1|  PREDICTED: serine/threonine-protein kinase 1...    248   3e-78   Solanum tuberosum [potatoes]
ref|XP_008351873.1|  PREDICTED: serine/threonine-protein kinase 1...    246   4e-78   
gb|KHG15042.1|  Serine/threonine-protein kinase 16                      247   1e-77   Gossypium arboreum [tree cotton]
gb|KJB06908.1|  hypothetical protein B456_001G066000                    247   1e-77   Gossypium raimondii
ref|XP_010678394.1|  PREDICTED: probable serine/threonine-protein...    246   3e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008360890.1|  PREDICTED: serine/threonine-protein kinase 1...    245   9e-77   
ref|XP_008367568.1|  PREDICTED: serine/threonine-protein kinase 1...    244   9e-77   
gb|AFK34971.1|  unknown                                                 238   2e-76   Lotus japonicus
gb|KJB19472.1|  hypothetical protein B456_003G104700                    240   2e-76   Gossypium raimondii
gb|AFK43523.1|  unknown                                                 238   6e-76   Lotus japonicus
ref|XP_009597332.1|  PREDICTED: serine/threonine-protein kinase 1...    242   7e-76   Nicotiana tomentosiformis
ref|XP_009346448.1|  PREDICTED: serine/threonine-protein kinase 1...    242   8e-76   Pyrus x bretschneideri [bai li]
gb|KJB19471.1|  hypothetical protein B456_003G104700                    239   9e-76   Gossypium raimondii
gb|KJB19474.1|  hypothetical protein B456_003G104700                    239   2e-75   Gossypium raimondii
ref|XP_008453331.1|  PREDICTED: serine/threonine-protein kinase 1...    239   2e-75   Cucumis melo [Oriental melon]
ref|XP_007155191.1|  hypothetical protein PHAVU_003G181000g             241   2e-75   Phaseolus vulgaris [French bean]
ref|XP_010099029.1|  Serine/threonine-protein kinase 16                 241   3e-75   Morus notabilis
ref|XP_007037718.1|  Serine/threonine protein kinase 3 isoform 2        238   4e-75   
ref|XP_008453330.1|  PREDICTED: serine/threonine-protein kinase 1...    239   5e-75   Cucumis melo [Oriental melon]
gb|KDO65614.1|  hypothetical protein CISIN_1g024842mg                   238   5e-75   Citrus sinensis [apfelsine]
ref|XP_007037719.1|  Serine/threonine protein kinase 3 isoform 3        238   7e-75   
ref|XP_004299264.1|  PREDICTED: serine/threonine-protein kinase 16      240   7e-75   Fragaria vesca subsp. vesca
ref|XP_010031327.1|  PREDICTED: serine/threonine-protein kinase 16      240   7e-75   Eucalyptus grandis [rose gum]
ref|XP_006440851.1|  hypothetical protein CICLE_v10021674mg             237   9e-75   
emb|CDO98513.1|  unnamed protein product                                239   1e-74   Coffea canephora [robusta coffee]
gb|ACU19230.1|  unknown                                                 235   1e-74   Glycine max [soybeans]
gb|KJB19470.1|  hypothetical protein B456_003G104700                    239   2e-74   Gossypium raimondii
ref|XP_008453329.1|  PREDICTED: serine/threonine-protein kinase 1...    238   3e-74   Cucumis melo [Oriental melon]
emb|CDY21515.1|  BnaC09g47770D                                          238   4e-74   Brassica napus [oilseed rape]
ref|XP_002512018.1|  serine/threonine protein kinase, putative          238   4e-74   Ricinus communis
ref|XP_007037717.1|  Serine/threonine protein kinase 3 isoform 1        238   5e-74   
ref|XP_003609185.1|  Serine/threonine protein kinase                    238   5e-74   Medicago truncatula
ref|XP_007209310.1|  hypothetical protein PRUPE_ppa008104mg             238   6e-74   Prunus persica
ref|XP_009798655.1|  PREDICTED: serine/threonine-protein kinase 1...    237   8e-74   Nicotiana sylvestris
ref|XP_006485732.1|  PREDICTED: serine/threonine-protein kinase 1...    237   8e-74   Citrus sinensis [apfelsine]
ref|XP_008240053.1|  PREDICTED: serine/threonine-protein kinase 16      237   9e-74   Prunus mume [ume]
ref|XP_003524500.1|  PREDICTED: probable serine/threonine-protein...    237   1e-73   Glycine max [soybeans]
ref|XP_004508637.1|  PREDICTED: serine/threonine-protein kinase 1...    236   2e-73   Cicer arietinum [garbanzo]
ref|XP_004138208.1|  PREDICTED: probable serine/threonine-protein...    236   2e-73   Cucumis sativus [cucumbers]
dbj|BAJ53163.1|  JHL10I11.9                                             236   3e-73   Jatropha curcas
ref|XP_006844169.1|  hypothetical protein AMTR_s00006p00262500          235   4e-73   Amborella trichopoda
ref|NP_196433.1|  serine/threonine protein kinase 3                     235   4e-73   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65833.1|  serine/threonine protein kinase                         235   5e-73   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69971.1|  BnaA10g23200D                                          235   5e-73   
ref|XP_006399302.1|  hypothetical protein EUTSA_v10013995mg             235   6e-73   Eutrema salsugineum [saltwater cress]
ref|XP_010423128.1|  PREDICTED: probable serine/threonine-protein...    235   7e-73   Camelina sativa [gold-of-pleasure]
gb|KFK25181.1|  hypothetical protein AALP_AA8G077200                    235   7e-73   Arabis alpina [alpine rockcress]
ref|XP_006600612.1|  PREDICTED: serine/threonine-protein kinase 16      234   8e-73   Glycine max [soybeans]
ref|XP_006288089.1|  hypothetical protein CARUB_v10001319mg             234   9e-73   Capsella rubella
ref|XP_010522295.1|  PREDICTED: serine/threonine-protein kinase 1...    234   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_002873344.1|  hypothetical protein ARALYDRAFT_487651             234   2e-72   
gb|EPS73700.1|  hypothetical protein M569_01056                         233   4e-72   Genlisea aurea
ref|XP_009131040.1|  PREDICTED: probable serine/threonine-protein...    233   5e-72   Brassica rapa
emb|CDY67889.1|  BnaAnng25480D                                          231   2e-71   Brassica napus [oilseed rape]
gb|KJB51100.1|  hypothetical protein B456_008G201200                    231   2e-71   Gossypium raimondii
gb|AIZ68208.1|  Serine/threonine-protein kinase 16                      231   2e-71   Ornithogalum longebracteatum [sea-onion]
ref|XP_002269355.1|  PREDICTED: serine/threonine-protein kinase 16      231   2e-71   Vitis vinifera
ref|XP_010491440.1|  PREDICTED: probable serine/threonine-protein...    231   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_002317918.2|  hypothetical protein POPTR_0012s05390g             229   9e-71   
ref|XP_010452793.1|  PREDICTED: probable serine/threonine-protein...    229   2e-70   Camelina sativa [gold-of-pleasure]
emb|CDY70989.1|  BnaC03g71390D                                          228   2e-70   Brassica napus [oilseed rape]
emb|CAN66918.1|  hypothetical protein VITISV_043041                     228   2e-70   Vitis vinifera
gb|AAZ39949.1|  serine/threonine protein kinase                         228   3e-70   Gossypium hirsutum [American cotton]
ref|XP_009396202.1|  PREDICTED: probable serine/threonine-protein...    228   3e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006374373.1|  hypothetical protein POPTR_0015s06550g             228   4e-70   Populus trichocarpa [western balsam poplar]
gb|ABK92466.1|  unknown                                                 228   5e-70   Populus trichocarpa [western balsam poplar]
ref|XP_010261723.1|  PREDICTED: serine/threonine-protein kinase 1...    227   8e-70   Nelumbo nucifera [Indian lotus]
ref|NP_001267650.1|  serine/threonine-protein kinase 16-like            226   1e-69   Cucumis sativus [cucumbers]
ref|XP_010257846.1|  PREDICTED: serine/threonine-protein kinase 16      226   2e-69   Nelumbo nucifera [Indian lotus]
ref|XP_011005497.1|  PREDICTED: serine/threonine-protein kinase 1...    226   3e-69   Populus euphratica
ref|XP_011011304.1|  PREDICTED: serine/threonine-protein kinase 1...    226   3e-69   Populus euphratica
ref|XP_009415450.1|  PREDICTED: probable serine/threonine-protein...    225   4e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008455005.1|  PREDICTED: serine/threonine-protein kinase 16      224   6e-69   Cucumis melo [Oriental melon]
ref|XP_009125719.1|  PREDICTED: serine/threonine-protein kinase 1...    223   2e-68   Brassica rapa
ref|XP_010547731.1|  PREDICTED: serine/threonine-protein kinase 16      223   3e-68   Tarenaya hassleriana [spider flower]
ref|XP_010942233.1|  PREDICTED: serine/threonine-protein kinase 1...    222   5e-68   Elaeis guineensis
ref|XP_010905763.1|  PREDICTED: probable serine/threonine-protein...    223   5e-68   Elaeis guineensis
ref|XP_008393382.1|  PREDICTED: serine/threonine-protein kinase 16      221   9e-68   
ref|XP_008804427.1|  PREDICTED: probable serine/threonine-protein...    221   2e-67   Phoenix dactylifera
emb|CDY44759.1|  BnaC02g01280D                                          221   2e-67   Brassica napus [oilseed rape]
ref|XP_008797567.1|  PREDICTED: probable serine/threonine-protein...    219   9e-67   Phoenix dactylifera
ref|XP_010905766.1|  PREDICTED: probable serine/threonine-protein...    219   1e-66   Elaeis guineensis
ref|XP_009395860.1|  PREDICTED: probable serine/threonine-protein...    219   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008804428.1|  PREDICTED: probable serine/threonine-protein...    218   4e-66   Phoenix dactylifera
ref|XP_004252263.1|  PREDICTED: probable serine/threonine-protein...    216   1e-65   Solanum lycopersicum
ref|XP_010929080.1|  PREDICTED: probable serine/threonine-protein...    216   2e-65   Elaeis guineensis
ref|XP_006345347.1|  PREDICTED: serine/threonine-protein kinase 1...    214   5e-65   Solanum tuberosum [potatoes]
gb|EMS68366.1|  Serine/threonine-protein kinase 16                      212   3e-64   Triticum urartu
ref|NP_001132895.1|  LOC100194392                                       212   6e-64   Zea mays [maize]
ref|XP_008783057.1|  PREDICTED: probable serine/threonine-protein...    211   1e-63   Phoenix dactylifera
ref|XP_004956689.1|  PREDICTED: probable serine/threonine-protein...    209   6e-63   Setaria italica
gb|KHN15181.1|  Serine/threonine-protein kinase 16                      209   7e-63   Glycine soja [wild soybean]
ref|XP_010238122.1|  PREDICTED: serine/threonine-protein kinase 1...    207   2e-62   Brachypodium distachyon [annual false brome]
gb|ACG33051.1|  serine/threonine-protein kinase 16                      207   4e-62   Zea mays [maize]
ref|XP_008650962.1|  PREDICTED: LOC100194392 isoform X1                 207   4e-62   Zea mays [maize]
ref|NP_001063027.1|  Os09g0372800                                       206   1e-61   
gb|ABB72838.1|  serine/threonine kinase                                 206   2e-61   Elaeis guineensis
ref|XP_004956690.1|  PREDICTED: probable serine/threonine-protein...    204   3e-61   Setaria italica
ref|XP_010238123.1|  PREDICTED: serine/threonine-protein kinase 1...    203   9e-61   Brachypodium distachyon [annual false brome]
ref|XP_006440850.1|  hypothetical protein CICLE_v10021674mg             196   3e-59   
ref|XP_002991218.1|  hypothetical protein SELMODRAFT_133041             186   6e-54   
ref|XP_002991279.1|  hypothetical protein SELMODRAFT_185952             185   1e-53   
tpg|DAA61227.1|  TPA: putative protein kinase superfamily protein       177   2e-53   
ref|NP_001062642.1|  Os09g0237600                                       182   2e-52   
dbj|BAJ87464.1|  predicted protein                                      181   5e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_850792.1|  serine/threonine protein kinase 3                     179   7e-52   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ08255.1|  hypothetical protein OsI_30510                          179   3e-51   Oryza sativa Indica Group [Indian rice]
gb|ACN26380.1|  unknown                                                 175   7e-50   Zea mays [maize]
ref|NP_001149977.1|  serine/threonine-protein kinase 16                 175   2e-49   Zea mays [maize]
ref|XP_004956402.1|  PREDICTED: probable serine/threonine-protein...    171   3e-48   Setaria italica
ref|XP_008668044.1|  PREDICTED: serine/threonine-protein kinase 1...    169   1e-47   Zea mays [maize]
ref|XP_001779469.1|  predicted protein                                  164   1e-45   
ref|XP_010237321.1|  PREDICTED: probable serine/threonine-protein...    163   4e-45   Brachypodium distachyon [annual false brome]
dbj|BAJ95332.1|  predicted protein                                      143   1e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008370887.1|  PREDICTED: uncharacterized protein LOC103434325    138   4e-37   
gb|ABB72840.1|  serine/threonine kinase splice variant 1                133   1e-36   Elaeis guineensis
ref|XP_006575874.1|  PREDICTED: uncharacterized protein LOC100811063    137   3e-36   
ref|XP_006661044.1|  PREDICTED: serine/threonine-protein kinase 1...    138   4e-35   
ref|XP_006661175.1|  PREDICTED: serine/threonine-protein kinase 1...    126   1e-31   
gb|ABB72839.1|  serine/threonine kinase                                 116   4e-30   Elaeis guineensis
ref|XP_008783056.1|  PREDICTED: probable serine/threonine-protein...    116   2e-27   Phoenix dactylifera
ref|XP_008783059.1|  PREDICTED: probable serine/threonine-protein...    116   2e-27   Phoenix dactylifera
gb|EMT14968.1|  Serine/threonine-protein kinase 16                      115   5e-27   
gb|AAN60358.1|  unknown                                                 102   8e-24   Arabidopsis thaliana [mouse-ear cress]
gb|EMS65453.1|  Serine/threonine-protein kinase 16                      105   1e-23   Triticum urartu
tpg|DAA39533.1|  TPA: putative protein kinase superfamily protein     76.6    8e-15   
ref|XP_005848000.1|  hypothetical protein CHLNCDRAFT_145529           79.0    6e-14   Chlorella variabilis
ref|XP_005767918.1|  hypothetical protein EMIHUDRAFT_245791           76.3    8e-14   Emiliania huxleyi CCMP1516
ref|XP_005794443.1|  hypothetical protein EMIHUDRAFT_431902           77.4    8e-14   Emiliania huxleyi CCMP1516
ref|XP_003060182.1|  predicted protein                                76.3    4e-13   Micromonas pusilla CCMP1545
ref|XP_008906617.1|  NAK/MPSK protein kinase                          70.5    2e-11   Phytophthora parasitica INRA-310
ref|XP_003215036.1|  PREDICTED: serine/threonine-protein kinase 16    69.7    3e-11   Anolis carolinensis [Carolina anole]
emb|CCA19548.1|  serine/threonine protein kinase putative             68.2    6e-11   Albugo laibachii Nc14
ref|XP_007419860.1|  PREDICTED: serine/threonine-protein kinase 1...  68.9    8e-11   Python bivittatus
ref|NP_001004792.1|  serine/threonine-protein kinase 16               68.6    9e-11   Xenopus tropicalis [western clawed frog]
ref|XP_009159379.1|  serine/threonine kinase 16                       69.7    9e-11   Exophiala dermatitidis NIH/UT8656
gb|KIY96099.1|  serine/threonine kinase 16                            68.2    3e-10   Monoraphidium neglectum
ref|XP_005096441.1|  PREDICTED: serine/threonine-protein kinase 1...  67.0    3e-10   Aplysia californica
ref|XP_002954912.1|  hypothetical protein VOLCADRAFT_118882           68.2    4e-10   Volvox carteri f. nagariensis
ref|XP_003287685.1|  hypothetical protein DICPUDRAFT_78515            66.6    5e-10   Dictyostelium purpureum
gb|ETE70724.1|  Serine/threonine-protein kinase 16                    65.9    6e-10   Ophiophagus hannah
ref|NP_001087851.1|  serine/threonine kinase 16                       66.2    7e-10   Xenopus laevis [clawed frog]
ref|XP_004997989.1|  NAK/MPSK protein kinase                          66.2    7e-10   Salpingoeca rosetta
ref|XP_002895305.1|  serine/threonine protein kinase                  66.2    8e-10   Phytophthora infestans T30-4
ref|XP_635157.1|  hypothetical protein DDB_G0291350                   65.9    1e-09   Dictyostelium discoideum AX4
ref|XP_009525867.1|  hypothetical protein PHYSODRAFT_459513           65.5    1e-09   Phytophthora sojae
dbj|GAM27617.1|  hypothetical protein SAMD00019534_107930             65.1    1e-09   Acytostelium subglobosum LB1
ref|XP_003389271.2|  PREDICTED: serine/threonine-protein kinase 1...  64.7    2e-09   Amphimedon queenslandica
gb|AAH05703.1|  Stk16 protein                                         63.5    3e-09   Mus musculus [mouse]
ref|XP_001561379.1|  hypothetical protein BC1G_00464                  65.1    3e-09   Botrytis cinerea B05.10
gb|EDL00385.1|  serine/threonine kinase 16, isoform CRA_b             63.2    3e-09   Mus musculus [mouse]
ref|XP_005395633.1|  PREDICTED: serine/threonine-protein kinase 1...  63.9    3e-09   Chinchilla lanigera
ref|XP_001594653.1|  hypothetical protein SS1G_04461                  64.7    3e-09   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_005395632.1|  PREDICTED: serine/threonine-protein kinase 1...  63.9    4e-09   
gb|AAV38392.1|  serine/threonine kinase 16                            64.3    4e-09   Homo sapiens [man]
gb|EPQ64769.1|  protein kinase                                        64.7    4e-09   Blumeria graminis f. sp. tritici 96224
emb|CCU78988.1|  serine/threonine protein kinase                      64.7    4e-09   Blumeria graminis f. sp. hordei DH14
gb|EGW11867.1|  Serine/threonine-protein kinase 16                    62.8    4e-09   Cricetulus griseus [Chinese hamsters]
ref|XP_005395628.1|  PREDICTED: serine/threonine-protein kinase 1...  63.9    5e-09   Chinchilla lanigera
ref|XP_006496525.1|  PREDICTED: serine/threonine-protein kinase 1...  63.2    5e-09   Mus musculus [mouse]
dbj|BAC27732.1|  unnamed protein product                              63.5    5e-09   Mus musculus [mouse]
gb|AAD02811.1|  palmitylated serine/threonine kinase                  63.5    6e-09   Mus musculus [mouse]
ref|XP_007519784.1|  PREDICTED: serine/threonine-protein kinase 16    63.5    6e-09   Erinaceus europaeus [common hedgehog]
ref|NP_035624.3|  serine/threonine-protein kinase 16                  63.5    6e-09   Mus musculus [mouse]
ref|XP_007445878.1|  PREDICTED: serine/threonine-protein kinase 16    63.5    6e-09   Lipotes vexillifer [baiji]
dbj|BAC26947.1|  unnamed protein product                              63.5    6e-09   Mus musculus [mouse]
gb|EDL75404.1|  serine/threonine kinase 16, isoform CRA_b             62.0    6e-09   Rattus norvegicus [brown rat]
gb|EKG22262.1|  hypothetical protein MPH_00441                        64.3    6e-09   Macrophomina phaseolina MS6
gb|KIX94689.1|  hypothetical protein Z520_09735                       64.3    6e-09   Fonsecaea multimorphosa CBS 102226
gb|KIW55799.1|  hypothetical protein PV05_04522                       63.9    7e-09   Exophiala xenobiotica
ref|XP_009181397.1|  PREDICTED: serine/threonine-protein kinase 16    63.2    7e-09   
gb|KIX02735.1|  hypothetical protein Z518_08677                       63.9    8e-09   Rhinocladiella mackenziei CBS 650.93
ref|XP_005574406.1|  PREDICTED: serine/threonine-protein kinase 1...  63.2    8e-09   Macaca fascicularis [crab eating macaque]
ref|NP_001253902.1|  serine/threonine-protein kinase 16               63.2    8e-09   Macaca mulatta [rhesus macaque]
gb|EWM24320.1|  serine threonine protein kinase                       63.5    8e-09   Nannochloropsis gaditana
dbj|GAA94070.1|  hypothetical protein E5Q_00717                       63.9    8e-09   Mixia osmundae IAM 14324
ref|XP_007122499.1|  PREDICTED: serine/threonine-protein kinase 1...  62.8    8e-09   Physeter catodon
ref|XP_007188028.1|  PREDICTED: serine/threonine-protein kinase 1...  62.4    9e-09   Balaenoptera acutorostrata scammoni
dbj|BAG63548.1|  unnamed protein product                              61.6    9e-09   Homo sapiens [man]
ref|XP_007122498.1|  PREDICTED: serine/threonine-protein kinase 1...  62.8    9e-09   Physeter catodon
gb|KIW66504.1|  hypothetical protein PV04_05833                       63.5    1e-08   Phialophora americana
ref|XP_007188026.1|  PREDICTED: serine/threonine-protein kinase 1...  62.8    1e-08   Balaenoptera acutorostrata scammoni
ref|XP_004262741.1|  PREDICTED: serine/threonine-protein kinase 16    62.8    1e-08   Orcinus orca [Orca]
ref|XP_007722449.1|  NAK protein kinase                               63.5    1e-08   Capronia coronata CBS 617.96
ref|XP_006245222.1|  PREDICTED: serine/threonine-protein kinase 1...  62.4    1e-08   Rattus norvegicus [brown rat]
ref|XP_008723761.1|  hypothetical protein G647_09545                  63.5    1e-08   Cladophialophora carrionii CBS 160.54
ref|XP_010610139.1|  PREDICTED: serine/threonine-protein kinase 16    62.8    1e-08   Fukomys damarensis [Damara mole rat]
ref|XP_007646375.1|  PREDICTED: serine/threonine-protein kinase 16    62.8    1e-08   Cricetulus griseus [Chinese hamsters]
ref|XP_007757578.1|  NAK protein kinase                               63.2    1e-08   Cladophialophora yegresii CBS 114405
gb|EMF10956.1|  serine/threonine protein kinase                       63.2    1e-08   Sphaerulina musiva SO2202
ref|NP_775165.1|  serine/threonine-protein kinase 16                  62.4    1e-08   Rattus norvegicus [brown rat]
ref|XP_005001103.1|  PREDICTED: serine/threonine-protein kinase 1...  62.0    1e-08   
ref|XP_003464049.1|  PREDICTED: serine/threonine-protein kinase 1...  62.4    2e-08   
ref|XP_008823981.1|  PREDICTED: serine/threonine-protein kinase 1...  62.0    2e-08   Nannospalax galili
gb|KEY70585.1|  hypothetical protein S7711_02189                      61.2    2e-08   Stachybotrys chartarum IBT 7711
ref|XP_007751990.1|  NAK protein kinase                               62.8    2e-08   Cladophialophora psammophila CBS 110553
ref|XP_007777376.1|  NAK protein kinase                               62.4    2e-08   Coniosporium apollinis CBS 100218
ref|XP_004876210.1|  PREDICTED: serine/threonine-protein kinase 1...  62.0    2e-08   
ref|XP_003272445.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  62.0    2e-08   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_005672285.1|  PREDICTED: serine/threonine-protein kinase 1...  61.6    2e-08   
emb|CAA06700.1|  PKL12 protein                                        62.0    2e-08   Homo sapiens [man]
ref|XP_008823979.1|  PREDICTED: serine/threonine-protein kinase 1...  61.6    2e-08   Nannospalax galili
gb|AAC28337.1|  myristilated and palmitylated serine-threonine ki...  61.6    2e-08   Homo sapiens [man]
emb|CCA71061.1|  related to Prk1p                                     62.4    2e-08   Serendipita indica DSM 11827
gb|AAH02618.1|  Serine/threonine kinase 16                            61.6    2e-08   Homo sapiens [man]
ref|XP_003852606.1|  hypothetical protein MYCGRDRAFT_72191            62.4    2e-08   Zymoseptoria tritici IPO323
emb|CAA09387.1|  serine/threonine kinase                              61.6    2e-08   Homo sapiens [man]
ref|XP_001162451.1|  PREDICTED: serine/threonine-protein kinase 1...  61.6    2e-08   Pan troglodytes
gb|ESZ99238.1|  serine/threonine protein kinase                       62.4    2e-08   Sclerotinia borealis F-4128
gb|ACE87420.1|  serine/threonine kinase 16 protein                    61.6    3e-08   synthetic construct
ref|XP_003818698.1|  PREDICTED: serine/threonine-protein kinase 1...  61.6    3e-08   Pan paniscus [bonobo]
dbj|BAF85383.1|  unnamed protein product                              61.6    3e-08   Homo sapiens [man]
ref|NP_001008910.1|  serine/threonine-protein kinase 16               61.6    3e-08   Homo sapiens [man]
ref|XP_011456099.1|  PREDICTED: serine/threonine-protein kinase 1...  61.6    3e-08   Crassostrea gigas
gb|AAQ02488.1|  serine/threonine kinase 16                            61.6    3e-08   synthetic construct
gb|KIW33065.1|  hypothetical protein PV07_04563                       62.4    3e-08   Cladophialophora immunda
ref|XP_010358600.1|  PREDICTED: serine/threonine-protein kinase 16    61.6    3e-08   Rhinopithecus roxellana
ref|XP_001928241.1|  PREDICTED: serine/threonine-protein kinase 1...  61.6    3e-08   
ref|XP_011231795.1|  PREDICTED: serine/threonine-protein kinase 1...  61.2    3e-08   
ref|XP_008688657.1|  PREDICTED: serine/threonine-protein kinase 1...  61.2    3e-08   Ursus maritimus [white bear]
ref|XP_006972221.1|  PREDICTED: serine/threonine-protein kinase 1...  61.6    3e-08   Peromyscus maniculatus bairdii
ref|XP_004638249.1|  PREDICTED: serine/threonine-protein kinase 16    61.6    3e-08   Octodon degus
ref|XP_004674323.1|  PREDICTED: serine/threonine-protein kinase 16    61.6    3e-08   Condylura cristata
ref|XP_002749858.1|  PREDICTED: serine/threonine-protein kinase 1...  61.6    3e-08   Callithrix jacchus [common marmoset]
ref|XP_006168694.1|  PREDICTED: serine/threonine-protein kinase 1...  61.2    3e-08   
gb|KIV84313.1|  hypothetical protein PV11_00101                       62.0    3e-08   Exophiala sideris
ref|XP_545656.1|  PREDICTED: serine/threonine-protein kinase 16 i...  61.2    3e-08   Canis lupus familiaris [dogs]
ref|XP_004662965.1|  PREDICTED: serine/threonine-protein kinase 16    61.2    3e-08   Jaculus jaculus
ref|XP_007582065.1|  putative serine threonine protein                61.6    4e-08   
gb|KEQ83345.1|  kinase-like protein                                   61.6    4e-08   Aureobasidium pullulans EXF-150
ref|XP_005330559.1|  PREDICTED: serine/threonine-protein kinase 1...  61.2    4e-08   Ictidomys tridecemlineatus
ref|XP_008585681.1|  PREDICTED: serine/threonine-protein kinase 16    61.2    4e-08   Galeopterus variegatus [Malayan flying lemur]
ref|XP_006168692.1|  PREDICTED: serine/threonine-protein kinase 1...  61.2    4e-08   Tupaia chinensis
ref|XP_003784978.1|  PREDICTED: serine/threonine-protein kinase 16    61.2    4e-08   
ref|XP_008688654.1|  PREDICTED: serine/threonine-protein kinase 1...  61.2    4e-08   Ursus maritimus [white bear]
ref|XP_010334582.1|  PREDICTED: serine/threonine-protein kinase 1...  61.2    4e-08   Saimiri boliviensis boliviensis
ref|XP_008528199.1|  PREDICTED: serine/threonine-protein kinase 1...  60.8    4e-08   Equus przewalskii [Przewalski horse]
emb|CCI44431.1|  unnamed protein product                              62.0    4e-08   Albugo candida
ref|XP_005070530.1|  PREDICTED: serine/threonine-protein kinase 1...  61.2    4e-08   Mesocricetus auratus [Syrian golden hamster]
ref|XP_002712533.1|  PREDICTED: serine/threonine-protein kinase 16    61.2    4e-08   
ref|XP_003991222.1|  PREDICTED: serine/threonine-protein kinase 16    61.2    4e-08   Felis catus [cat]
ref|XP_004762884.1|  PREDICTED: serine/threonine-protein kinase 1...  60.8    4e-08   Mustela putorius furo [black ferret]
ref|XP_002913702.1|  PREDICTED: serine/threonine-protein kinase 1...  60.8    4e-08   
gb|KEF58800.1|  NAK protein kinase                                    61.6    4e-08   Exophiala aquamarina CBS 119918
ref|XP_005153910.1|  PREDICTED: serine/threonine-protein kinase 16    60.8    4e-08   Melopsittacus undulatus
ref|XP_007677906.1|  hypothetical protein BAUCODRAFT_541809           61.6    4e-08   Baudoinia panamericana UAMH 10762
ref|XP_004576867.1|  PREDICTED: serine/threonine-protein kinase 16    60.8    5e-08   Ochotona princeps [southern American pika]
ref|XP_426593.1|  PREDICTED: serine/threonine-protein kinase 16 i...  60.8    5e-08   Gallus gallus [bantam]
ref|XP_004942901.1|  PREDICTED: serine/threonine-protein kinase 1...  61.2    5e-08   Gallus gallus [bantam]
ref|XP_003925562.1|  PREDICTED: serine/threonine-protein kinase 1...  60.8    5e-08   Saimiri boliviensis boliviensis
gb|KEQ67082.1|  kinase-like protein                                   61.2    5e-08   Aureobasidium melanogenum CBS 110374
ref|XP_005519774.1|  PREDICTED: serine/threonine-protein kinase 16    60.8    5e-08   Pseudopodoces humilis [Tibetan ground-jay]
gb|KIN04003.1|  hypothetical protein OIDMADRAFT_143466                61.2    5e-08   Oidiodendron maius Zn
ref|XP_006763424.1|  PREDICTED: serine/threonine-protein kinase 1...  60.5    5e-08   Myotis davidii
ref|XP_005049571.1|  PREDICTED: serine/threonine-protein kinase 16    60.8    5e-08   Ficedula albicollis
gb|KFA61460.1|  hypothetical protein S40285_03432                     59.7    5e-08   Stachybotrys chlorohalonata IBT 40285
ref|XP_008528196.1|  PREDICTED: serine/threonine-protein kinase 1...  60.8    5e-08   Equus przewalskii [Przewalski horse]
gb|KIW80897.1|  hypothetical protein Z517_03920                       61.2    5e-08   Fonsecaea pedrosoi CBS 271.37
ref|XP_008057071.1|  PREDICTED: serine/threonine-protein kinase 1...  60.8    5e-08   
ref|XP_007735266.1|  NAK protein kinase                               61.2    6e-08   Capronia epimyces CBS 606.96
ref|XP_011356864.1|  PREDICTED: serine/threonine-protein kinase 16    60.8    6e-08   
ref|XP_008868218.1|  NAK protein kinase, variant 2                    60.5    6e-08   Aphanomyces invadans
ref|XP_008057070.1|  PREDICTED: serine/threonine-protein kinase 1...  60.8    6e-08   
ref|XP_005485280.1|  PREDICTED: serine/threonine-protein kinase 1...  60.5    6e-08   Zonotrichia albicollis
ref|XP_004358442.1|  putative protein serine/threonine kinase         60.5    6e-08   Cavenderia fasciculata
ref|XP_006906757.1|  PREDICTED: serine/threonine-protein kinase 16    60.5    6e-08   
ref|XP_008868217.1|  NAK protein kinase, variant 1                    60.5    6e-08   Aphanomyces invadans
ref|XP_001493234.1|  PREDICTED: serine/threonine-protein kinase 16    60.5    6e-08   Equus caballus [domestic horse]
ref|XP_004467828.1|  PREDICTED: serine/threonine-protein kinase 1...  60.5    6e-08   Dasypus novemcinctus
gb|KIW86898.1|  hypothetical protein Z519_12520                       61.2    6e-08   
ref|XP_003406100.1|  PREDICTED: serine/threonine-protein kinase 16    60.5    7e-08   
ref|XP_007956990.1|  PREDICTED: serine/threonine-protein kinase 16    60.5    7e-08   
ref|XP_004467827.1|  PREDICTED: serine/threonine-protein kinase 1...  60.5    7e-08   
ref|XP_008057069.1|  PREDICTED: serine/threonine-protein kinase 1...  60.5    7e-08   
ref|XP_004402801.1|  PREDICTED: serine/threonine-protein kinase 16    60.5    7e-08   
ref|XP_006763422.1|  PREDICTED: serine/threonine-protein kinase 1...  60.5    7e-08   
ref|XP_009086158.1|  PREDICTED: serine/threonine-protein kinase 16    60.5    7e-08   
gb|KIW07925.1|  hypothetical protein PV09_01833                       60.8    7e-08   
emb|CBN77951.1|  Serine/threonine protein kinase/TGF-beta stimula...  60.8    8e-08   
ref|XP_005651977.1|  hypothetical protein COCSUDRAFT_39101            61.2    8e-08   
ref|XP_004376394.1|  PREDICTED: serine/threonine-protein kinase 16    60.1    9e-08   
ref|XP_005883518.1|  PREDICTED: serine/threonine-protein kinase 1...  60.1    9e-08   
ref|XP_008868216.1|  NAK protein kinase                               60.5    9e-08   
ref|XP_008076868.1|  Protein kinase-like (PK-like)                    60.5    9e-08   
ref|XP_006867895.1|  PREDICTED: serine/threonine-protein kinase 16    60.1    9e-08   
ref|XP_006082609.1|  PREDICTED: serine/threonine-protein kinase 1...  59.7    9e-08   
ref|XP_004067141.1|  PREDICTED: serine/threonine-protein kinase 16    60.1    1e-07   
dbj|BAA89499.1|  F5-2                                                 60.1    1e-07   
ref|XP_006742950.1|  PREDICTED: serine/threonine-protein kinase 1...  60.1    1e-07   
gb|KIV90023.1|  hypothetical protein PV10_07370                       60.5    1e-07   
dbj|BAA89662.1|  F5-2                                                 60.1    1e-07   
gb|KIW47890.1|  hypothetical protein PV06_00544                       60.5    1e-07   
ref|XP_008143361.1|  PREDICTED: serine/threonine-protein kinase 16    59.7    1e-07   
ref|XP_006082607.1|  PREDICTED: serine/threonine-protein kinase 1...  59.7    1e-07   
ref|XP_006742949.1|  PREDICTED: serine/threonine-protein kinase 1...  59.7    1e-07   
emb|CDS09297.1|  hypothetical protein LRAMOSA10657                    59.7    2e-07   
gb|KEQ91137.1|  hypothetical protein AUEXF2481DRAFT_70276             59.7    2e-07   
emb|CDH56229.1|  serine threonine protein                             59.7    2e-07   
ref|XP_011297504.1|  PREDICTED: serine/threonine-protein kinase 16    59.3    2e-07   
ref|NP_001133526.1|  serine/threonine-protein kinase 16               58.9    2e-07   
gb|KIM33499.1|  hypothetical protein M408DRAFT_155596                 59.7    2e-07   
ref|XP_007930260.1|  hypothetical protein MYCFIDRAFT_208836           60.1    2e-07   
gb|KEQ69246.1|  kinase-like protein                                   59.3    2e-07   
ref|XP_010728226.1|  PREDICTED: serine/threonine-protein kinase 16    58.9    2e-07   
ref|XP_008714211.1|  hypothetical protein HMPREF1541_01631            59.3    3e-07   
ref|XP_005361649.1|  PREDICTED: serine/threonine-protein kinase 16    58.5    3e-07   
gb|KIW16851.1|  hypothetical protein PV08_04041                       58.9    3e-07   
ref|XP_008487211.1|  PREDICTED: serine/threonine-protein kinase 1...  56.2    3e-07   
gb|EQL02420.1|  Protein kinase-like domain protein                    58.9    3e-07   
ref|XP_010986671.1|  PREDICTED: serine/threonine-protein kinase 1...  58.2    3e-07   
ref|XP_007292695.1|  serine/threonine kinase 16                       58.9    3e-07   
ref|XP_008487210.1|  PREDICTED: serine/threonine-protein kinase 1...  55.8    3e-07   
gb|KIR74195.1|  NAK protein kinase                                    58.5    4e-07   
ref|XP_010947117.1|  PREDICTED: serine/threonine-protein kinase 1...  58.2    4e-07   
gb|KGB74358.1|  NAK protein kinase                                    58.5    4e-07   
gb|KIR32493.1|  NAK protein kinase                                    58.5    4e-07   
gb|KIR24671.1|  NAK protein kinase                                    58.5    4e-07   
ref|XP_003969924.1|  PREDICTED: serine/threonine-protein kinase 1...  58.2    4e-07   
gb|EME38432.1|  hypothetical protein DOTSEDRAFT_181583                58.9    4e-07   
gb|KIM67589.1|  hypothetical protein SCLCIDRAFT_107618                58.5    4e-07   
gb|KIR96896.1|  NAK protein kinase                                    58.5    4e-07   
ref|XP_003192223.1|  serine/threonine-protein kinase                  58.5    4e-07   
gb|KIR53126.1|  NAK protein kinase                                    58.5    4e-07   
ref|XP_010986670.1|  PREDICTED: serine/threonine-protein kinase 1...  58.2    4e-07   
gb|KIR50443.1|  NAK protein kinase                                    58.5    4e-07   
gb|KIR58761.1|  NAK protein kinase                                    58.5    4e-07   
ref|XP_007362345.1|  Pkinase-domain-containing protein                58.5    4e-07   
ref|XP_005985203.1|  PREDICTED: serine/threonine-protein kinase 1...  58.2    4e-07   
ref|XP_008039622.1|  Pkinase-domain-containing protein                58.5    4e-07   
ref|XP_006207296.1|  PREDICTED: serine/threonine-protein kinase 16    58.2    4e-07   
ref|XP_006186928.1|  PREDICTED: serine/threonine-protein kinase 16    58.2    5e-07   
ref|XP_002504178.1|  serine/threonine-protein kinase                  58.5    5e-07   
ref|XP_008997782.1|  PREDICTED: serine/threonine-protein kinase 1...  57.8    5e-07   
gb|EWC48059.1|  hypothetical protein DRE_02638                        58.2    5e-07   
ref|XP_008997783.1|  PREDICTED: serine/threonine-protein kinase 1...  57.8    5e-07   
ref|XP_006059054.1|  PREDICTED: serine/threonine-protein kinase 1...  57.8    5e-07   
ref|XP_008467843.1|  PREDICTED: serine/threonine-protein kinase 16    57.8    5e-07   
ref|XP_006059051.1|  PREDICTED: serine/threonine-protein kinase 1...  57.8    5e-07   
ref|XP_569013.1|  serine/threonine-protein kinase                     58.2    6e-07   
ref|XP_004005479.1|  PREDICTED: serine/threonine-protein kinase 16    57.4    7e-07   
gb|AFR93303.2|  NAK protein kinase                                    57.8    7e-07   
ref|XP_777046.1|  hypothetical protein CNBB2780                       57.8    7e-07   
gb|EPB91820.1|  NAK protein kinase                                    57.8    7e-07   
ref|XP_010334586.1|  PREDICTED: serine/threonine-protein kinase 1...  57.4    7e-07   
gb|EMT63835.1|  hypothetical protein FOC4_g10010307                   57.0    8e-07   
ref|XP_002483375.1|  serine/threonine protein kinase, putative        57.8    9e-07   
ref|XP_009840628.1|  NAK protein kinase                               57.4    9e-07   
emb|CDO74993.1|  hypothetical protein BN946_scf184945.g65             57.4    1e-06   
dbj|BAD26025.1|  putative AAK1 protein                                57.8    1e-06   
gb|EAZ08411.1|  hypothetical protein OsI_30675                        57.8    1e-06   
gb|ACQ58215.1|  Serine/threonine-protein kinase 16                    57.0    1e-06   
ref|XP_007263188.1|  other/NAK protein kinase                         57.4    1e-06   
gb|KFZ24140.1|  hypothetical protein V502_01391                       57.8    1e-06   
ref|XP_011397254.1|  Serine/threonine-protein kinase 16               57.4    1e-06   
ref|XP_004348721.1|  serine/threonine protein kinase                  57.0    1e-06   
gb|KFY94533.1|  hypothetical protein V500_03179                       57.8    1e-06   
ref|XP_005202899.1|  PREDICTED: serine/threonine-protein kinase 1...  56.6    1e-06   
emb|CDX98559.1|  BnaC05g38160D                                        54.7    1e-06   
dbj|GAN07621.1|  pkinase-domain-containing protein                    57.0    1e-06   
gb|EEE69334.1|  hypothetical protein OsJ_28650                        57.8    1e-06   
ref|NP_001039720.1|  serine/threonine-protein kinase 16               56.6    1e-06   
gb|KIL84301.1|  hypothetical protein FAVG1_12538                      57.0    1e-06   
ref|XP_004701680.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  56.6    1e-06   
ref|XP_005889744.1|  PREDICTED: serine/threonine-protein kinase 16    56.6    1e-06   
gb|KIJ52504.1|  hypothetical protein M422DRAFT_223049                 57.0    1e-06   
gb|KFH47930.1|  Serine/threonine-protein kinase-like protein          57.0    1e-06   
ref|XP_009840627.1|  NAK protein kinase, variant                      56.6    1e-06   
ref|XP_010800638.1|  PREDICTED: serine/threonine-protein kinase 1...  56.6    1e-06   
ref|XP_001795102.1|  hypothetical protein SNOG_04689                  57.0    2e-06   
emb|CEJ95044.1|  Putative Kinase                                      57.0    2e-06   
ref|XP_011326486.1|  hypothetical protein FGSG_06832                  56.6    2e-06   
gb|EYB23207.1|  hypothetical protein FG05_06832                       56.6    2e-06   
ref|XP_007560183.1|  PREDICTED: serine/threonine-protein kinase 16    56.2    2e-06   
ref|XP_004427642.1|  PREDICTED: serine/threonine-protein kinase 16    56.2    2e-06   
ref|XP_009263226.1|  hypothetical protein FPSE_11834                  56.6    2e-06   
pdb|2BUJ|A  Chain A, Crystal Structure Of The Human Serine-Threon...  56.2    2e-06   
emb|CCT66045.1|  related to Prk1p, and serine/threonine protein k...  56.6    2e-06   
ref|XP_003052158.1|  predicted protein                                56.6    2e-06   
gb|KJA16857.1|  hypothetical protein HYPSUDRAFT_46891                 56.6    2e-06   
ref|XP_005799781.1|  PREDICTED: serine/threonine-protein kinase 1...  56.2    2e-06   
gb|EWG43871.1|  NAK protein kinase                                    56.6    2e-06   
gb|KID80154.1|  Protein kinase-like domain protein                    56.6    2e-06   
ref|XP_010794761.1|  PREDICTED: serine/threonine-protein kinase 1...  56.2    2e-06   
gb|EGU89066.1|  hypothetical protein FOXB_00415                       56.6    2e-06   
ref|XP_010794760.1|  PREDICTED: serine/threonine-protein kinase 1...  56.2    2e-06   
gb|KIM36166.1|  hypothetical protein M413DRAFT_449359                 56.6    2e-06   
gb|EPS96122.1|  hypothetical protein FOMPIDRAFT_1167839               56.2    2e-06   
ref|XP_007319103.1|  protein kinase                                   56.2    2e-06   
ref|XP_011126760.1|  hypothetical protein AOL_s00188g210              56.2    2e-06   
ref|XP_010884397.1|  PREDICTED: serine/threonine-protein kinase 16    55.8    3e-06   
ref|XP_009045048.1|  hypothetical protein LOTGIDRAFT_223991           55.8    3e-06   
ref|XP_001880611.1|  predicted protein                                55.8    3e-06   
gb|KDQ59307.1|  hypothetical protein JAAARDRAFT_154656                56.2    3e-06   
gb|KIJ13415.1|  hypothetical protein PAXINDRAFT_170488                55.8    3e-06   
gb|ELR10510.1|  hypothetical protein GMDG_04788                       54.7    3e-06   
ref|XP_006890368.1|  PREDICTED: serine/threonine-protein kinase 16    55.8    3e-06   
gb|KIO15191.1|  hypothetical protein M404DRAFT_991904                 55.8    3e-06   
gb|KHJ34990.1|  putative serine threonine protein kinase              55.8    3e-06   
gb|KIK99586.1|  hypothetical protein PAXRUDRAFT_30412                 55.8    3e-06   
ref|XP_002169756.2|  PREDICTED: probable ATP-dependent RNA helica...  56.2    3e-06   
emb|CCM04252.1|  predicted protein                                    55.8    3e-06   
gb|KIJ66924.1|  hypothetical protein HYDPIDRAFT_150022                55.8    3e-06   
ref|XP_003445781.1|  PREDICTED: serine/threonine-protein kinase 1...  55.5    3e-06   
ref|XP_008290775.1|  PREDICTED: serine/threonine-protein kinase 16    55.5    3e-06   
gb|KFX87852.1|  hypothetical protein O988_09260                       55.5    4e-06   
ref|XP_010237997.1|  PREDICTED: AP2-associated protein kinase 1-like  56.2    4e-06   
ref|XP_004617190.1|  PREDICTED: serine/threonine-protein kinase 16    55.5    4e-06   
ref|XP_003341897.1|  PREDICTED: serine/threonine-protein kinase 1...  55.5    4e-06   
ref|XP_001836285.1|  other/NAK protein kinase                         55.8    4e-06   
ref|XP_007807374.1|  serine/threonine protein kinase, putative        55.5    5e-06   
gb|KIL64445.1|  hypothetical protein M378DRAFT_78338                  55.5    5e-06   
gb|KIK66664.1|  hypothetical protein GYMLUDRAFT_157468                55.5    5e-06   
gb|KFG80489.1|  putative serine/threonine protein kinase              55.5    5e-06   
gb|KID91187.1|  Protein kinase-like domain protein                    55.5    5e-06   
gb|KID99990.1|  Protein kinase-like domain protein                    55.1    5e-06   
ref|XP_007300066.1|  Pkinase-domain-containing protein                55.1    6e-06   
ref|XP_008402689.1|  PREDICTED: serine/threonine-protein kinase 16    54.7    6e-06   
gb|KFY73016.1|  hypothetical protein V499_06873                       55.1    6e-06   
gb|KEZ44343.1|  Serine threonine protein                              55.1    7e-06   
gb|KFY49109.1|  hypothetical protein V495_00757                       55.1    7e-06   
gb|KDR78818.1|  hypothetical protein GALMADRAFT_1271408               55.1    7e-06   
gb|KEY78331.1|  serine threoninee protein kinase                      54.7    8e-06   
ref|XP_006008957.1|  PREDICTED: serine/threonine-protein kinase 16    54.3    8e-06   
ref|XP_007821888.1|  Protein kinase, ATP binding site                 54.7    8e-06   
ref|XP_006780460.1|  PREDICTED: serine/threonine-protein kinase 1...  54.3    8e-06   
gb|KIP04401.1|  hypothetical protein PHLGIDRAFT_31384                 54.7    9e-06   
gb|KFY08760.1|  hypothetical protein V492_05938                       55.1    9e-06   
ref|XP_009545416.1|  hypothetical protein HETIRDRAFT_316384           54.7    9e-06   
gb|KIK10008.1|  hypothetical protein K443DRAFT_136030                 54.7    9e-06   
gb|EQB48009.1|  hypothetical protein CGLO_12786                       54.7    9e-06   
gb|KFY39505.1|  hypothetical protein V494_03938                       55.1    9e-06   
ref|XP_003299571.1|  hypothetical protein PTT_10595                   54.7    9e-06   
ref|XP_007279829.1|  serine threonine protein                         54.3    1e-05   
ref|XP_747273.1|  serine/threonine protein kinase                     54.3    1e-05   
ref|XP_006679528.1|  hypothetical protein BATDEDRAFT_33346            54.3    1e-05   
ref|XP_007800711.1|  hypothetical protein EPUS_00962                  54.3    1e-05   
ref|XP_008308178.1|  PREDICTED: serine/threonine-protein kinase 16    54.3    1e-05   
emb|CCX16347.1|  Similar to Serine/threonine-protein kinase ppk13...  54.3    1e-05   
ref|XP_007765994.1|  other/NAK protein kinase                         54.3    1e-05   
ref|XP_001938210.1|  serine/threonine kinase 16                       54.3    1e-05   
gb|EMD31340.1|  hypothetical protein CERSUDRAFT_119907                54.3    1e-05   
ref|XP_007867650.1|  Pkinase-domain-containing protein                54.3    1e-05   
ref|XP_002129344.2|  PREDICTED: serine/threonine-protein kinase 1...  53.9    1e-05   
ref|XP_005724188.1|  PREDICTED: serine/threonine-protein kinase 1...  53.9    1e-05   
ref|XP_005935306.1|  PREDICTED: serine/threonine-protein kinase 1...  53.9    1e-05   
ref|XP_003005152.1|  serine/threonine-protein kinase                  53.9    1e-05   
gb|EMS19970.1|  serine/threonine-protein kinase                       54.3    1e-05   
gb|KDQ19325.1|  hypothetical protein BOTBODRAFT_184376                54.3    1e-05   
gb|KFY01542.1|  hypothetical protein V490_00863                       53.9    1e-05   
gb|KIK16096.1|  hypothetical protein PISMIDRAFT_277244                53.9    1e-05   
ref|XP_002177071.1|  predicted protein                                53.9    1e-05   
gb|KII85212.1|  hypothetical protein PLICRDRAFT_166831                53.9    1e-05   
gb|KFY53391.1|  hypothetical protein V496_07653                       54.3    1e-05   
gb|KFY24413.1|  hypothetical protein V493_05252                       53.9    2e-05   
gb|KFY18925.1|  hypothetical protein V491_04657                       53.9    2e-05   
ref|XP_007846682.1|  nak protein kinase                               53.9    2e-05   
ref|XP_008866641.1|  NAK/MPSK protein kinase, variant                 53.5    2e-05   
gb|KIY43898.1|  kinase-like protein                                   53.5    2e-05   
gb|KDB13381.1|  putative serine/threonine protein kinase              53.9    2e-05   
ref|XP_008866642.1|  NAK/MPSK protein kinase                          53.5    2e-05   
dbj|GAM38688.1|  hypothetical protein TCE0_033r09616                  53.9    2e-05   
ref|XP_003838791.1|  similar to serine/threonine protein kinase       53.5    2e-05   
ref|XP_003659209.1|  hypothetical protein MYCTH_2295931               53.5    2e-05   
ref|XP_003377990.1|  serine/threonine-protein kinase 16               53.1    2e-05   
ref|XP_003031576.1|  hypothetical protein SCHCODRAFT_76377            53.1    2e-05   
ref|XP_007908286.1|  PREDICTED: serine/threonine-protein kinase 16    53.1    2e-05   
emb|CEG84116.1|  Putative NAK protein kinase                          53.1    3e-05   
emb|CCE31009.1|  related to serine/threonine kinase 16                53.1    3e-05   
ref|XP_008023611.1|  hypothetical protein SETTUDRAFT_176381           53.1    3e-05   
gb|KDQ24429.1|  hypothetical protein PLEOSDRAFT_1094292               53.1    3e-05   
tpe|CBF84937.1|  TPA: serine/threonine protein kinase, putative (...  53.1    3e-05   
gb|EMT09791.1|  Putative serine/threonine-protein kinase              53.1    3e-05   
ref|XP_011255230.1|  PREDICTED: serine/threonine-protein kinase 16    52.8    3e-05   
gb|EMD94299.1|  hypothetical protein COCHEDRAFT_1130806               53.1    3e-05   
ref|XP_001262015.1|  serine/threonine protein kinase, putative        52.8    3e-05   
ref|XP_007701506.1|  hypothetical protein COCSADRAFT_120619           52.8    3e-05   
ref|XP_008671591.1|  PREDICTED: probable serine/threonine-protein...  53.1    3e-05   
tpg|DAA39365.1|  TPA: putative protein kinase superfamily protein     53.1    3e-05   
ref|XP_004543459.1|  PREDICTED: serine/threonine-protein kinase 1...  52.8    3e-05   
gb|EHK40865.1|  hypothetical protein TRIATDRAFT_227009                52.8    4e-05   
ref|XP_003332725.2|  NAK protein kinase                               52.8    4e-05   
gb|KDE05248.1|  NAK protein kinase                                    52.8    4e-05   
ref|XP_003025242.1|  hypothetical protein TRV_00558                   52.4    4e-05   
ref|XP_002843872.1|  serine/threonine-protein kinase                  52.4    4e-05   
ref|XP_006459060.1|  hypothetical protein AGABI2DRAFT_191128          52.4    4e-05   
ref|XP_007331420.1|  hypothetical protein AGABI1DRAFT_114902          52.4    4e-05   
gb|EGE01087.1|  NAK protein kinase                                    52.4    5e-05   
gb|EGD96067.1|  NAK protein kinase                                    52.4    5e-05   
ref|XP_003015384.1|  hypothetical protein ARB_06507                   52.4    5e-05   
ref|NP_001017630.1|  serine/threonine-protein kinase 16               52.4    5e-05   



>ref|XP_006345079.1| PREDICTED: serine/threonine-protein kinase 16-like [Solanum tuberosum]
Length=342

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+++DP+ PGVSKK
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVISDPSNPGVSKK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
            FKD SH SD+GTYAMKKVLIQNSEQL+LVKEEIRVSSLF+HPNLLPLLDHA+IAVKA   
Sbjct  61   FKDSSHISDDGTYAMKKVLIQNSEQLELVKEEIRVSSLFTHPNLLPLLDHAIIAVKAGPD  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
            QSWKHEAYLLFPVH+DGTLLD
Sbjct  121  QSWKHEAYLLFPVHLDGTLLD  141



>ref|XP_004236087.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Solanum lycopersicum]
Length=342

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE+++DP+ PGVSKK
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVISDPSNPGVSKK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
            FKD SH SD+GTYAMKKVLIQNSEQL LVKEEIRVSSLF+HPNLLPLLDHA+IAVKA   
Sbjct  61   FKDSSHISDDGTYAMKKVLIQNSEQLALVKEEIRVSSLFTHPNLLPLLDHAIIAVKAGPD  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
            QSWKHEAYLLFPVH+DGTLLD
Sbjct  121  QSWKHEAYLLFPVHLDGTLLD  141



>ref|XP_004241617.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Solanum lycopersicum]
Length=342

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCS SGLN LYDAVNGGGDVWIN+NRF+I+RQLGEGGFAYV+LVKE+L+DP+ PG+SKK
Sbjct  1    MGCSISGLNGLYDAVNGGGDVWINENRFKIIRQLGEGGFAYVFLVKEVLSDPSNPGISKK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
            FKDPSH SD+GTYAMKKVLIQNSEQL++V+EEIRVSSLFSHPNLLPLLDHA+I+VK ++ 
Sbjct  61   FKDPSHISDDGTYAMKKVLIQNSEQLEMVREEIRVSSLFSHPNLLPLLDHAIISVKVAQD  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
            QS KHEAYLLFPVH+DGTLLD
Sbjct  121  QSLKHEAYLLFPVHLDGTLLD  141



>ref|XP_011072928.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Sesamum indicum]
Length=344

 Score =   255 bits (652),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 135/143 (94%), Gaps = 2/143 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP--GVS  294
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRI+RQLGEGGFA+VYLVKE+L+DP+ P  G+S
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRILRQLGEGGFAFVYLVKELLSDPSNPADGIS  60

Query  295  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
            +K KDPSH S +GTYAMKKVLIQN+EQL+LV+EEIRVSS FSHPNLLPLLDHA+IAVKAS
Sbjct  61   RKIKDPSHVSGDGTYAMKKVLIQNNEQLELVREEIRVSSQFSHPNLLPLLDHAIIAVKAS  120

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
            + QSWKHEAYLLFPVH+DGTLLD
Sbjct  121  QDQSWKHEAYLLFPVHLDGTLLD  143



>ref|XP_009766540.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Nicotiana sylvestris]
Length=342

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+++D + PG+S K
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVISDTSNPGLSNK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
            FKD SH SD+GTYAMKKVLIQN+EQL+LVKEEIRVSSLF+H NLLPLLDHA+IAVKA+  
Sbjct  61   FKDSSHLSDDGTYAMKKVLIQNTEQLELVKEEIRVSSLFTHRNLLPLLDHAIIAVKAAPD  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
            QSWKHEAYLLFPVH+DGTLLD
Sbjct  121  QSWKHEAYLLFPVHLDGTLLD  141



>ref|XP_009607782.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Nicotiana tomentosiformis]
Length=342

 Score =   252 bits (644),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+++D + PG+S K
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVISDTSNPGLSNK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
            FKD SH SD+GTYAMKKVLIQN+EQL+LVKEEIRVSSLF+H NLLPLLDH +IAVKA+  
Sbjct  61   FKDSSHLSDDGTYAMKKVLIQNTEQLELVKEEIRVSSLFTHRNLLPLLDHGIIAVKAAPD  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
            QSWKHEAYLLFPVH+DGTLLD
Sbjct  121  QSWKHEAYLLFPVHLDGTLLD  141



>gb|EYU19016.1| hypothetical protein MIMGU_mgv1a009372mg [Erythranthe guttata]
Length=344

 Score =   252 bits (644),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 132/143 (92%), Gaps = 2/143 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP--GVS  294
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE+LADP+ P  G+S
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKELLADPSNPSNGIS  60

Query  295  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
             K KD SH S +GTYAMKKVLIQNSEQL+LV+EEI VSS FSHPNLLPLLDHA+IAVKAS
Sbjct  61   SKIKDSSHVSVDGTYAMKKVLIQNSEQLELVREEIHVSSQFSHPNLLPLLDHAIIAVKAS  120

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
            + Q+WKHEAYLLFPVH+DGTLLD
Sbjct  121  QEQTWKHEAYLLFPVHLDGTLLD  143



>gb|EPS69990.1| hypothetical protein M569_04770 [Genlisea aurea]
Length=341

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 133/143 (93%), Gaps = 2/143 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP--GVS  294
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE  ADP+ P  G+S
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKETPADPSDPAAGIS  60

Query  295  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
            +K KD +H S +GTYAMKK+LIQNSEQL++V+EEIRVSSLFSHPNLLPLLDHA+IAVKAS
Sbjct  61   RKIKDSAHVSGDGTYAMKKILIQNSEQLEMVREEIRVSSLFSHPNLLPLLDHAIIAVKAS  120

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
            + QSWKHEAYLLFPVH+DGTLLD
Sbjct  121  QDQSWKHEAYLLFPVHLDGTLLD  143



>ref|XP_008356645.1| PREDICTED: serine/threonine-protein kinase 16-like [Malus domestica]
Length=345

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 133/144 (92%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  291
            MGC+FSGL ALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE++AD +  G   +
Sbjct  1    MGCTFSGLGALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVVADSSASGGGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KKFKDPSH SD+GTYAMKKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+IAVK 
Sbjct  61   AKKFKDPSHVSDDGTYAMKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIIAVKT  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++ QSW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEQSWNHEAYLLFPVHLDGTLLD  144



>ref|XP_009337751.1| PREDICTED: serine/threonine-protein kinase 16-like [Pyrus x bretschneideri]
Length=345

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 133/144 (92%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  291
            MGC+FSGL ALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE++AD +  G   +
Sbjct  1    MGCTFSGLGALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVVADSSASGGGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KKFKDPSH SD+GTYAMKKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+IAVK 
Sbjct  61   AKKFKDPSHVSDDGTYAMKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIIAVKT  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++ QSW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEQSWNHEAYLLFPVHLDGTLLD  144



>ref|XP_006354740.1| PREDICTED: serine/threonine-protein kinase 16-like [Solanum tuberosum]
Length=339

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 133/141 (94%), Gaps = 3/141 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLN LYDAVNGGGDVWIN+NRF+I+RQLGEGGFAYV+LVKE+L+DP   G+SKK
Sbjct  1    MGCSFSGLNGLYDAVNGGGDVWINENRFKIIRQLGEGGFAYVFLVKEVLSDP---GISKK  57

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
            F+DPSH SD+GTYAMKKVLIQNSEQL++V+EEIRVSSLFSHPNLLPLLDHA+I+VK ++ 
Sbjct  58   FRDPSHISDDGTYAMKKVLIQNSEQLEMVREEIRVSSLFSHPNLLPLLDHAIISVKVAQD  117

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
            QS KHEAYLLFPVH+DGTLLD
Sbjct  118  QSLKHEAYLLFPVHLDGTLLD  138



>ref|XP_008351873.1| PREDICTED: serine/threonine-protein kinase 16-like [Malus domestica]
Length=271

 Score =   246 bits (627),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  291
            MGC+ SGL ALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE++AD +  G   +
Sbjct  1    MGCTXSGLGALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVVADSSASGGGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KKFKDPSH SD+GTYA+KKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+IAVK 
Sbjct  61   AKKFKDPSHVSDDGTYALKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIIAVKT  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++ QSW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEQSWNHEAYLLFPVHLDGTLLD  144



>gb|KHG15042.1| Serine/threonine-protein kinase 16 [Gossypium arboreum]
Length=345

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 132/144 (92%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  291
            MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKE+++D +     G+
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEVISDASSASSVGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK KDPSH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSHPNLLPLLDHA+IA+K 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFSHPNLLPLLDHAIIAIKP  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLD  144



>gb|KJB06908.1| hypothetical protein B456_001G066000 [Gossypium raimondii]
Length=345

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 132/144 (92%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  291
            MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKE+++D +     G+
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEVISDASSASSVGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK KDPSH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSHPNLLPLLDHA+IA+K 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFSHPNLLPLLDHAIIAIKP  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLD  144



>ref|XP_010678394.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Beta vulgaris subsp. vulgaris]
Length=344

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 131/143 (92%), Gaps = 2/143 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADP--AKPGVS  294
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYVYLVKE++ D   A  G+S
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVYLVKEVVTDASAASAGLS  60

Query  295  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
             K KDPS  SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I VKA+
Sbjct  61   NKLKDPSFLSDDGTYAMKKVLIQNTEQLELVREEIRVSSLFNHPNLLPLLDHAIIKVKAT  120

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
            + QSWKHEAYLLFPVH+DGTLLD
Sbjct  121  QEQSWKHEAYLLFPVHLDGTLLD  143



>ref|XP_008360890.1| PREDICTED: serine/threonine-protein kinase 16-like [Malus domestica]
Length=345

 Score =   245 bits (625),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  291
            MGC+ SGL ALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE++AD +  G   +
Sbjct  1    MGCTXSGLGALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVVADSSASGGGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KKFKDPSH SD+GTYA+KKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+IAVK 
Sbjct  61   AKKFKDPSHVSDDGTYALKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIIAVKT  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++ QSW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEQSWNHEAYLLFPVHLDGTLLD  144



>ref|XP_008367568.1| PREDICTED: serine/threonine-protein kinase 16-like [Malus domestica]
Length=345

 Score =   244 bits (624),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  291
            MGC+ SGL ALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE++AD +  G   +
Sbjct  1    MGCTXSGLGALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVVADSSASGGGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KKFKDPSH SD+GTYA+KKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+IAVK 
Sbjct  61   AKKFKDPSHVSDDGTYALKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIIAVKT  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++ QSW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEQSWNHEAYLLFPVHLDGTLLD  144



>gb|AFK34971.1| unknown [Lotus japonicus]
Length=184

 Score =   238 bits (608),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYD+VNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+  D A  G++ K
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVPNDSAAGGLANK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             K  SH SD+G+YAMKKVLIQN+EQL+LV+EEIRVSSLF+HPNLLPLLDHA+IAVK ++ 
Sbjct  61   LKHSSHISDDGSYAMKKVLIQNNEQLELVREEIRVSSLFNHPNLLPLLDHAIIAVKRTQE  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             SW HEAYLLFPVH+DGTLLD
Sbjct  121  TSWTHEAYLLFPVHLDGTLLD  141



>gb|KJB19472.1| hypothetical protein B456_003G104700 [Gossypium raimondii]
 gb|KJB19473.1| hypothetical protein B456_003G104700 [Gossypium raimondii]
Length=240

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 131/144 (91%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  291
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYVYLVKE+++D +     G+
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVYLVKEVVSDSSSALASGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK KDPSH SD+ TYA+KKVLIQN+EQLDLV+EEIRVSSLFSHPNLLPLLDH++I+VK 
Sbjct  61   AKKVKDPSHLSDDRTYAIKKVLIQNNEQLDLVREEIRVSSLFSHPNLLPLLDHSIISVKP  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLD  144



>gb|AFK43523.1| unknown [Lotus japonicus]
Length=202

 Score =   238 bits (607),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYD+VNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+  D A  G++ K
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVPNDSAAGGLANK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             K  SH SD+G+YAMKKVLIQN+EQL+LV+EEIRVSSLF+HPNLLPLLDHA+IAVK ++ 
Sbjct  61   LKHSSHISDDGSYAMKKVLIQNNEQLELVREEIRVSSLFNHPNLLPLLDHAIIAVKRTQE  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             SW HEAYLLFPVH+DGTLLD
Sbjct  121  TSWTHEAYLLFPVHLDGTLLD  141



>ref|XP_009597332.1| PREDICTED: serine/threonine-protein kinase 16-like [Nicotiana 
tomentosiformis]
Length=343

 Score =   242 bits (618),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYD  NGGGDVWIN+NRFRI++QLGEGG   V++VKEI++DP+ PG SKK
Sbjct  1    MGCSFSGLNALYDGANGGGDVWINENRFRILKQLGEGGLDNVFIVKEIISDPSNPGFSKK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
            FKDPS  SD+GTYAMKKVLIQN+EQL+LVKEEIRVSSLFSHPNLLPLLDHA+I+VKA++ 
Sbjct  61   FKDPSLVSDDGTYAMKKVLIQNNEQLELVKEEIRVSSLFSHPNLLPLLDHAIISVKATQD  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
            Q  KHEAYLLFPVH+DGTLLD
Sbjct  121  QPKKHEAYLLFPVHLDGTLLD  141



>ref|XP_009346448.1| PREDICTED: serine/threonine-protein kinase 16-like [Pyrus x bretschneideri]
Length=345

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 132/144 (92%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  291
            MGC+FSGL ALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE++AD +  G   +
Sbjct  1    MGCTFSGLGALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVVADSSSSGGGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KKFKD SH SD+GTYAMKKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+IAVK 
Sbjct  61   AKKFKDSSHVSDDGTYAMKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIIAVKT  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++ QSW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEQSWNHEAYLLFPVHLDGTLLD  144



>gb|KJB19471.1| hypothetical protein B456_003G104700 [Gossypium raimondii]
Length=255

 Score =   239 bits (610),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 131/144 (91%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  291
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYVYLVKE+++D +     G+
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVYLVKEVVSDSSSALASGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK KDPSH SD+ TYA+KKVLIQN+EQLDLV+EEIRVSSLFSHPNLLPLLDH++I+VK 
Sbjct  61   AKKVKDPSHLSDDRTYAIKKVLIQNNEQLDLVREEIRVSSLFSHPNLLPLLDHSIISVKP  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLD  144



>gb|KJB19474.1| hypothetical protein B456_003G104700 [Gossypium raimondii]
Length=271

 Score =   239 bits (610),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 131/144 (91%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  291
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYVYLVKE+++D +     G+
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVYLVKEVVSDSSSALASGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK KDPSH SD+ TYA+KKVLIQN+EQLDLV+EEIRVSSLFSHPNLLPLLDH++I+VK 
Sbjct  61   AKKVKDPSHLSDDRTYAIKKVLIQNNEQLDLVREEIRVSSLFSHPNLLPLLDHSIISVKP  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLD  144



>ref|XP_008453331.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X3 
[Cucumis melo]
Length=288

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 130/145 (90%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPA----KPG  288
            MGC+FSGLNA YDAVN GGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+LAD +    + G
Sbjct  1    MGCTFSGLNAFYDAVNSGGDVWINENRFRIVRQLGEGGFAYVFLVKEVLADTSSDAVQSG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            + KKFKD +H SD+G+YA+KKVLIQN+EQL+LVKEEIRVSSLFSHPNLLPLLDHA+IA K
Sbjct  61   LRKKFKDSTHLSDDGSYALKKVLIQNNEQLELVKEEIRVSSLFSHPNLLPLLDHAIIATK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
             ++ +SW HEAYLLFPVH+DGTLLD
Sbjct  121  PTQERSWNHEAYLLFPVHLDGTLLD  145



>ref|XP_007155191.1| hypothetical protein PHAVU_003G181000g [Phaseolus vulgaris]
 gb|ESW27185.1| hypothetical protein PHAVU_003G181000g [Phaseolus vulgaris]
Length=342

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYD+VN GGD WIN+NRFRIVRQLGEGGFAYVYLVKE++ D A  G++ K
Sbjct  1    MGCSFSGLNALYDSVNNGGDAWINENRFRIVRQLGEGGFAYVYLVKELINDSAASGLANK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             KD SH S++GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSHPNLLPLLDHA+I+VK ++ 
Sbjct  61   LKDSSHVSEDGTYAMKKVLIQNNEQLELVREEIRVSSLFSHPNLLPLLDHAIISVKPTQE  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             SW HEAYLLFPVHMDGTLLD
Sbjct  121  TSWNHEAYLLFPVHMDGTLLD  141



>ref|XP_010099029.1| Serine/threonine-protein kinase 16 [Morus notabilis]
 gb|EXB76387.1| Serine/threonine-protein kinase 16 [Morus notabilis]
Length=345

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 130/143 (91%), Gaps = 2/143 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG--VS  294
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRI+RQLGEGGFAYV+LVKE++ D +  G  ++
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIIRQLGEGGFAYVFLVKEVVTDTSANGGGLA  60

Query  295  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
            KK KD SH SD+GTYAMKKVLIQNSEQL+LV+EEI VSSLF HPNLLPLLDHA+IAVKA+
Sbjct  61   KKVKDSSHLSDDGTYAMKKVLIQNSEQLELVREEIHVSSLFCHPNLLPLLDHAIIAVKAT  120

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
            +  SWKHEAYLLFPVH+DGTLLD
Sbjct  121  QEGSWKHEAYLLFPVHLDGTLLD  143



>ref|XP_007037718.1| Serine/threonine protein kinase 3 isoform 2 [Theobroma cacao]
 gb|EOY22219.1| Serine/threonine protein kinase 3 isoform 2 [Theobroma cacao]
Length=271

 Score =   238 bits (608),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  291
            MGC+FSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYV+LVKE+++D +     G+
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVFLVKEVMSDSSSASASGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK KDPSH SD+GTYAMKKVLIQN+EQL LV+EEIRVSSLFSHP+LLPLLDHA+IAVK 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNNEQLQLVREEIRVSSLFSHPHLLPLLDHAIIAVKP  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLD  144



>ref|XP_008453330.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X2 
[Cucumis melo]
Length=311

 Score =   239 bits (610),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 130/145 (90%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPA----KPG  288
            MGC+FSGLNA YDAVN GGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+LAD +    + G
Sbjct  1    MGCTFSGLNAFYDAVNSGGDVWINENRFRIVRQLGEGGFAYVFLVKEVLADTSSDAVQSG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            + KKFKD +H SD+G+YA+KKVLIQN+EQL+LVKEEIRVSSLFSHPNLLPLLDHA+IA K
Sbjct  61   LRKKFKDSTHLSDDGSYALKKVLIQNNEQLELVKEEIRVSSLFSHPNLLPLLDHAIIATK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
             ++ +SW HEAYLLFPVH+DGTLLD
Sbjct  121  PTQERSWNHEAYLLFPVHLDGTLLD  145



>gb|KDO65614.1| hypothetical protein CISIN_1g024842mg [Citrus sinensis]
Length=262

 Score =   238 bits (606),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL---ADPAKPGV  291
            MGCS SGLNALYD+VNGGGDVWIN+NR+RI+RQLGEGGFAYVYLVKE +   A  A  G+
Sbjct  1    MGCSLSGLNALYDSVNGGGDVWINENRYRILRQLGEGGFAYVYLVKETVTTDASAASGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            + K KDPSH SD+GTYAMKKVLIQN+EQL++V+EEIRVSSLFSH NLLPLLDHA+IAVKA
Sbjct  61   ANKVKDPSHLSDDGTYAMKKVLIQNNEQLEMVREEIRVSSLFSHRNLLPLLDHAIIAVKA  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SWKHEAYLLFPVH+DGTLLD
Sbjct  121  NQEGSWKHEAYLLFPVHLDGTLLD  144



>ref|XP_007037719.1| Serine/threonine protein kinase 3 isoform 3 [Theobroma cacao]
 gb|EOY22220.1| Serine/threonine protein kinase 3 isoform 3 [Theobroma cacao]
Length=279

 Score =   238 bits (606),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  291
            MGC+FSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYV+LVKE+++D +     G+
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVFLVKEVMSDSSSASASGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK KDPSH SD+GTYAMKKVLIQN+EQL LV+EEIRVSSLFSHP+LLPLLDHA+IAVK 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNNEQLQLVREEIRVSSLFSHPHLLPLLDHAIIAVKP  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLD  144



>ref|XP_004299264.1| PREDICTED: serine/threonine-protein kinase 16 [Fragaria vesca 
subsp. vesca]
Length=343

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAK-PGVSK  297
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFA+V+LVKE+++D +    ++ 
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAFVFLVKEVVSDSSSATSLAN  60

Query  298  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  477
            KFKD SH SD+GTYAMKKVLIQNSEQL+LVKEEI+VSSLF+HPNLLPLLDHA+I+VK ++
Sbjct  61   KFKDASHVSDDGTYAMKKVLIQNSEQLELVKEEIQVSSLFTHPNLLPLLDHAIISVKPTQ  120

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
             QSW HEAYLLFPVH+DGTLLD
Sbjct  121  DQSWNHEAYLLFPVHLDGTLLD  142



>ref|XP_010031327.1| PREDICTED: serine/threonine-protein kinase 16 [Eucalyptus grandis]
 gb|KCW83786.1| hypothetical protein EUGRSUZ_B00658 [Eucalyptus grandis]
Length=345

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 130/144 (90%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  291
            MGC+FSGLNALYDAVNGGGDVWIN+NRFRI+RQLGEGGFA+VYLVKE++ D +     G+
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINENRFRILRQLGEGGFAFVYLVKEVVNDNSSVSGGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK KDPSH SD+GTYAMKKVLIQNSEQL+LV+EEIRVSSLFSHPNLLPLLDHA+IAVK 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNSEQLELVREEIRVSSLFSHPNLLPLLDHAIIAVKT  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SW HEAYLLFPVH+DGTL D
Sbjct  121  AQEGSWNHEAYLLFPVHLDGTLFD  144



>ref|XP_006440851.1| hypothetical protein CICLE_v10021674mg [Citrus clementina]
 gb|ESR54091.1| hypothetical protein CICLE_v10021674mg [Citrus clementina]
Length=269

 Score =   237 bits (605),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL---ADPAKPGV  291
            MGCS SGLNALYD+VNGGGDVWIN+NR+RI+RQLGEGGFAYVYLVKE +   A  A  G+
Sbjct  1    MGCSLSGLNALYDSVNGGGDVWINENRYRILRQLGEGGFAYVYLVKETVTTDASAASGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            + K KDPSH SD+GTYAMKKVLIQN+EQL++V+EEIRVSSLFSH NLLPLLDHA+IAVKA
Sbjct  61   ANKVKDPSHLSDDGTYAMKKVLIQNNEQLEMVREEIRVSSLFSHRNLLPLLDHAIIAVKA  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SWKHEAYLLFPVH+DGTLLD
Sbjct  121  NQEGSWKHEAYLLFPVHLDGTLLD  144



>emb|CDO98513.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 134/144 (93%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEI-LADPAK-PGVS  294
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR++RQLGEGGFAYVYLVKEI  +DP+   G+S
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVIRQLGEGGFAYVYLVKEIPSSDPSSNAGLS  60

Query  295  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA-  471
            KK K+ SH S++GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSHPNLLPLLDHA+IA+KA 
Sbjct  61   KKCKNSSHLSEDGTYAMKKVLIQNTEQLELVREEIRVSSLFSHPNLLPLLDHAIIAIKAP  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++ QSWKHEAYLLFPVH+DGTL+D
Sbjct  121  TQDQSWKHEAYLLFPVHLDGTLMD  144



>gb|ACU19230.1| unknown [Glycine max]
Length=230

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPA-KPGVSK  297
            MGCSFSGLNALYD+VNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE   D A   G+SK
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKETPNDSAVAAGLSK  60

Query  298  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  477
            K K  SH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLF+HPNLLPLL+HA+I+VK ++
Sbjct  61   KLKGSSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFNHPNLLPLLEHAIISVKPTQ  120

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
              SW HEAYLLFPVH+DGTLLD
Sbjct  121  ETSWNHEAYLLFPVHLDGTLLD  142



>gb|KJB19470.1| hypothetical protein B456_003G104700 [Gossypium raimondii]
Length=345

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 131/144 (91%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  291
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+IVRQLGEGGFAYVYLVKE+++D +     G+
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKIVRQLGEGGFAYVYLVKEVVSDSSSALASGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK KDPSH SD+ TYA+KKVLIQN+EQLDLV+EEIRVSSLFSHPNLLPLLDH++I+VK 
Sbjct  61   AKKVKDPSHLSDDRTYAIKKVLIQNNEQLDLVREEIRVSSLFSHPNLLPLLDHSIISVKP  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLD  144



>ref|XP_008453329.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X1 
[Cucumis melo]
Length=346

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 130/145 (90%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPA----KPG  288
            MGC+FSGLNA YDAVN GGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+LAD +    + G
Sbjct  1    MGCTFSGLNAFYDAVNSGGDVWINENRFRIVRQLGEGGFAYVFLVKEVLADTSSDAVQSG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            + KKFKD +H SD+G+YA+KKVLIQN+EQL+LVKEEIRVSSLFSHPNLLPLLDHA+IA K
Sbjct  61   LRKKFKDSTHLSDDGSYALKKVLIQNNEQLELVKEEIRVSSLFSHPNLLPLLDHAIIATK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
             ++ +SW HEAYLLFPVH+DGTLLD
Sbjct  121  PTQERSWNHEAYLLFPVHLDGTLLD  145



>emb|CDY21515.1| BnaC09g47770D [Brassica napus]
Length=343

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR+VRQLGEGGFA+VYLVKEI+AD +  G++KK
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVVRQLGEGGFAFVYLVKEIVADASGGGLAKK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             KDPSH S +GTYA+KKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK  +G
Sbjct  61   VKDPSHISADGTYAVKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVKDGQG  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             + KHEA+LLFPVH+DGTLLD
Sbjct  121  GARKHEAFLLFPVHLDGTLLD  141



>ref|XP_002512018.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF50687.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=347

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 129/146 (88%), Gaps = 5/146 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP-----  285
            MGC+FSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE+L           
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKEVLVTDTSAIAGGG  60

Query  286  GVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAV  465
            G++KK KD SH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSHPNLLPLLDHA+I+V
Sbjct  61   GLAKKVKDTSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFSHPNLLPLLDHAIISV  120

Query  466  KASEGQSWKHEAYLLFPVHMDGTLLD  543
            KA++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  KANQEGSWNHEAYLLFPVHLDGTLLD  146



>ref|XP_007037717.1| Serine/threonine protein kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY22218.1| Serine/threonine protein kinase 3 isoform 1 [Theobroma cacao]
Length=345

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GV  291
            MGC+FSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYV+LVKE+++D +     G+
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVFLVKEVMSDSSSASASGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK KDPSH SD+GTYAMKKVLIQN+EQL LV+EEIRVSSLFSHP+LLPLLDHA+IAVK 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNNEQLQLVREEIRVSSLFSHPHLLPLLDHAIIAVKP  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLD  144



>ref|XP_003609185.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES91382.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=342

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYD+VNGGGDVWIN+NRFRI+RQLGEGGFAYVYLVKE   D A  G++ K
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRFRILRQLGEGGFAYVYLVKEAPNDSATGGLANK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             KD SH +D+G+YAMKKVLIQN+EQL+LV+EEIRVSSLFSHPNLLPLLDHA+I+VK ++ 
Sbjct  61   LKDSSHLADDGSYAMKKVLIQNNEQLELVREEIRVSSLFSHPNLLPLLDHAIISVKPTQE  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             SW HEAYLLFPVH+DGTLLD
Sbjct  121  TSWSHEAYLLFPVHLDGTLLD  141



>ref|XP_007209310.1| hypothetical protein PRUPE_ppa008104mg [Prunus persica]
 gb|EMJ10509.1| hypothetical protein PRUPE_ppa008104mg [Prunus persica]
Length=345

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 132/144 (92%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  291
            MGC+FSGLNALYDAVNGGGDVWIN+ RF+IVRQLGEGGFAYV+LVKE+++D +  G   +
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINETRFKIVRQLGEGGFAYVFLVKEVVSDSSASGGGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KKFKDPSH SD+GTYAMKKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+I+VK 
Sbjct  61   AKKFKDPSHVSDDGTYAMKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIISVKP  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEASWNHEAYLLFPVHLDGTLLD  144



>ref|XP_009798655.1| PREDICTED: serine/threonine-protein kinase 16-like [Nicotiana 
sylvestris]
Length=343

 Score =   237 bits (605),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYD  NGGGDVWIN+NRFRI++QLGEGG   V++VKEI++DP+ P  SKK
Sbjct  1    MGCSFSGLNALYDGANGGGDVWINENRFRILKQLGEGGLDNVFIVKEIISDPSIPSFSKK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             KDPS  SD+GTYAMKKV+IQN+EQL+LVKEEIRVSSLFSHPNLLPLLDHA+I+VKAS+ 
Sbjct  61   LKDPSLVSDDGTYAMKKVIIQNNEQLELVKEEIRVSSLFSHPNLLPLLDHAIISVKASQD  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
            Q  KHEAYLLFPVH+DGTLLD
Sbjct  121  QPKKHEAYLLFPVHLDGTLLD  141



>ref|XP_006485732.1| PREDICTED: serine/threonine-protein kinase 16-like [Citrus sinensis]
Length=349

 Score =   237 bits (605),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 131/144 (91%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL---ADPAKPGV  291
            MGCSFSGLNALYD+VNGGGDVWIN+NR+RI+RQLGEGGFAYVYLVKE++   A  A  G+
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRYRILRQLGEGGFAYVYLVKEMVTTDASAASGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            + K KDPSH SD+GTYAMKKVLIQN+EQL++V+EEIRVSSLFSH NLLPLLDHA+IAVKA
Sbjct  61   ANKVKDPSHLSDDGTYAMKKVLIQNNEQLEMVREEIRVSSLFSHRNLLPLLDHAIIAVKA  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SWKHEAYLLFPVH+DGTLLD
Sbjct  121  NQEGSWKHEAYLLFPVHLDGTLLD  144



>ref|XP_008240053.1| PREDICTED: serine/threonine-protein kinase 16 [Prunus mume]
Length=346

 Score =   237 bits (605),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 132/145 (91%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG----  288
            MGC+FSGLNALYDAVNGGGDVWIN+ RF+IVRQLGEGGFAYV+LVKE+++D +  G    
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINETRFKIVRQLGEGGFAYVFLVKEVVSDSSASGGGGG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            ++KKFKDPSH SD+GTYAMKKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+I+VK
Sbjct  61   LAKKFKDPSHVSDDGTYAMKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIISVK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
             ++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  PTQEASWNHEAYLLFPVHLDGTLLD  145



>ref|XP_003524500.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
[Glycine max]
Length=342

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYD+VNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE   D A  G++KK
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKEAPDDSAAAGLAKK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             K  SH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLF+HPNLLPLL+HA+I+VK +  
Sbjct  61   LKGSSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFNHPNLLPLLEHAIISVKPTHE  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             SW HEAYLLFPVH+DGTLLD
Sbjct  121  TSWNHEAYLLFPVHLDGTLLD  141



>ref|XP_004508637.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X1 
[Cicer arietinum]
 ref|XP_004508638.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X2 
[Cicer arietinum]
Length=342

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALY +VNGGGDVWIN+NRFRI+RQLGEGGFAYVYLVKE+  + A  G++ K
Sbjct  1    MGCSFSGLNALYTSVNGGGDVWINENRFRILRQLGEGGFAYVYLVKELPNESATGGLANK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             KD SH SD+G+YAMKKVLIQNSEQL+LV+EEIRVSSLFSHPNLLPLLDHA+I+VK +  
Sbjct  61   IKDSSHISDDGSYAMKKVLIQNSEQLELVREEIRVSSLFSHPNLLPLLDHAIISVKPTPE  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             SW HEAYLLFPVH+DGTLLD
Sbjct  121  TSWSHEAYLLFPVHLDGTLLD  141



>ref|XP_004138208.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
[Cucumis sativus]
 ref|XP_004154941.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
[Cucumis sativus]
 gb|KGN63753.1| Serine/threonine protein kinase [Cucumis sativus]
Length=346

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 129/145 (89%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPA----KPG  288
            MGC+FSGLNA YDAVN GGDVWIN+NRFRIVRQLGEGGFAYV+LVKE+LAD +    + G
Sbjct  1    MGCTFSGLNAFYDAVNSGGDVWINENRFRIVRQLGEGGFAYVFLVKELLADTSSDAVQSG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            + KKFKD +H SD+G+YA+KKVLIQ +EQL+LVKEEIRVSSLFSHPNLLPLLDHA+IA K
Sbjct  61   LRKKFKDSTHLSDDGSYALKKVLIQTNEQLELVKEEIRVSSLFSHPNLLPLLDHAIIATK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
             ++ +SW HEAYLLFPVH+DGTLLD
Sbjct  121  PTQERSWNHEAYLLFPVHLDGTLLD  145



>dbj|BAJ53163.1| JHL10I11.9 [Jatropha curcas]
 gb|KDP20046.1| hypothetical protein JCGZ_05815 [Jatropha curcas]
Length=350

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 129/149 (87%), Gaps = 8/149 (5%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG----  288
            MGC+FSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE++ D +       
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKEVVTDSSASTGGGV  60

Query  289  ----VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAV  456
                ++KK KD SH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSHPNLLPLLDHA+
Sbjct  61   AGGGLAKKVKDTSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFSHPNLLPLLDHAI  120

Query  457  IAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            IAVK ++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  IAVKNNQEGSWNHEAYLLFPVHLDGTLLD  149



>ref|XP_006844169.1| hypothetical protein AMTR_s00006p00262500 [Amborella trichopoda]
 gb|ERN05844.1| hypothetical protein AMTR_s00006p00262500 [Amborella trichopoda]
Length=338

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 126/141 (89%), Gaps = 4/141 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYDAVNGGGDVWIN+NR+RI+RQLGEGGFA+VYLVKE++A+    G  KK
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRYRIIRQLGEGGFAFVYLVKEVVAE----GSVKK  56

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             KDPSH SDNG YA+KKVLIQ  EQL+LV++EIRVSSLFSHPNLLPLLDHA+IAVK ++ 
Sbjct  57   LKDPSHISDNGMYAVKKVLIQTPEQLELVRQEIRVSSLFSHPNLLPLLDHAIIAVKGTQE  116

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             SW HEAYLLFPVH+DGTLLD
Sbjct  117  GSWNHEAYLLFPVHLDGTLLD  137



>ref|NP_196433.1| serine/threonine protein kinase 3 [Arabidopsis thaliana]
 gb|AAG40409.1|AF325057_1 AT5g08160 [Arabidopsis thaliana]
 gb|AAB69123.1| serine/threonine protein kinase [Arabidopsis thaliana]
 emb|CAB93717.1| serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAN60359.1| unknown [Arabidopsis thaliana]
 gb|ABF18990.1| At5g08160 [Arabidopsis thaliana]
 gb|AED91259.1| serine/threonine protein kinase 3 [Arabidopsis thaliana]
Length=347

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 130/145 (90%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  288
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI+AD +      G
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVADASSAASGGG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
              +  +WKHEA+LLFPVH+DGTLLD
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLD  145



>gb|AAM65833.1| serine/threonine protein kinase [Arabidopsis thaliana]
Length=347

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 130/145 (90%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  288
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI+AD +      G
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVADASSAASGGG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
              +  +WKHEA+LLFPVH+DGTLLD
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLD  145



>emb|CDX69971.1| BnaA10g23200D [Brassica napus]
Length=343

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR+VRQLGEGGFA+V+LVKEI++D +  G++KK
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVVRQLGEGGFAFVFLVKEIVSDASAGGLAKK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             KDPSH S +GTYA+KKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK  +G
Sbjct  61   VKDPSHLSVDGTYAVKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVKDGQG  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             + KHEA+LLFPVH+DGTLLD
Sbjct  121  GARKHEAFLLFPVHLDGTLLD  141



>ref|XP_006399302.1| hypothetical protein EUTSA_v10013995mg [Eutrema salsugineum]
 gb|ESQ40755.1| hypothetical protein EUTSA_v10013995mg [Eutrema salsugineum]
Length=347

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 130/145 (90%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  288
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR+VRQLGEGGFA+V+LVKEI+AD +      G
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVVRQLGEGGFAFVFLVKEIVADASSAASGGG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
              +  +WKHEA+LLFPVH+DGTLLD
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLD  145



>ref|XP_010423128.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Camelina sativa]
Length=347

 Score =   235 bits (599),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 131/145 (90%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADP---AKPG-  288
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR+VRQLGEGGFA+V+LVKEI+AD    A PG 
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVVRQLGEGGFAFVFLVKEIVADAPSAASPGG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
              +  +WKHEA+LLFPVH+DGTLLD
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLD  145



>gb|KFK25181.1| hypothetical protein AALP_AA8G077200 [Arabis alpina]
Length=348

 Score =   235 bits (599),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 130/145 (90%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  288
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR+VRQLGEGGFA+V+LVKEI+AD +      G
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVVRQLGEGGFAFVFLVKEIVADASSAASGGG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
              +  +WKHEA+LLFPVH+DGTLLD
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLD  145



>ref|XP_006600612.1| PREDICTED: serine/threonine-protein kinase 16 [Glycine max]
 gb|KHN18398.1| Serine/threonine-protein kinase 16 [Glycine soja]
Length=343

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPA-KPGVSK  297
            MGCSFSGLNALYD+VNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE   D A   G+SK
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKETPNDSAVAAGLSK  60

Query  298  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  477
            K K  SH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLF+HPNLLPLL+HA+I+VK ++
Sbjct  61   KLKGSSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFNHPNLLPLLEHAIISVKPTQ  120

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
              SW HEAYLLFPVH+DGTLLD
Sbjct  121  ETSWNHEAYLLFPVHLDGTLLD  142



>ref|XP_006288089.1| hypothetical protein CARUB_v10001319mg [Capsella rubella]
 gb|EOA20987.1| hypothetical protein CARUB_v10001319mg [Capsella rubella]
Length=347

 Score =   234 bits (598),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 130/145 (90%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  288
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR+VRQLGEGGFA+V+LVKEI+AD +      G
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVVRQLGEGGFAFVFLVKEIVADASSATSGGG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
              +  +WKHEA+LLFPVH+DGTLLD
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLD  145



>ref|XP_010522295.1| PREDICTED: serine/threonine-protein kinase 16-like [Tarenaya 
hassleriana]
Length=349

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 128/145 (88%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  288
            MGC+FSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+VYLVKE + D +      G
Sbjct  1    MGCTFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVYLVKETVTDASAAASGGG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLFSHPNLLPLLDHA+I+VK
Sbjct  61   MAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFSHPNLLPLLDHAIISVK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
              +  +WKHEA+LLFPVH+DGTLLD
Sbjct  121  DGQEGTWKHEAFLLFPVHLDGTLLD  145



>ref|XP_002873344.1| hypothetical protein ARALYDRAFT_487651 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49603.1| hypothetical protein ARALYDRAFT_487651 [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 130/145 (90%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  288
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI+AD +      G
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVADASSAASGGG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            ++KK K+P+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKNPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
              +  +WKHEA+LLFPVH+DGTLLD
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLD  145



>gb|EPS73700.1| hypothetical protein M569_01056 [Genlisea aurea]
Length=336

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGL A YD VNGG DVWIN NRFRIVRQLGEGGFAYV+LVKE+L+D    G S+K
Sbjct  1    MGCSFSGLTAFYDVVNGGDDVWINGNRFRIVRQLGEGGFAYVFLVKELLSD-FTAGFSRK  59

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             KDP+H SD+GTYAMKKVLIQNSEQL +V+EEIRVSSLF+HPNLLPLLDHA+IAVKA + 
Sbjct  60   IKDPAHVSDDGTYAMKKVLIQNSEQLKIVREEIRVSSLFTHPNLLPLLDHAIIAVKAPD-  118

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
            QSWKHEAY LFPVHM GTLLD
Sbjct  119  QSWKHEAYFLFPVHMGGTLLD  139



>ref|XP_009131040.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Brassica rapa]
Length=345

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG-VSK  297
            MGCS SGLN+LYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+VYLVKEI+AD +  G ++K
Sbjct  1    MGCSLSGLNSLYDAVNGGGDVWINENRFRIVRQLGEGGFAFVYLVKEIVADASSGGGLAK  60

Query  298  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  477
            K KDP+H S +GTYAMKK+LIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK  +
Sbjct  61   KVKDPAHLSADGTYAMKKILIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVKDGQ  120

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
               WKHEA+LLFPVH+DGTLLD
Sbjct  121  EGGWKHEAFLLFPVHLDGTLLD  142



>emb|CDY67889.1| BnaAnng25480D [Brassica napus]
Length=345

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG-VSK  297
            MGCS SGLN+LYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI+AD +  G ++K
Sbjct  1    MGCSLSGLNSLYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVADASSGGGLAK  60

Query  298  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  477
            K KDP+H S +GTYAMKK+LIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK  +
Sbjct  61   KVKDPAHLSADGTYAMKKILIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVKDGQ  120

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
               WKHEA+LLFPVH+DGTLLD
Sbjct  121  EGGWKHEAFLLFPVHLDGTLLD  142



>gb|KJB51100.1| hypothetical protein B456_008G201200 [Gossypium raimondii]
 gb|KJB51101.1| hypothetical protein B456_008G201200 [Gossypium raimondii]
Length=345

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 127/144 (88%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAK---PGV  291
            MGC+FSG NA+YDA NGGGDVWIND RF+IVRQLGEGGFAYVYLVKE+ +D +     G+
Sbjct  1    MGCTFSGFNAMYDAANGGGDVWINDIRFKIVRQLGEGGFAYVYLVKEVTSDSSSISAGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK KDPSH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSH NLLPLLDHA+I+VK 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFSHHNLLPLLDHAIISVKP  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLD  144



>gb|AIZ68208.1| Serine/threonine-protein kinase 16 [Ornithogalum saundersiae]
Length=341

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 129/142 (91%), Gaps = 3/142 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVS-K  297
            MGCSFSGLNALYDAVNGGGDVWIN+NRF+I+RQLGEGGFAYVYLVKE+++D    G++ K
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFKILRQLGEGGFAYVYLVKEVVSDGG--GIAGK  58

Query  298  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  477
            K K+PSH SD+GTYAMKKVLIQ+ EQL LV+EEI VSSLFSHPNLLPLLDHA+IAVK ++
Sbjct  59   KIKNPSHISDDGTYAMKKVLIQSEEQLALVREEIHVSSLFSHPNLLPLLDHAIIAVKDNQ  118

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
              SW+HEAYLLFPVH+DGTLLD
Sbjct  119  QGSWRHEAYLLFPVHLDGTLLD  140



>ref|XP_002269355.1| PREDICTED: serine/threonine-protein kinase 16 [Vitis vinifera]
 emb|CBI15371.3| unnamed protein product [Vitis vinifera]
Length=341

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 128/141 (91%), Gaps = 1/141 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVR LGEGGFAYV+LVKE++ D +    SKK
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRPLGEGGFAYVFLVKEVVTDSSS-SASKK  59

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
            FKDPSH SD+GTYAMKKVLIQNSEQL+LV+EEIRVSSLFSHPNLLPLLDHA+I VK  + 
Sbjct  60   FKDPSHVSDDGTYAMKKVLIQNSEQLELVREEIRVSSLFSHPNLLPLLDHAIIGVKTPQE  119

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             +WKHEAYLLFPVH+DGTLLD
Sbjct  120  GAWKHEAYLLFPVHLDGTLLD  140



>ref|XP_010491440.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Camelina sativa]
Length=347

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 128/145 (88%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  288
            MGCSFSGLNALYDAVNGG DVWIN+NRFR+VRQLGEGGFA+V+LVKEI+AD        G
Sbjct  1    MGCSFSGLNALYDAVNGGADVWINENRFRVVRQLGEGGFAFVFLVKEIVADAPSAASAGG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            ++KK KDP+H S +GTYA+KKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAIKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
              +  +WKHEA+LLFPVH+DGTLLD
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLD  145



>ref|XP_002317918.2| hypothetical protein POPTR_0012s05390g [Populus trichocarpa]
 gb|EEE96138.2| hypothetical protein POPTR_0012s05390g [Populus trichocarpa]
Length=352

 Score =   229 bits (585),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 129/151 (85%), Gaps = 10/151 (7%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL--ADPAKPG--  288
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE++  + PA  G  
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKEVVNVSSPASSGGR  60

Query  289  ------VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDH  450
                  +SKK KD SH S +GTYAMKKVLIQN+EQL+ V+EEIRVSSLF+H NLLPLLDH
Sbjct  61   AAVGGGLSKKVKDKSHLSVDGTYAMKKVLIQNNEQLEFVREEIRVSSLFNHSNLLPLLDH  120

Query  451  AVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            A+I+VKA++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  AIISVKATQEGSWNHEAYLLFPVHLDGTLLD  151



>ref|XP_010452793.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Camelina sativa]
Length=347

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 130/145 (90%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP----G  288
            MGCSFSGLNALYDAVNGGGDVWIN+NRFR+VRQLGEGGFA+V+LVKEI+AD +      G
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRVVRQLGEGGFAFVFLVKEIVADASSAASAGG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            ++KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
              +  +WKHEA+LLFPVH+DGTLLD
Sbjct  121  DGQEGAWKHEAFLLFPVHLDGTLLD  145



>emb|CDY70989.1| BnaC03g71390D [Brassica napus]
Length=344

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG-VSK  297
            MGCS SGLN+LYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI++D +  G ++ 
Sbjct  1    MGCSLSGLNSLYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVSDASSGGGLAN  60

Query  298  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  477
            K KDP+H S +GTYAMKK+LIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK  +
Sbjct  61   KVKDPAHLSADGTYAMKKILIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVKDGQ  120

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
               WKHEA+LLFPVH+DGTLLD
Sbjct  121  EGGWKHEAFLLFPVHLDGTLLD  142



>emb|CAN66918.1| hypothetical protein VITISV_043041 [Vitis vinifera]
Length=341

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 127/141 (90%), Gaps = 1/141 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYDAVNGGGDVWIN+NRF IVR LGEGGFAYV+LVKE++ D +    SKK
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFXIVRPLGEGGFAYVFLVKEVVTDSSS-SASKK  59

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
            FKDPSH SD+GTYAMKKVLIQNSEQL+LV+EEIRVSSLFSHPNLLPLLDHA+I VK  + 
Sbjct  60   FKDPSHVSDDGTYAMKKVLIQNSEQLELVREEIRVSSLFSHPNLLPLLDHAIIGVKTPQE  119

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             +WKHEAYLLFPVH+DGTLLD
Sbjct  120  GAWKHEAYLLFPVHLDGTLLD  140



>gb|AAZ39949.1| serine/threonine protein kinase [Gossypium hirsutum]
Length=345

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 126/144 (88%), Gaps = 3/144 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAK---PGV  291
            MGC+FSG NA+YDA NG GD+WIND RF+IVRQLGEGGFAYVYLVKE+ +D +     G+
Sbjct  1    MGCTFSGFNAMYDAANGEGDIWINDIRFKIVRQLGEGGFAYVYLVKEVTSDSSSISAGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK KDPSH SD+GTYAMKKVLIQN+EQL+LV+EEIRVSSLFSH NLLPLLDHA+I+VK 
Sbjct  61   AKKVKDPSHLSDDGTYAMKKVLIQNNEQLELVREEIRVSSLFSHRNLLPLLDHAIISVKP  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            ++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  TQEGSWNHEAYLLFPVHLDGTLLD  144



>ref|XP_009396202.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Musa acuminata subsp. malaccensis]
Length=342

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNA YDAVNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE++AD A      K
Sbjct  1    MGCSFSGLNAFYDAVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVVADGAAGLARNK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
              DPSH SD+GTYAMKKV+IQ  EQL+LVK+EIRVSSLF+HPNLLPLLDH VI VK ++ 
Sbjct  61   SIDPSHISDHGTYAMKKVIIQTEEQLELVKQEIRVSSLFNHPNLLPLLDHVVIPVKGTQD  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             S KHEAYLLFPVH+DGTLLD
Sbjct  121  GSRKHEAYLLFPVHLDGTLLD  141



>ref|XP_006374373.1| hypothetical protein POPTR_0015s06550g [Populus trichocarpa]
 gb|ERP52170.1| hypothetical protein POPTR_0015s06550g [Populus trichocarpa]
Length=350

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 127/149 (85%), Gaps = 8/149 (5%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL--------ADP  276
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE++           
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVVNASAPASGGGA  60

Query  277  AKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAV  456
               G+SKK KD SH S +GTYAMKKVLIQN+EQL+LV+EEI VSSLF+HPNLLPLLDHA+
Sbjct  61   VAGGLSKKVKDKSHLSGDGTYAMKKVLIQNNEQLELVREEIHVSSLFNHPNLLPLLDHAI  120

Query  457  IAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            IAVKA++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  IAVKATQEGSWNHEAYLLFPVHLDGTLLD  149



>gb|ABK92466.1| unknown [Populus trichocarpa]
Length=350

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 127/149 (85%), Gaps = 8/149 (5%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL--------ADP  276
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE++           
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVVNASAPASGGGA  60

Query  277  AKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAV  456
               G+SKK KD SH S +GTYAMKKVLIQN+EQL+LV+EEI VSSLF+HPNLLPLLDHA+
Sbjct  61   VAGGLSKKVKDKSHLSGDGTYAMKKVLIQNNEQLELVREEIHVSSLFNHPNLLPLLDHAI  120

Query  457  IAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            IAVKA++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  IAVKATQEGSWNHEAYLLFPVHLDGTLLD  149



>ref|XP_010261723.1| PREDICTED: serine/threonine-protein kinase 16-like [Nelumbo nucifera]
Length=346

 Score =   227 bits (578),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 126/145 (87%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG----  288
            MGCSFSGLNALYDAVNGG DVWINDNRF+I+RQLGEGGF+YVYLVKE++ D A  G    
Sbjct  1    MGCSFSGLNALYDAVNGGEDVWINDNRFKILRQLGEGGFSYVYLVKEVVEDVAGDGGGGG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            + KK KD S  SD+GTYAMKKVLIQ +EQL+LV+EEIRVSSLFSHPNLLPLLDHA+I VK
Sbjct  61   IRKKIKDSSFVSDDGTYAMKKVLIQTNEQLELVREEIRVSSLFSHPNLLPLLDHAIIQVK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
            A++ +SW  EAYLLFPVH+DGTLLD
Sbjct  121  ATQERSWNSEAYLLFPVHLDGTLLD  145



>ref|NP_001267650.1| serine/threonine-protein kinase 16-like [Cucumis sativus]
 ref|XP_004157430.1| PREDICTED: serine/threonine-protein kinase 16-like [Cucumis sativus]
 emb|CAI30891.1| somatic embryogenesis serine-threonine protein kinase 1 [Cucumis 
sativus]
 gb|KGN64092.1| hypothetical protein Csa_1G041540 [Cucumis sativus]
Length=344

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 132/144 (92%), Gaps = 4/144 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  291
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKE+++D + P    +
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEVVSDSSSPSGGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK KDPS  S +GTYA+KKVLIQ+SEQL+LV+EEIR+SSLFSHPNLLPLLDHA+IAVK+
Sbjct  61   AKKLKDPSRLSGDGTYALKKVLIQSSEQLELVREEIRISSLFSHPNLLPLLDHAIIAVKS  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            SEG S KHEAYLLFPVH+DGTLLD
Sbjct  121  SEG-SVKHEAYLLFPVHLDGTLLD  143



>ref|XP_010257846.1| PREDICTED: serine/threonine-protein kinase 16 [Nelumbo nucifera]
Length=344

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 126/145 (87%), Gaps = 6/145 (4%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG----  288
            MGCSFSGLNALYD VNGGGDVWIN+NRFRI+RQLGEGGFAYVYLVKEI+ D A  G    
Sbjct  1    MGCSFSGLNALYDVVNGGGDVWINENRFRILRQLGEGGFAYVYLVKEIVKDVATDGGVGG  60

Query  289  VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
            ++KK KDPS  SD+GTYAMKKVLIQ SEQL+LV+EEIRVSSLFSHPNLLPLLDHA+I+  
Sbjct  61   IAKKVKDPSFVSDDGTYAMKKVLIQTSEQLELVREEIRVSSLFSHPNLLPLLDHAIIS--  118

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
            A++  S  HEAYLLFPVH+DGTLLD
Sbjct  119  ATQEGSGNHEAYLLFPVHLDGTLLD  143



>ref|XP_011005497.1| PREDICTED: serine/threonine-protein kinase 16-like [Populus euphratica]
 ref|XP_011005498.1| PREDICTED: serine/threonine-protein kinase 16-like [Populus euphratica]
Length=354

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 128/153 (84%), Gaps = 12/153 (8%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL-----------  267
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE++           
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKEVVNVSPPASSSSG  60

Query  268  -ADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLL  444
             A     G+SKK KD SH S +GTYAMKKVLIQN+EQL+LV+EEI VSSLF+HPNLLPLL
Sbjct  61   GAAAVSGGLSKKVKDKSHLSVDGTYAMKKVLIQNNEQLELVREEIHVSSLFNHPNLLPLL  120

Query  445  DHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            DHA+I+VKA++  SW HEAYLLFPVH+DGTLLD
Sbjct  121  DHAIISVKATQEGSWNHEAYLLFPVHLDGTLLD  153



>ref|XP_011011304.1| PREDICTED: serine/threonine-protein kinase 16-like [Populus euphratica]
Length=350

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 127/149 (85%), Gaps = 8/149 (5%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL--------ADP  276
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFAYV+LVKE++           
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAYVFLVKEVVNASSPASGGGA  60

Query  277  AKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAV  456
            A  G+SKK KD SH S +GTYAMKKVLIQN+EQL+LV+EEI VSSLF+HPNLLPLLDHA+
Sbjct  61   AAGGLSKKVKDKSHLSGDGTYAMKKVLIQNNEQLELVREEIHVSSLFNHPNLLPLLDHAI  120

Query  457  IAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            IAVKA++  SW HE YLLFPVH+DGTLLD
Sbjct  121  IAVKATQEGSWNHEGYLLFPVHLDGTLLD  149



>ref|XP_009415450.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Musa acuminata subsp. malaccensis]
Length=342

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLN+ YDAVNG GDVWIN+NRFRIVRQLGEGGFA+V+LVKE++AD A     KK
Sbjct  1    MGCSFSGLNSFYDAVNGAGDVWINENRFRIVRQLGEGGFAFVFLVKEVVADGAAGLARKK  60

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
              +PSH SD+GTYAMKKV+IQ  EQL++VK+EIRVSSLFSHPNLLPLLDHA+I VK +  
Sbjct  61   SINPSHVSDDGTYAMKKVIIQTEEQLEMVKQEIRVSSLFSHPNLLPLLDHAIIPVKGTHD  120

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             S KHEAYLLFPVH+DGTLLD
Sbjct  121  ISRKHEAYLLFPVHLDGTLLD  141



>ref|XP_008455005.1| PREDICTED: serine/threonine-protein kinase 16 [Cucumis melo]
Length=344

 Score =   224 bits (572),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 131/144 (91%), Gaps = 4/144 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  291
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRIVRQLGEGGFA+V+LVKE+++D + P    +
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRIVRQLGEGGFAFVFLVKEVVSDSSSPSGGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK KDPS  S +GTYA+KKVLIQ+SEQL+LV+EEIR+SSLF HPNLLPLLDHA+IAVK+
Sbjct  61   AKKLKDPSRLSGDGTYALKKVLIQSSEQLELVREEIRISSLFCHPNLLPLLDHAIIAVKS  120

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
            SEG S KHEAYLLFPVH+DGTLLD
Sbjct  121  SEG-SVKHEAYLLFPVHLDGTLLD  143



>ref|XP_009125719.1| PREDICTED: serine/threonine-protein kinase 16-like [Brassica 
rapa]
 emb|CDY40762.1| BnaAnng06250D [Brassica napus]
Length=342

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 3/142 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG-VSK  297
            MGCSFSGLNALYD+  GGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI+AD +  G ++ 
Sbjct  1    MGCSFSGLNALYDS--GGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVADASSGGGLAS  58

Query  298  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  477
            K KDP+H SD+GTYAMKKVLIQN EQL+LV+EEIRVSSLFSHPNLLPLLDHA+I VK  +
Sbjct  59   KVKDPAHLSDDGTYAMKKVLIQNKEQLELVREEIRVSSLFSHPNLLPLLDHAIIPVKGGQ  118

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
              + KHEA+LLFPVH+DGTLLD
Sbjct  119  EGAGKHEAFLLFPVHLDGTLLD  140



>ref|XP_010547731.1| PREDICTED: serine/threonine-protein kinase 16 [Tarenaya hassleriana]
Length=349

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 125/145 (86%), Gaps = 4/145 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVS--  294
            MGC+FSGLNA YDAVN GGDVWIN+NRFRIVRQLGEGGFA+VYLVKEI AD +       
Sbjct  1    MGCTFSGLNAFYDAVNSGGDVWINENRFRIVRQLGEGGFAFVYLVKEIAADASAAAAGGG  60

Query  295  --KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK  468
              KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+++VK
Sbjct  61   LAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIVSVK  120

Query  469  ASEGQSWKHEAYLLFPVHMDGTLLD  543
            A +  SWKHEA+LLFPVH++GTLLD
Sbjct  121  AGQEGSWKHEAFLLFPVHLEGTLLD  145



>ref|XP_010942233.1| PREDICTED: serine/threonine-protein kinase 16-like [Elaeis guineensis]
Length=344

 Score =   222 bits (566),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG--VS  294
            MGCSFSGLNA YDAVN GGD WIN+NRFRI+RQLGEGGFAYVYLVKE+++D    G    
Sbjct  1    MGCSFSGLNAFYDAVNAGGDAWINENRFRILRQLGEGGFAYVYLVKEVVSDGGGGGGLAK  60

Query  295  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
            KK  DPSH SD+GTYAMKK+LIQ+ EQL+LV+EEIRVSSLF+HPNLLPLLDHA+IAVK +
Sbjct  61   KKSVDPSHISDDGTYAMKKILIQSEEQLELVREEIRVSSLFNHPNLLPLLDHAIIAVKGA  120

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
            +  S  HEAYLLFPVH+DGTLLD
Sbjct  121  QQGSRNHEAYLLFPVHLDGTLLD  143



>ref|XP_010905763.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Elaeis guineensis]
 ref|XP_010905764.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Elaeis guineensis]
 ref|XP_010905765.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Elaeis guineensis]
Length=347

 Score =   223 bits (567),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 5/144 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  291
            MGCSFSGLNALY+AVNGGGDVWIN+NRFRI+RQ+GEGGFAYVYLVKE++ D A+ G    
Sbjct  1    MGCSFSGLNALYNAVNGGGDVWINENRFRILRQIGEGGFAYVYLVKEVVDD-ARSGSGLA  59

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK   PSH S++GTYAMKKVLIQ+ +QL LV+EEIRVSSLF+HPNLLPLLDHA+IAVK 
Sbjct  60   AKKSMHPSHVSEDGTYAMKKVLIQSEDQLQLVREEIRVSSLFNHPNLLPLLDHAIIAVKG  119

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
             +G  W HEAYLLFPVH+DGTLLD
Sbjct  120  PQG-GWNHEAYLLFPVHLDGTLLD  142



>ref|XP_008393382.1| PREDICTED: serine/threonine-protein kinase 16, partial [Malus 
domestica]
Length=331

 Score =   221 bits (563),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 120/130 (92%), Gaps = 3/130 (2%)
 Frame = +1

Query  163  VNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---VSKKFKDPSHASDNG  333
            VNGGGDVWIN+NRF+IVRQLGEGGFAYV+LVKE++AD +  G   ++KKFKDPSH SD+G
Sbjct  1    VNGGGDVWINENRFKIVRQLGEGGFAYVFLVKEVVADSSASGGGGLAKKFKDPSHVSDDG  60

Query  334  TYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLF  513
            TYA+KKVLIQNSEQL+LVKEEIRVSSLFSHPNLLPLLDHA+IAVK ++ QSW HEAYLLF
Sbjct  61   TYALKKVLIQNSEQLELVKEEIRVSSLFSHPNLLPLLDHAIIAVKTTQEQSWNHEAYLLF  120

Query  514  PVHMDGTLLD  543
            PVH+DGTLLD
Sbjct  121  PVHLDGTLLD  130



>ref|XP_008804427.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Phoenix dactylifera]
Length=347

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 124/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG--VS  294
            MGCSFSGLNALY+AVNGGGDVWIN+NRFRI++Q+GEGGFAYVYLVKE++AD    G   +
Sbjct  1    MGCSFSGLNALYNAVNGGGDVWINENRFRILKQIGEGGFAYVYLVKEVVADARSGGGLAA  60

Query  295  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
            KK   PSH S++GTYAMKKVLIQ+ +QL LV+EEI VSSLF+HPNLLPLLDHA+IAVK  
Sbjct  61   KKSVPPSHVSEDGTYAMKKVLIQSEDQLQLVREEIHVSSLFNHPNLLPLLDHAIIAVKGP  120

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
            +G  W HEAYLLFPVH+DGTLLD
Sbjct  121  QG-GWNHEAYLLFPVHLDGTLLD  142



>emb|CDY44759.1| BnaC02g01280D [Brassica napus]
Length=342

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 125/142 (88%), Gaps = 3/142 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG-VSK  297
            MGCSFSGLNALYD+  GGGDVWIN+NRFRIVRQLGEGGFA+V+LVKEI+AD +  G ++ 
Sbjct  1    MGCSFSGLNALYDS--GGGDVWINENRFRIVRQLGEGGFAFVFLVKEIVADASSGGGLAS  58

Query  298  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  477
            K KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLFSHPNLLPLLDHA+I VK  +
Sbjct  59   KVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFSHPNLLPLLDHAIIPVKGGQ  118

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
              + KHEA+LLFPVH+DGTLLD
Sbjct  119  EGAGKHEAFLLFPVHLDGTLLD  140



>ref|XP_008797567.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Phoenix dactylifera]
Length=347

 Score =   219 bits (558),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG-VSK  297
            MGCSFSGLNALYDAVN GGDVWIN+NRF+I+RQLGEGGFAYVYLVKE+++D    G ++K
Sbjct  1    MGCSFSGLNALYDAVNAGGDVWINENRFQILRQLGEGGFAYVYLVKEVVSDGGGGGGLAK  60

Query  298  KFK-DPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
            K   DPSH S +GTYAMKK+LIQ+ EQL+LV+EEIRVSSLF+HPNLLPLLDHA+IAVK +
Sbjct  61   KISVDPSHISGDGTYAMKKILIQSEEQLELVREEIRVSSLFNHPNLLPLLDHAIIAVKGA  120

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
            +  S  HEAYLLFPVH+DGTLLD
Sbjct  121  QQGSRNHEAYLLFPVHLDGTLLD  143



>ref|XP_010905766.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X2 [Elaeis guineensis]
Length=346

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 125/144 (87%), Gaps = 6/144 (4%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  291
            MGCSFSGLNALY+AVNGGGDVWIN+NRFRI+RQ+GEGGFAYVYLVKE++ D A+ G    
Sbjct  1    MGCSFSGLNALYNAVNGGGDVWINENRFRILRQIGEGGFAYVYLVKEVVDD-ARSGSGLA  59

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            +KK   PSH SD GTYAMKKVLIQ+ +QL LV+EEIRVSSLF+HPNLLPLLDHA+IAVK 
Sbjct  60   AKKSMHPSHVSD-GTYAMKKVLIQSEDQLQLVREEIRVSSLFNHPNLLPLLDHAIIAVKG  118

Query  472  SEGQSWKHEAYLLFPVHMDGTLLD  543
             +G  W HEAYLLFPVH+DGTLLD
Sbjct  119  PQG-GWNHEAYLLFPVHLDGTLLD  141



>ref|XP_009395860.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Musa acuminata subsp. malaccensis]
Length=362

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 124/142 (87%), Gaps = 5/142 (4%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVS-K  297
            MGCS SGLNA YDAV+GGGDVWIN+NRFRIVRQLGEGGFA+V+LVKE++AD    G++ K
Sbjct  24   MGCSLSGLNAFYDAVSGGGDVWINENRFRIVRQLGEGGFAFVFLVKEVVAD----GLARK  79

Query  298  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  477
            K  +PSH SD+GTYAMKK++IQ  EQL+LV++EIRVSSLFSHPNLLPLLDHA+I VK  +
Sbjct  80   KSINPSHISDDGTYAMKKIIIQTEEQLELVRQEIRVSSLFSHPNLLPLLDHAIIPVKGMQ  139

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
              S KHEAYLLFPVH+DGTLLD
Sbjct  140  DGSLKHEAYLLFPVHLDGTLLD  161



>ref|XP_008804428.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X2 [Phoenix dactylifera]
Length=346

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 123/143 (86%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG--VS  294
            MGCSFSGLNALY+AVNGGGDVWIN+NRFRI++Q+GEGGFAYVYLVKE++AD    G   +
Sbjct  1    MGCSFSGLNALYNAVNGGGDVWINENRFRILKQIGEGGFAYVYLVKEVVADARSGGGLAA  60

Query  295  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
            KK   PSH SD GTYAMKKVLIQ+ +QL LV+EEI VSSLF+HPNLLPLLDHA+IAVK  
Sbjct  61   KKSVPPSHVSD-GTYAMKKVLIQSEDQLQLVREEIHVSSLFNHPNLLPLLDHAIIAVKGP  119

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
            +G  W HEAYLLFPVH+DGTLLD
Sbjct  120  QG-GWNHEAYLLFPVHLDGTLLD  141



>ref|XP_004252263.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Solanum lycopersicum]
Length=335

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 9/141 (6%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYD  NGGGDVWIN+NRFRI+RQ     F  V+LVKE+++DP       K
Sbjct  1    MGCSFSGLNALYDNANGGGDVWINENRFRILRQ---ATFPNVFLVKELISDP------NK  51

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             KDPSH SD+GTYAMKKVLIQN+E+L+LVKEEIRVSSLFSHPNLLPLLDHA+I+VKAS+ 
Sbjct  52   IKDPSHVSDDGTYAMKKVLIQNNEELELVKEEIRVSSLFSHPNLLPLLDHAIISVKASQD  111

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
            QS K EAYLLFP HMDGTLLD
Sbjct  112  QSRKQEAYLLFPAHMDGTLLD  132



>ref|XP_010929080.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Elaeis guineensis]
Length=341

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 124/142 (87%), Gaps = 3/142 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNA YD+V+ GGDVWIN+NRFRI+RQLGEGGFAYVYLVKE+++D    G++KK
Sbjct  1    MGCSFSGLNAFYDSVSAGGDVWINENRFRILRQLGEGGFAYVYLVKEVVSDGG--GLAKK  58

Query  301  FK-DPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  477
               DPSH S +GTYAMKKVLIQ+ EQL+LV+EEI VSSLF+HPNLLPLLDHA+IAVK ++
Sbjct  59   KSIDPSHISADGTYAMKKVLIQSEEQLELVREEIHVSSLFNHPNLLPLLDHAIIAVKGAQ  118

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
              +  HEAYLLFPVH+DGTLLD
Sbjct  119  QGAQSHEAYLLFPVHLDGTLLD  140



>ref|XP_006345347.1| PREDICTED: serine/threonine-protein kinase 16-like [Solanum tuberosum]
Length=335

 Score =   214 bits (545),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 118/141 (84%), Gaps = 9/141 (6%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYD  N GGDVWIN+NRFRI+RQ     F  V+LVKE+++DP       K
Sbjct  1    MGCSFSGLNALYDNANSGGDVWINENRFRILRQ---ASFPNVFLVKELISDP------NK  51

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             KDPSH SD+GTYAMKKVLIQN+EQL+LVKEEIRVSSLFSHPNLLPLLDHA+I+VKAS+ 
Sbjct  52   IKDPSHVSDDGTYAMKKVLIQNNEQLELVKEEIRVSSLFSHPNLLPLLDHAIISVKASQD  111

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
            QS K EAYLLFP H+DGTLLD
Sbjct  112  QSRKQEAYLLFPAHLDGTLLD  132



>gb|EMS68366.1| Serine/threonine-protein kinase 16 [Triticum urartu]
Length=336

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 119/141 (84%), Gaps = 5/141 (4%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCS SGLNALY+A  GGGDVWIN+ RFR++RQ+GEGGFA+VYLVKE  A       + +
Sbjct  1    MGCSLSGLNALYEAATGGGDVWINERRFRVLRQIGEGGFAFVYLVKEHDAS----SYAAR  56

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             + PSH SD+GTYAMKKVLIQ+ EQLDLVKEEIRVSSLF+HPNLLPLLDHA+IAVK+++G
Sbjct  57   DRHPSHVSDDGTYAMKKVLIQSREQLDLVKEEIRVSSLFNHPNLLPLLDHAIIAVKSTQG  116

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
              W HEAYLLFPVH+DGTL D
Sbjct  117  -DWSHEAYLLFPVHLDGTLFD  136



>ref|NP_001132895.1| LOC100194392 [Zea mays]
 gb|ACF81929.1| unknown [Zea mays]
 tpg|DAA61226.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=338

 Score =   212 bits (539),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 119/143 (83%), Gaps = 8/143 (6%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E      +P     
Sbjct  1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVRE-----HQPASDAA  55

Query  301  F--KDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
            F  +DP+H S++GTYAMKKVLIQ+ EQLDLV+EEIRVSSLF+HPNLLPLLDHA+IAVK+ 
Sbjct  56   FARRDPAHVSEDGTYAMKKVLIQSKEQLDLVREEIRVSSLFNHPNLLPLLDHAIIAVKSQ  115

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
            +G  W HEAYLLFPVH+DGTL D
Sbjct  116  QG-DWSHEAYLLFPVHLDGTLFD  137



>ref|XP_008783057.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X2 [Phoenix dactylifera]
 ref|XP_008783058.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X2 [Phoenix dactylifera]
Length=341

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%), Gaps = 3/142 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVS-K  297
            MGCSFSGLNA YDAV  GGDVWIN+NRFR++RQLGEGG +YVYLVKE+++D A  G++ K
Sbjct  1    MGCSFSGLNAFYDAVGAGGDVWINENRFRVLRQLGEGGLSYVYLVKEVVSDGA--GLARK  58

Query  298  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  477
            K  DPSH SD+GTY MKKV IQ+ EQL LV+EEIRVSSLF+HPNLLPLLDHA+IAVK ++
Sbjct  59   KSIDPSHISDDGTYVMKKVPIQSEEQLKLVREEIRVSSLFNHPNLLPLLDHAIIAVKGAQ  118

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
              S   EAYLLFPVH+DGTLLD
Sbjct  119  QGSQNREAYLLFPVHLDGTLLD  140



>ref|XP_004956689.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
isoform X1 [Setaria italica]
Length=338

 Score =   209 bits (532),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 117/141 (83%), Gaps = 4/141 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E    PA      +
Sbjct  1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVRE--QQPASNAAPAR  58

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
              D +H S++GTYAMKKVLIQ+ EQLDLV+EEIRVSSLFSHPNLLPLLDHA+IAVK+ +G
Sbjct  59   RHD-AHVSEDGTYAMKKVLIQSKEQLDLVREEIRVSSLFSHPNLLPLLDHAIIAVKSPQG  117

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
              W HEAYLLFPVH+DGTL D
Sbjct  118  -DWSHEAYLLFPVHLDGTLFD  137



>gb|KHN15181.1| Serine/threonine-protein kinase 16 [Glycine soja]
Length=361

 Score =   209 bits (533),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 121/160 (76%), Gaps = 19/160 (12%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYD+VNGGGDVWIN+NRFRIVRQLGEGGFAYVYLVKE   D A     ++
Sbjct  1    MGCSFSGLNALYDSVNGGGDVWINENRFRIVRQLGEGGFAYVYLVKEAPDDSAARWPRQE  60

Query  301  FK-------------------DPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSH  423
             +                     S   D+GTYAMKKVLIQN+EQL+LV+EEIRVSSLF+H
Sbjct  61   AQRLLSSLRNREIIFVRCDECPISRFGDDGTYAMKKVLIQNNEQLELVREEIRVSSLFNH  120

Query  424  PNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            PNLLPLL+HA+I+VK +   SW HEAYLLFPVH+DGTLLD
Sbjct  121  PNLLPLLEHAIISVKPTHETSWNHEAYLLFPVHLDGTLLD  160



>ref|XP_010238122.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Brachypodium 
distachyon]
Length=336

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 117/141 (83%), Gaps = 5/141 (4%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLVKE  A       + +
Sbjct  1    MGCSMSGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVKEHEAS----SDAAR  56

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             + PSH S++GTYAMKKVLIQ+ EQLDLVKEEIRVSSLF+HPNLLPLLDHA+IAVK  +G
Sbjct  57   GRHPSHVSEDGTYAMKKVLIQSKEQLDLVKEEIRVSSLFNHPNLLPLLDHAIIAVKTEQG  116

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
              W HEAYLLFPV++DGTL D
Sbjct  117  -DWSHEAYLLFPVYLDGTLFD  136



>gb|ACG33051.1| serine/threonine-protein kinase 16 [Zea mays]
Length=335

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 116/143 (81%), Gaps = 11/143 (8%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E      +P     
Sbjct  1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVRE-----HQPASDAA  55

Query  301  F--KDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
            F  +DP+H S++GTYAMKKVLIQ+ EQLDLV+EEIRVSSLF+HPNLLPLLDHA+IAVK  
Sbjct  56   FARRDPAHVSEDGTYAMKKVLIQSKEQLDLVREEIRVSSLFNHPNLLPLLDHAIIAVKG-  114

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
                W HEAYLLFPVH+DGTL D
Sbjct  115  ---DWSHEAYLLFPVHLDGTLFD  134



>ref|XP_008650962.1| PREDICTED: LOC100194392 isoform X1 [Zea mays]
 gb|ACF80463.1| unknown [Zea mays]
 tpg|DAA61225.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=335

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 116/143 (81%), Gaps = 11/143 (8%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E      +P     
Sbjct  1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVRE-----HQPASDAA  55

Query  301  F--KDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
            F  +DP+H S++GTYAMKKVLIQ+ EQLDLV+EEIRVSSLF+HPNLLPLLDHA+IAVK  
Sbjct  56   FARRDPAHVSEDGTYAMKKVLIQSKEQLDLVREEIRVSSLFNHPNLLPLLDHAIIAVKG-  114

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
                W HEAYLLFPVH+DGTL D
Sbjct  115  ---DWSHEAYLLFPVHLDGTLFD  134



>ref|NP_001063027.1| Os09g0372800 [Oryza sativa Japonica Group]
 dbj|BAD26364.1| putative serine/threonine-protein kinase 16 [Oryza sativa Japonica 
Group]
 dbj|BAF24941.1| Os09g0372800 [Oryza sativa Japonica Group]
 gb|EAZ08870.1| hypothetical protein OsI_31131 [Oryza sativa Indica Group]
 gb|EAZ44518.1| hypothetical protein OsJ_29137 [Oryza sativa Japonica Group]
 dbj|BAG93927.1| unnamed protein product [Oryza sativa Japonica Group]
Length=337

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 117/141 (83%), Gaps = 5/141 (4%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E  A       + +
Sbjct  1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVREHQAS----ADAAR  56

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             + PS AS++GTYAMKKVLIQ+ EQLDLVKEEIRVSSLF+HPNLLPLLDHAVIAVK  +G
Sbjct  57   GRSPSLASEDGTYAMKKVLIQSKEQLDLVKEEIRVSSLFNHPNLLPLLDHAVIAVKNQQG  116

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
              W HEAYLLFPV++DGTL D
Sbjct  117  -DWNHEAYLLFPVYIDGTLFD  136



>gb|ABB72838.1| serine/threonine kinase [Elaeis guineensis]
Length=346

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILAD-PAKPGV-S  294
            MGCSFSGLNALY+AVNGGGDV IN+N FRI+RQ+GEGGFAYVYLVKE++ D P++ G+ +
Sbjct  1    MGCSFSGLNALYNAVNGGGDVLINENPFRILRQIGEGGFAYVYLVKEVVDDAPSRSGLAA  60

Query  295  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
            KK   PSH S++GTY+MKKVLIQ+ +QL  V+EEI VSSLF+HPNLL LLDHA+I+VK  
Sbjct  61   KKSMHPSHVSEDGTYSMKKVLIQSEDQLQFVREEIPVSSLFNHPNLLSLLDHAIISVKGP  120

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
            +G  W HEAYLLFPVH+DGT LD
Sbjct  121  QG-GWNHEAYLLFPVHLDGTFLD  142



>ref|XP_004956690.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
isoform X2 [Setaria italica]
Length=335

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 114/141 (81%), Gaps = 7/141 (5%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E    PA      +
Sbjct  1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVRE--QQPASNAAPAR  58

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
              D +H S++GTYAMKKVLIQ+ EQLDLV+EEIRVSSLFSHPNLLPLLDHA+IAVK    
Sbjct  59   RHD-AHVSEDGTYAMKKVLIQSKEQLDLVREEIRVSSLFSHPNLLPLLDHAIIAVKG---  114

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
              W HEAYLLFPVH+DGTL D
Sbjct  115  -DWSHEAYLLFPVHLDGTLFD  134



>ref|XP_010238123.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Brachypodium 
distachyon]
Length=333

 Score =   203 bits (517),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 8/141 (6%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLVKE  A       + +
Sbjct  1    MGCSMSGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVKEHEAS----SDAAR  56

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             + PSH S++GTYAMKKVLIQ+ EQLDLVKEEIRVSSLF+HPNLLPLLDHA+IAVK    
Sbjct  57   GRHPSHVSEDGTYAMKKVLIQSKEQLDLVKEEIRVSSLFNHPNLLPLLDHAIIAVKG---  113

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
              W HEAYLLFPV++DGTL D
Sbjct  114  -DWSHEAYLLFPVYLDGTLFD  133



>ref|XP_006440850.1| hypothetical protein CICLE_v10021674mg [Citrus clementina]
 gb|ESR54090.1| hypothetical protein CICLE_v10021674mg [Citrus clementina]
Length=221

 Score =   196 bits (498),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 108/128 (84%), Gaps = 3/128 (2%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEIL---ADPAKPGV  291
            MGCS SGLNALYD+VNGGGDVWIN+NR+RI+RQLGEGGFAYVYLVKE +   A  A  G+
Sbjct  1    MGCSLSGLNALYDSVNGGGDVWINENRYRILRQLGEGGFAYVYLVKETVTTDASAASGGL  60

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            + K KDPSH SD+GTYAMKKVLIQN+EQL++V+EEIRVSSLFSH NLLPLLDHA+IAVK 
Sbjct  61   ANKVKDPSHLSDDGTYAMKKVLIQNNEQLEMVREEIRVSSLFSHRNLLPLLDHAIIAVKI  120

Query  472  SEGQSWKH  495
              G    H
Sbjct  121  CAGLKHMH  128



>ref|XP_002991218.1| hypothetical protein SELMODRAFT_133041 [Selaginella moellendorffii]
 gb|EFJ07762.1| hypothetical protein SELMODRAFT_133041 [Selaginella moellendorffii]
Length=342

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 108/140 (77%), Gaps = 8/140 (6%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALY+AV+G  D+WIN+ RFRIVRQLGEGGFA+VYL +EI  D       + 
Sbjct  1    MGCSFSGLNALYEAVSGAADIWINERRFRIVRQLGEGGFAFVYLAREIQGD-------RP  53

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK-ASE  477
             K  S  SD+G YA+KKVLIQ+ EQL LVK EI+VSSLF HPNLLPLL+H++IAVK  S 
Sbjct  54   LKQSSQVSDDGLYAVKKVLIQSEEQLALVKREIQVSSLFKHPNLLPLLEHSMIAVKQGSR  113

Query  478  GQSWKHEAYLLFPVHMDGTL  537
              +W  EAYLLFPV+ DGTL
Sbjct  114  EGTWNTEAYLLFPVYPDGTL  133



>ref|XP_002991279.1| hypothetical protein SELMODRAFT_185952 [Selaginella moellendorffii]
 gb|EFJ07707.1| hypothetical protein SELMODRAFT_185952 [Selaginella moellendorffii]
Length=342

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 107/140 (76%), Gaps = 8/140 (6%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALY+AV+G  D+WIN  RFRIVRQLGEGGFA+VYL +EI  D       + 
Sbjct  1    MGCSFSGLNALYEAVSGAADIWINQRRFRIVRQLGEGGFAFVYLAREIQGD-------RP  53

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVK-ASE  477
             K  S  SD+G YA+KKVLIQ+ EQL LVK EI+VSSLF HPNLLPLL+H++IAVK  S 
Sbjct  54   LKQSSQVSDDGLYAVKKVLIQSEEQLALVKREIQVSSLFKHPNLLPLLEHSMIAVKQGSR  113

Query  478  GQSWKHEAYLLFPVHMDGTL  537
              +W  EAYLLFPV+ DGTL
Sbjct  114  EGTWNTEAYLLFPVYPDGTL  133



>tpg|DAA61227.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=119

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 100/119 (84%), Gaps = 3/119 (3%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCS SGLNALYDA  GGGDVWIN+ RFR++RQ+GEGGFA+VYLV+E    PA      +
Sbjct  1    MGCSISGLNALYDAATGGGDVWINERRFRVLRQIGEGGFAFVYLVRE--HQPASDAAFAR  58

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  477
             +DP+H S++GTYAMKKVLIQ+ EQLDLV+EEIRVSSLF+HPNLLPLLDHA+IAVK  E
Sbjct  59   -RDPAHVSEDGTYAMKKVLIQSKEQLDLVREEIRVSSLFNHPNLLPLLDHAIIAVKHLE  116



>ref|NP_001062642.1| Os09g0237600 [Oryza sativa Japonica Group]
 dbj|BAD33903.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF24556.1| Os09g0237600 [Oryza sativa Japonica Group]
 gb|EAZ43874.1| hypothetical protein OsJ_28494 [Oryza sativa Japonica Group]
Length=358

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 117/156 (75%), Gaps = 15/156 (10%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGG-DVWINDNRFRIVRQLGEGGFA--YVYLVKEILADP-----  276
            MGCSFSGLNALYD V GGG D+W+ND RFR+VR+LG+ G A  +V+LVKE++A       
Sbjct  1    MGCSFSGLNALYDTVGGGGGDIWVNDYRFRVVRRLGDAGPAGSFVFLVKEVVAAATASDG  60

Query  277  ---AKPGVS----KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLL  435
               A PG S    KK  DPSH S +GTYA+KKVLIQN + L+ V++EIRVSS FSHPNLL
Sbjct  61   TGGAVPGASGLAKKKGIDPSHISADGTYALKKVLIQNEQHLEQVRQEIRVSSQFSHPNLL  120

Query  436  PLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            PLL++A+IAVK  +  S  HEAYLLFPVH+DGTL D
Sbjct  121  PLLENAIIAVKGVQDGSQNHEAYLLFPVHLDGTLQD  156



>dbj|BAJ87464.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=357

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 114/155 (74%), Gaps = 14/155 (9%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFA--YVYLVKEILADPAKPGV-  291
            MGCSFSGLNALYD V GGGD+W+ND RFR++R+LG+ G A   V+LVKE++A  A     
Sbjct  1    MGCSFSGLNALYDTVGGGGDIWVNDYRFRVLRRLGDAGPAGSSVFLVKEVVAAAAPSDGT  60

Query  292  -----------SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLP  438
                        KK  DPSH S +GTYA+KKVLIQ+ + L+LV++EIRVSS FSHPNLLP
Sbjct  61   AGAGPGAAGLAKKKGVDPSHISADGTYALKKVLIQSDQHLELVRQEIRVSSQFSHPNLLP  120

Query  439  LLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            LL++A+IAVK  +  S  HEAYLLFPVH+DGTL D
Sbjct  121  LLENAIIAVKGVQDGSQNHEAYLLFPVHLDGTLQD  155



>ref|NP_850792.1| serine/threonine protein kinase 3 [Arabidopsis thaliana]
 gb|AED91260.1| serine/threonine protein kinase 3 [Arabidopsis thaliana]
Length=311

 Score =   179 bits (455),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 102/141 (72%), Gaps = 32/141 (23%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGCSFSGLNALYDAVNGGGDVWIN+NRFRI                              
Sbjct  1    MGCSFSGLNALYDAVNGGGDVWINENRFRI------------------------------  30

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
              DP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HPNLLPLLDHA+I+VK  + 
Sbjct  31   --DPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPNLLPLLDHAIISVKDGQE  88

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             +WKHEA+LLFPVH+DGTLLD
Sbjct  89   GAWKHEAFLLFPVHLDGTLLD  109



>gb|EAZ08255.1| hypothetical protein OsI_30510 [Oryza sativa Indica Group]
Length=358

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 116/156 (74%), Gaps = 15/156 (10%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGG-DVWINDNRFRIVRQLGEGGFA--YVYLVKEILADP-----  276
            MGCSFSGLNALYD V GGG D+W+ND RFR+VR+LG+ G A  +V+LVKE++A       
Sbjct  1    MGCSFSGLNALYDTVGGGGGDIWVNDYRFRVVRRLGDAGPAGSFVFLVKEVVAAATASDG  60

Query  277  ---AKPGVS----KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLL  435
               A PG S    KK  DPSH S +GTYA+KKVLIQN + L+ V++EIRVSS FSHPNLL
Sbjct  61   TGGAVPGASGLAKKKGIDPSHISADGTYALKKVLIQNEQHLEQVRQEIRVSSQFSHPNLL  120

Query  436  PLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            PLL++A+IAVK  +     HEAYLLFPVH+DGTL D
Sbjct  121  PLLENAIIAVKGVQDGLQNHEAYLLFPVHLDGTLQD  156



>gb|ACN26380.1| unknown [Zea mays]
 tpg|DAA39535.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=328

 Score =   175 bits (443),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 117/156 (75%), Gaps = 15/156 (10%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNG-GGDVWINDNRFRIVRQLGEGGFA--YVYLVKEILA-------  270
            MGCSFSGLNALYD V G GGDVW+ND  FR++R+LG+ G A   V+LVKE++A       
Sbjct  1    MGCSFSGLNALYDTVGGRGGDVWVNDYHFRVLRRLGDAGPAGSSVFLVKEVVAAATASDG  60

Query  271  ----DPAKPGVS-KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLL  435
                +P   G++ KK  DPSH S +GTYA+KKVL+Q+ + L+LV++EIRVSS FSHPNLL
Sbjct  61   TAGSEPGASGIAGKKGIDPSHISADGTYALKKVLVQSDQHLELVQQEIRVSSQFSHPNLL  120

Query  436  PLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            PLL+HA++AVK  +  S  +EAYLLFPVH++GTL D
Sbjct  121  PLLEHAIVAVKGVQDGSQNYEAYLLFPVHLEGTLHD  156



>ref|NP_001149977.1| serine/threonine-protein kinase 16 [Zea mays]
 gb|ACF85515.1| unknown [Zea mays]
 gb|ACG37388.1| serine/threonine-protein kinase 16 [Zea mays]
 tpg|DAA39536.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=357

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 117/156 (75%), Gaps = 15/156 (10%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNG-GGDVWINDNRFRIVRQLGEGGFA--YVYLVKEILA-------  270
            MGCSFSGLNALYD V G GGDVW+ND  FR++R+LG+ G A   V+LVKE++A       
Sbjct  1    MGCSFSGLNALYDTVGGRGGDVWVNDYHFRVLRRLGDAGPAGSSVFLVKEVVAAATASDG  60

Query  271  ----DPAKPGVS-KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLL  435
                +P   G++ KK  DPSH S +GTYA+KKVL+Q+ + L+LV++EIRVSS FSHPNLL
Sbjct  61   TAGSEPGASGIAGKKGIDPSHISADGTYALKKVLVQSDQHLELVQQEIRVSSQFSHPNLL  120

Query  436  PLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            PLL+HA++AVK  +  S  +EAYLLFPVH++GTL D
Sbjct  121  PLLEHAIVAVKGVQDGSQNYEAYLLFPVHLEGTLHD  156



>ref|XP_004956402.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
[Setaria italica]
Length=358

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 116/156 (74%), Gaps = 15/156 (10%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGG-DVWINDNRFRIVRQLGEGGFA--YVYLVKEILADPAK---  282
            MGCSFSGLNALYD V GGG DVW+ND RFR++R+LG+ G A   V+LVKE++A  A    
Sbjct  1    MGCSFSGLNALYDNVGGGGGDVWVNDYRFRVLRRLGDAGPAGSSVFLVKEVVAAAASSDG  60

Query  283  -----PGVS----KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLL  435
                 PG S    KK  DPSH S +G YA+KKVLI++ + L+LV++EIRVSS FSHPNLL
Sbjct  61   TAGAGPGTSGIARKKGVDPSHISADGIYALKKVLIRSEQHLELVRQEIRVSSQFSHPNLL  120

Query  436  PLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            PLL+HA+IAVK  +  S  HEAYLLFPVH+DGTL D
Sbjct  121  PLLEHAIIAVKGVQDGSQNHEAYLLFPVHLDGTLQD  156



>ref|XP_008668044.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Zea 
mays]
 tpg|DAA39534.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=354

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 116/156 (74%), Gaps = 18/156 (12%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNG-GGDVWINDNRFRIVRQLGEGGFA--YVYLVKEILA-------  270
            MGCSFSGLNALYD V G GGDVW+ND  FR++R+LG+ G A   V+LVKE++A       
Sbjct  1    MGCSFSGLNALYDTVGGRGGDVWVNDYHFRVLRRLGDAGPAGSSVFLVKEVVAAATASDG  60

Query  271  ----DPAKPGVS-KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLL  435
                +P   G++ KK  DPSH S +GTYA+KKVL+Q+ + L+LV++EIRVSS FSHPNLL
Sbjct  61   TAGSEPGASGIAGKKGIDPSHISADGTYALKKVLVQSDQHLELVQQEIRVSSQFSHPNLL  120

Query  436  PLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            PLL+HA++AVK     S  +EAYLLFPVH++GTL D
Sbjct  121  PLLEHAIVAVKDG---SQNYEAYLLFPVHLEGTLHD  153



>ref|XP_001779469.1| predicted protein [Physcomitrella patens]
 gb|EDQ55747.1| predicted protein [Physcomitrella patens]
Length=350

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGC++SGL+ALY AV  G +V++N  RF+I RQLGEGGFA+VYLV+E++  PA     K 
Sbjct  1    MGCTWSGLDALYGAVGSGAEVFVNKRRFKIQRQLGEGGFAFVYLVRELI--PAGLQPLKD  58

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
              DP+  S++G YA+KKVLIQ+ EQL+LV++EI VSSLF+HPN++ LL+H++I V  +E 
Sbjct  59   SDDPNPGSEDGMYALKKVLIQSDEQLELVEKEIEVSSLFNHPNVIRLLEHSIIKVAKTES  118

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
            Q    E YLLFPV+ DGTLLD
Sbjct  119  QPEHQEGYLLFPVYRDGTLLD  139



>ref|XP_010237321.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Brachypodium distachyon]
Length=362

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 113/160 (71%), Gaps = 19/160 (12%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGG--DVWINDNRFRIVRQLGEGGFA--YVYLVKEILADPAKPG  288
            MGCSFSGLNALYD V GGG  DVW+ND RFR++R+LG+ G A   V+LVKEI+A  +   
Sbjct  1    MGCSFSGLNALYDTVGGGGGGDVWVNDYRFRVLRRLGDAGPAGSSVFLVKEIVAAASAAS  60

Query  289  ---------------VSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSH  423
                             KK  DPSH S +GTYA+KKVLIQ+ + L LV++EIRVSS FSH
Sbjct  61   DAGAGGGAGPGPVGLAKKKGVDPSHISADGTYALKKVLIQSDQHLQLVRQEIRVSSQFSH  120

Query  424  PNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            PNLLPLL++A+IAVK  +  S  HEAYLLFPVH+DGTL D
Sbjct  121  PNLLPLLENAIIAVKGVQDGSQNHEAYLLFPVHLDGTLQD  160



>dbj|BAJ95332.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=341

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 101/155 (65%), Gaps = 30/155 (19%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFA--YVYLVKEILADPAKPGV-  291
            MGCSFSGLNALYD                ++R+LG+ G A   V+LVKE++A  A     
Sbjct  1    MGCSFSGLNALYD----------------VLRRLGDAGPAGSSVFLVKEVVAAAAPSDGT  44

Query  292  -----------SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLP  438
                        KK  DPSH S +GTYA+KKVLIQ+ + L+LV++EIRVSS FSHPNLLP
Sbjct  45   AGAGPGAAGLAKKKGVDPSHISADGTYALKKVLIQSDQHLELVRQEIRVSSQFSHPNLLP  104

Query  439  LLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            LL++A+IAVK  +  S  HEAYLLFPVH+DGTL D
Sbjct  105  LLENAIIAVKGVQDGSQNHEAYLLFPVHLDGTLQD  139



>ref|XP_008370887.1| PREDICTED: uncharacterized protein LOC103434325 [Malus domestica]
Length=208

 Score =   138 bits (348),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 91/123 (74%), Gaps = 5/123 (4%)
 Frame = +1

Query  169  GGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP---GVSKKFKDPSHASDNGTY  339
            G GD+       +IVRQLG+GGFAYV+LVK+++AD +     G++KKFKD SH SD+GTY
Sbjct  21   GYGDLEKLQKLVKIVRQLGKGGFAYVFLVKKVVADSSASSGGGLAKKFKDHSHVSDDGTY  80

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQS--WKHEAYLLF  513
            AMKKVLIQNSEQL+LV EEIRVSSLFSHPNL PLLDHA+IA   + G S  W +    + 
Sbjct  81   AMKKVLIQNSEQLELVNEEIRVSSLFSHPNLFPLLDHAIIASLMAGGISLLWTNSQTFIP  140

Query  514  PVH  522
             +H
Sbjct  141  VMH  143



>gb|ABB72840.1| serine/threonine kinase splice variant 1 [Elaeis guineensis]
Length=91

 Score =   133 bits (335),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 5/93 (5%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG---V  291
            MGCSFSGLNALY+AVNGGGDVWIN+NRFRI+RQ+GEGGFAYVYLVKE++ D A+ G    
Sbjct  1    MGCSFSGLNALYNAVNGGGDVWINENRFRILRQIGEGGFAYVYLVKEVV-DDARSGSGLA  59

Query  292  SKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVK  390
            +KK   PSH SD GTYAMKKVLIQ+ +QL  V+
Sbjct  60   AKKSMHPSHVSD-GTYAMKKVLIQSEDQLQFVR  91



>ref|XP_006575874.1| PREDICTED: uncharacterized protein LOC100811063 [Glycine max]
Length=224

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  163  VNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPA-KPGVSKKFKDPSHASDNGTY  339
            +NGGG+V IN N FRIVR+  E GFAYVYL+KE+  D A   G+SKK K  SH S++ TY
Sbjct  63   LNGGGNVCINKNHFRIVRKFREDGFAYVYLIKEVPNDSAITGGLSKKLKGSSHLSNDETY  122

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKA  471
            AMKKVLIQN+ Q +LV+EEIRVSSLF+HPN+LP LDH++++VK+
Sbjct  123  AMKKVLIQNNGQQELVREEIRVSSLFNHPNMLPFLDHSIVSVKS  166



>ref|XP_006661044.1| PREDICTED: serine/threonine-protein kinase 16-like [Oryza brachyantha]
Length=477

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 97/142 (68%), Gaps = 14/142 (10%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFA--YVYLVKEILADPAKPGV------------SK  297
            A N   D+W+ND RFR++R+L + G A   V+LVKE++A  A                 K
Sbjct  134  AKNKESDIWVNDYRFRVIRRLSDAGPAGSSVFLVKEVVAAAAASDGTAGAGPGAAGLAKK  193

Query  298  KFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASE  477
            K  DPSH S +GTYA+KKVLIQN + L+ V++EIRVSS FSHPNLLPLL++A+I+VK  +
Sbjct  194  KGVDPSHISADGTYALKKVLIQNDQHLEQVRQEIRVSSQFSHPNLLPLLENAIISVKGVQ  253

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
              S  HEAYLLFPVH+DGTL D
Sbjct  254  DGSHNHEAYLLFPVHLDGTLQD  275



>ref|XP_006661175.1| PREDICTED: serine/threonine-protein kinase 16-like [Oryza brachyantha]
Length=305

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 1/73 (1%)
 Frame = +1

Query  325  DNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAY  504
            D+GTYAMKKVLIQ+ EQLDLVKEEIRVSSLF+HPNLLPLLDHAVIAVK+ +G  W HEAY
Sbjct  33   DDGTYAMKKVLIQSKEQLDLVKEEIRVSSLFNHPNLLPLLDHAVIAVKSQQG-DWNHEAY  91

Query  505  LLFPVHMDGTLLD  543
            LLFPVH+DGTL D
Sbjct  92   LLFPVHIDGTLFD  104



>gb|ABB72839.1| serine/threonine kinase [Elaeis guineensis]
Length=83

 Score =   116 bits (291),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 2/83 (2%)
 Frame = +1

Query  148  ALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPG--VSKKFKDPSHA  321
            ALY+A+NGGGDVWIN+NRFRI+RQ+GEGGFAYVYLVKE++ D    G   +KK   PSH 
Sbjct  1    ALYNAMNGGGDVWINENRFRILRQIGEGGFAYVYLVKEVVDDARSGGGLAAKKSMHPSHV  60

Query  322  SDNGTYAMKKVLIQNSEQLDLVK  390
            S++GTYAMKKVLIQ+ +QL  V+
Sbjct  61   SEDGTYAMKKVLIQSEDQLQFVR  83



>ref|XP_008783056.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Phoenix dactylifera]
Length=345

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  ASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHE  498
            +SD+GTY MKKV IQ+ EQL LV+EEIRVSSLF+HPNLLPLLDHA+IAVK ++  S   E
Sbjct  70   SSDDGTYVMKKVPIQSEEQLKLVREEIRVSSLFNHPNLLPLLDHAIIAVKGAQQGSQNRE  129

Query  499  AYLLFPVHMDGTLLD  543
            AYLLFPVH+DGTLLD
Sbjct  130  AYLLFPVHLDGTLLD  144



>ref|XP_008783059.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X3 [Phoenix dactylifera]
Length=341

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  ASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHE  498
            +SD+GTY MKKV IQ+ EQL LV+EEIRVSSLF+HPNLLPLLDHA+IAVK ++  S   E
Sbjct  70   SSDDGTYVMKKVPIQSEEQLKLVREEIRVSSLFNHPNLLPLLDHAIIAVKGAQQGSQNRE  129

Query  499  AYLLFPVHMDGTLLD  543
            AYLLFPVH+DGTLLD
Sbjct  130  AYLLFPVHLDGTLLD  144



>gb|EMT14968.1| Serine/threonine-protein kinase 16 [Aegilops tauschii]
Length=350

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  295  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
            KK  DPSH S +GTYA+KKV IQ+ + L+LV++EIRVSS FSHPNLLPLL++A+IAVK  
Sbjct  66   KKGVDPSHISADGTYALKKVFIQSDQHLELVRQEIRVSSQFSHPNLLPLLENAIIAVKGV  125

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
            +  S  HEAYLLFPVH+DGTL D
Sbjct  126  QDGSQNHEAYLLFPVHLDGTLQD  148



>gb|AAN60358.1| unknown [Arabidopsis thaliana]
Length=149

 Score =   102 bits (254),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  295  KKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKAS  474
            KK KDP+H S +GTYAMKKVLIQN EQL+LV+EEIRVSSLF+HP LLP LDHA+I+VK  
Sbjct  82   KKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIRVSSLFNHPXLLPXLDHAIISVKDG  141

Query  475  EGQSWKH  495
               +WKH
Sbjct  142  XXGAWKH  148



>gb|EMS65453.1| Serine/threonine-protein kinase 16 [Triticum urartu]
Length=306

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  328  NGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYL  507
            +GTYA+KKVLIQ+ + L+LV++EIRVSS FSHPNLLPLL++A+IAVK  +  S  HEAYL
Sbjct  33   DGTYALKKVLIQSDQHLELVRQEIRVSSQFSHPNLLPLLENAIIAVKGVQDGSQNHEAYL  92

Query  508  LFPVHMDGTLLD  543
            LFPVH+DGTL D
Sbjct  93   LFPVHLDGTLQD  104



>tpg|DAA39533.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=90

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 55/83 (66%), Gaps = 15/83 (18%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNG-GGDVWINDNRFRIVRQLGEGGFA--YVYLVKEILA-------  270
            MGCSFSGLNALYD V G GGDVW+ND  FR++R+LG+ G A   V+LVKE++A       
Sbjct  1    MGCSFSGLNALYDTVGGRGGDVWVNDYHFRVLRRLGDAGPAGSSVFLVKEVVAAATASDG  60

Query  271  ----DPAKPGVS-KKFKDPSHAS  324
                +P   G++ KK  DPSH S
Sbjct  61   TAGSEPGASGIAGKKGIDPSHIS  83



>ref|XP_005848000.1| hypothetical protein CHLNCDRAFT_145529 [Chlorella variabilis]
 gb|EFN55898.1| hypothetical protein CHLNCDRAFT_145529 [Chlorella variabilis]
Length=452

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 64/125 (51%), Gaps = 22/125 (18%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKE------ILADPAKPGVSKKFKDPSHASDNGTYAMK  348
            +   R R+VRQLGEGG+++VYLV+E      +LA PA                 G +A+K
Sbjct  58   LGARRLRVVRQLGEGGYSFVYLVREGAGSGGLLAAPA---------------GTGLFALK  102

Query  349  KVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMD  528
            +VL    +QL   + E+       HP LLPLLD AV   +  +G S +    +LFPV+  
Sbjct  103  RVLCGGPDQLSEAQHEVATMRRLRHPCLLPLLDAAVREQRTPDGGS-RQVVLMLFPVYAQ  161

Query  529  GTLLD  543
            G L D
Sbjct  162  GNLFD  166



>ref|XP_005767918.1| hypothetical protein EMIHUDRAFT_245791 [Emiliania huxleyi CCMP1516]
 gb|EOD15489.1| hypothetical protein EMIHUDRAFT_245791 [Emiliania huxleyi CCMP1516]
Length=200

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 72/138 (52%), Gaps = 26/138 (19%)
 Frame = +1

Query  133  FSGLNALYDAVNGGGD-VWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKD  309
            ++ + +L  AV      + +N+   R+V+ L EGGF++VYLV++                
Sbjct  10   YAWVTSLCCAVTCSTQSMQVNERNLRVVKLLAEGGFSFVYLVED----------------  53

Query  310  PSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW  489
                 +   YA+KKVL Q  E  +L + E++V   F H NL+PL+DHAV++       S 
Sbjct  54   ----DEKKKYALKKVLAQLPEASELARWEVQVHQSFKHANLMPLIDHAVVSTA-----SG  104

Query  490  KHEAYLLFPVHMDGTLLD  543
              E  LL P++ DGTLLD
Sbjct  105  AEEFRLLMPLYPDGTLLD  122



>ref|XP_005794443.1| hypothetical protein EMIHUDRAFT_431902 [Emiliania huxleyi CCMP1516]
 gb|EOD42014.1| hypothetical protein EMIHUDRAFT_431902 [Emiliania huxleyi CCMP1516]
Length=329

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 72/138 (52%), Gaps = 26/138 (19%)
 Frame = +1

Query  133  FSGLNALYDAVNGGG-DVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKD  309
            ++ + +L  AV      + +N+   R+V+ L EGGF++VYLV++                
Sbjct  18   YAWVTSLCCAVTCSTQSMQVNERNLRVVKLLAEGGFSFVYLVED----------------  61

Query  310  PSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW  489
                 +   YA+KKVL Q  E  +L + E++V   F H NL+PL+DHAV++       S 
Sbjct  62   ----DEKKKYALKKVLAQLPEASELARWEVQVHQSFKHANLMPLIDHAVVSTA-----SG  112

Query  490  KHEAYLLFPVHMDGTLLD  543
              E  LL P++ DGTLLD
Sbjct  113  AEEFRLLMPLYPDGTLLD  130



>ref|XP_003060182.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56134.1| predicted protein [Micromonas pusilla CCMP1545]
Length=377

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 79/156 (51%), Gaps = 31/156 (20%)
 Frame = +1

Query  115  KKMGCSFSGL-NALYDAVNGGG--------DVWINDNRFRIVRQLGEGGFAYVYLVKEIL  267
            ++ GC+  G+  A+ DA    G        +V + D  F IV++LGEGGF+YV+L +EI 
Sbjct  10   EQYGCNVDGIWRAVVDAGKQVGLTLPPLTEEVVVEDKTFAIVKKLGEGGFSYVHLAREI-  68

Query  268  ADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLD  447
                          P  AS++  YA+K++LI   E    ++ EI V     HPN+LPLL 
Sbjct  69   --------------PDLASED--YALKRILIHEEEHQGAIQNEIDVMRALDHPNILPLL-  111

Query  448  HAVIAVKASEGQSW----KHEAYLLFPVHMDGTLLD  543
            +A I    S         +  A L+FP ++DGT+ D
Sbjct  112  YAEIEPHRSPPPGARVFVRKRASLVFPAYLDGTMFD  147



>ref|XP_008906617.1| NAK/MPSK protein kinase [Phytophthora parasitica INRA-310]
 gb|ETI45892.1| NAK/MPSK protein kinase [Phytophthora parasitica P1569]
 gb|ETK85822.1| NAK/MPSK protein kinase [Phytophthora parasitica]
 gb|ETL39252.1| NAK/MPSK protein kinase [Phytophthora parasitica]
 gb|ETL92375.1| NAK/MPSK protein kinase [Phytophthora parasitica]
 gb|ETM45669.1| NAK/MPSK protein kinase [Phytophthora parasitica]
 gb|ETN08329.1| NAK/MPSK protein kinase [Phytophthora parasitica INRA-310]
 gb|ETO74563.1| NAK/MPSK protein kinase [Phytophthora parasitica P1976]
 gb|ETP15723.1| NAK/MPSK protein kinase [Phytophthora parasitica CJ01A1]
 gb|ETP43757.1| NAK/MPSK protein kinase [Phytophthora parasitica P10297]
Length=339

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 74/161 (46%), Gaps = 39/161 (24%)
 Frame = +1

Query  103  PIARKKMG------CS------FSGLNALYDAVNGGGDVWINDNRFRIVR-QLGEGGFAY  243
            P+AR+  G      CS      F     L   +     + +   R  IV  ++ +GGF++
Sbjct  9    PVARQSPGATSSRICSAVTFFPFYAAQRLLSCLGYTHSIRMQSGRTVIVSSEIAQGGFSF  68

Query  244  VYLVKEILADPAKPGVSKKFKDPSHASDNG-TYAMKKVLIQNSEQLDLVKEEIRVSSLFS  420
            VY  ++                    +D G  +A+KK+L Q +EQ+ L K EI+    F+
Sbjct  69   VYKARD--------------------TDTGEAFALKKILCQTNEQVQLAKAEIQAHKAFA  108

Query  421  HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            HPN++PL D+AV++           E YLLFP   +GTL D
Sbjct  109  HPNIMPLCDYAVVSTGVE-----MFEYYLLFPFMENGTLRD  144



>ref|XP_003215036.1| PREDICTED: serine/threonine-protein kinase 16 [Anolis carolinensis]
Length=305

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 62/126 (49%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             +   G + IN+ R+  + +LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CICSRGTITINNKRYLSIHRLGEGGFSYVDLVEGL-------------------HDGRFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K+++  + +       EI +  LF HPN+LPL  HAV+  K S     KHEA+LL P 
Sbjct  47   ALKRIVCHDKDDRQEAMHEIEMHQLFDHPNILPLCAHAVVE-KGS-----KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  LKRGTL  106



>emb|CCA19548.1| serine/threonine protein kinase putative [Albugo laibachii Nc14]
Length=239

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = +1

Query  337  YAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFP  516
            YA+KK++ Q+ EQ  +VK EI++  +  HPN++PL+DHA +      G S  HE YLLFP
Sbjct  92   YALKKIICQSEEQRRMVKHEIQLHRVLKHPNIMPLIDHAEVT-----GGSICHEYYLLFP  146

Query  517  VHMDGTLLD  543
               +GTL D
Sbjct  147  FMQEGTLRD  155



>ref|XP_007419860.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Python 
bivittatus]
Length=305

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             +   G + IN  R+ ++ +LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CICSRGTITINSKRYLLIHRLGEGGFSYVDLVEGL-------------------HDGRFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L  + +       E+ +  LF HPN+LPL  HA++  K S     KHEA+LL P 
Sbjct  47   ALKRILCHDKDDRQEALHEVEMHLLFEHPNILPLCAHAMVE-KGS-----KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  LKRGTL  106



>ref|NP_001004792.1| serine/threonine-protein kinase 16 [Xenopus (Silurana) tropicalis]
 gb|AAH74528.1| MGC69350 protein [Xenopus (Silurana) tropicalis]
Length=305

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 63/126 (50%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             +   G + I + R+  V +LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CICSRGSITIENKRYFFVHKLGEGGFSYVDLVEGV-------------------QDGRFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L  + E     + E+ +  LF+HPN+LPL+ H++I     +G  W  EA+LL P 
Sbjct  47   ALKRILCHDREDRKEAQHEVEMHRLFNHPNVLPLVAHSII----EKGPKW--EAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  VKGGTL  106



>ref|XP_009159379.1| serine/threonine kinase 16 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY58918.1| serine/threonine kinase 16 [Exophiala dermatitidis NIH/UT8656]
Length=446

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 74/158 (47%), Gaps = 32/158 (20%)
 Frame = +1

Query  106  IARKKMGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKP  285
            +A+  +   +S  N +Y    G   + IN+  FR++R LGEGGF+YVYLV++        
Sbjct  1    MAQTMLDVFYSLCNCIY-CFPGTPQLKINNRSFRMLRLLGEGGFSYVYLVQD--------  51

Query  286  GVSKKFKDPSHASDNGTYAMKKVLIQ-NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAV-  456
                        SD+  YA+KK+      E +    +E+   +LF+ HPN++  +DHAV 
Sbjct  52   -----------TSDSALYALKKIRCPFGQESVSQALKEVEAYTLFAPHPNIIRSIDHAVQ  100

Query  457  ---------IAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
                     I  +A  G S     Y+L P +  G L D
Sbjct  101  NDSSTKVSGIGTEAGSGSSASKTVYILLPYYRRGNLQD  138



>gb|KIY96099.1| serine/threonine kinase 16 [Monoraphidium neglectum]
Length=433

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 62/126 (49%), Gaps = 24/126 (19%)
 Frame = +1

Query  199  RFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQL  378
            R+R + QLGEGG+A+VYLV+E+      P   +         D+   A+K++   + ++L
Sbjct  34   RYRAL-QLGEGGYAFVYLVREV------PTAQQPL------VDDAPLALKRINAASGDRL  80

Query  379  DLVKEEIRVSSLFSHPNLLPLLDHAVI--------AVKASEGQSWKHEAY---LLFPVHM  525
               K EI      SHPN LPLLDHAV         +  A  G    HE     LLFP   
Sbjct  81   QQAKREIATMRALSHPNCLPLLDHAVCAGGAGAAASGGAGGGGRTPHEGCTVLLLFPAFE  140

Query  526  DGTLLD  543
            DGTL D
Sbjct  141  DGTLFD  146



>ref|XP_005096441.1| PREDICTED: serine/threonine-protein kinase 16-like [Aplysia californica]
Length=308

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 68/129 (53%), Gaps = 20/129 (16%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             + G   + I+D RF I ++LGEGGF+YV LV++         VS K           TY
Sbjct  3    CMCGKESLSIDDRRFFIRQRLGEGGFSYVDLVED--------AVSHK-----------TY  43

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAV-KASEGQSWKHEAYLLFP  516
            A+K++L  + E+  +  +E+ V    +HPN++PL  H+   V + S+      E +L+ P
Sbjct  44   ALKRILCHSKEEEQIALQEVEVMRAVAHPNVIPLECHSFHKVGQYSKAVDITCEVFLVIP  103

Query  517  VHMDGTLLD  543
            ++  GTL D
Sbjct  104  LYRRGTLQD  112



>ref|XP_002954912.1| hypothetical protein VOLCADRAFT_118882 [Volvox carteri f. nagariensis]
 gb|EFJ44111.1| hypothetical protein VOLCADRAFT_118882 [Volvox carteri f. nagariensis]
Length=548

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 64/110 (58%), Gaps = 14/110 (13%)
 Frame = +1

Query  127  CSFSGLNALYDAVNGGGDVW-INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKF  303
            C  +   A +    GGG++  +   +FR++++LGEGG+A VYLV E LA    P      
Sbjct  21   CGLTNWAAAFLPSLGGGEIIPVGTRKFRVIQKLGEGGYAVVYLVSE-LATAEHP-----H  74

Query  304  KDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRV-SSLFSHPNLLPLLDH  450
             DP         A+K+V I ++EQ D V++E+ V S++  HPN+LPLLD+
Sbjct  75   PDPE------PRALKRVFIHSAEQFDAVQQEMLVHSAVQHHPNILPLLDY  118



>ref|XP_003287685.1| hypothetical protein DICPUDRAFT_78515 [Dictyostelium purpureum]
 gb|EGC35791.1| hypothetical protein DICPUDRAFT_78515 [Dictyostelium purpureum]
Length=311

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 63/119 (53%), Gaps = 25/119 (21%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN  366
            +N  ++ + R LGEGGF++VYLVK+                    S++  YA+K ++ Q 
Sbjct  15   VNGAKYTVNRVLGEGGFSFVYLVKD--------------------SNSRKYALKVMICQT  54

Query  367  SEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            +E ++  K EI +   F+HPN++ L+DH+     +S+      +  LL P + DG+L D
Sbjct  55   NESINTAKREINIFKTFNHPNIMKLVDHS-----SSQYSQDGKQYLLLLPYYKDGSLQD  108



>gb|ETE70724.1| Serine/threonine-protein kinase 16 [Ophiophagus hannah]
Length=272

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 25/119 (21%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             +   G + IN+ R+ ++ +LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CICSRGTITINNKRYLLIHRLGEGGFSYVDLVEGL-------------------QDGRFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFP  516
            A+K+++  + +       E+ +  LF HPN+LPL  HA++  K S     KHEA+LL P
Sbjct  47   ALKRIICHDKDDRQEALHEVEMHLLFEHPNILPLCAHAMVE-KGS-----KHEAWLLLP  99



>ref|NP_001087851.1| serine/threonine kinase 16 [Xenopus laevis]
 gb|AAH82377.1| MGC81705 protein [Xenopus laevis]
Length=305

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 62/126 (49%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             +   G + I + R+  V++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CICSRGSITIENKRYFFVQKLGEGGFSYVDLVEGV-------------------HDGRFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L  + E     + E+ +  LF+HPN+L L+ H +I     +G  W  EA+LL P 
Sbjct  47   ALKRILCHDREDRKEAQHEVEMHRLFNHPNILSLVAHCII----EKGPKW--EAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  VKGGTL  106



>ref|XP_004997989.1| NAK/MPSK protein kinase [Salpingoeca rosetta]
 gb|EGD79033.1| NAK/MPSK protein kinase [Salpingoeca rosetta]
Length=313

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 69/141 (49%), Gaps = 20/141 (14%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MG     L+ L   V  G  V +   RF I ++L  GGF+ V LV ++           +
Sbjct  1    MGQGLGVLDCLAGVVGNGQTVEVGSRRFSIRKRLATGGFSNVDLVCDV-----------Q  49

Query  301  FKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEG  480
             KD         YAMK++L     ++   K E+    LF HPN++ +++  V++++ ++G
Sbjct  50   TKD--------MYAMKRMLCTEKAEVQRAKAEVEYYRLFDHPNIIQVVESGVLSLRRNQG  101

Query  481  QSWKHEAYLLFPVHMDGTLLD  543
             +   E   +FP++  GTLLD
Sbjct  102  -APSQEVVCVFPLYERGTLLD  121



>ref|XP_002895305.1| serine/threonine protein kinase [Phytophthora infestans T30-4]
 gb|EEY58784.1| serine/threonine protein kinase [Phytophthora infestans T30-4]
Length=327

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 74/157 (47%), Gaps = 36/157 (23%)
 Frame = +1

Query  103  PIARKKMG-----CSFSGLNALYDA------VNGGGDVWINDNRFRIVR-QLGEGGFAYV  246
            P+AR+        CS   L  LY A      +     V +   R  IV  ++ +GGF++V
Sbjct  9    PVARQSPDTSSRICSAVTLFPLYAAQRLLSCLGYTHSVRMQSGRTVIVSSEITQGGFSFV  68

Query  247  YLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHP  426
            Y  K I  D  +P                 +A+KK+L Q +EQ+ L K EI+    F+HP
Sbjct  69   Y--KAIDTDTGEP-----------------FALKKILCQTNEQVQLAKAEIQALKAFTHP  109

Query  427  NLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTL  537
            N++ L D+AV++  A        E YLLFP   +GTL
Sbjct  110  NIMSLRDYAVVSTGAD-----SFEYYLLFPFMENGTL  141



>ref|XP_635157.1| hypothetical protein DDB_G0291350 [Dictyostelium discoideum AX4]
 sp|Q54ET3.1|Y6373_DICDI RecName: Full=Probable serine/threonine-protein kinase DDB_G0291350 
[Dictyostelium discoideum]
 gb|EAL61659.1| hypothetical protein DDB_G0291350 [Dictyostelium discoideum AX4]
Length=369

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 62/119 (52%), Gaps = 24/119 (20%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN  366
            IN  ++ + R LGEGGF++VYLVK+                    S++  YA+K ++ Q 
Sbjct  17   INGVKYTVNRILGEGGFSFVYLVKD-------------------NSNSKKYALKVMICQT  57

Query  367  SEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
             E ++  K EI     F+H N++ L+DH++    ++  Q  K E  LL P + DGTL D
Sbjct  58   QESINTAKREINAFQTFNHENIMKLIDHSI----SNHSQDTK-EYRLLLPYYKDGTLQD  111



>ref|XP_009525867.1| hypothetical protein PHYSODRAFT_459513, partial [Phytophthora 
sojae]
 gb|EGZ16809.1| hypothetical protein PHYSODRAFT_459513 [Phytophthora sojae]
Length=324

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 65/136 (48%), Gaps = 25/136 (18%)
 Frame = +1

Query  133  FSGLNALYDAVNGGGDVWINDNRFRIVR-QLGEGGFAYVYLVKEILADPAKPGVSKKFKD  309
            F     L   +     V +   R  +V  ++ +GGF++VY  ++   D  +P        
Sbjct  31   FYAAQRLLSCLGYSHSVRMQSGRTVVVSSEIAQGGFSFVYRARD--TDTGEP--------  80

Query  310  PSHASDNGTYAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW  489
                     +A+KK+L Q  EQ+ L K EI+    F+HPN++PL D+AV+    S G   
Sbjct  81   ---------FALKKILCQTDEQVQLAKAEIQAHKSFAHPNIMPLSDYAVV----SSGPE-  126

Query  490  KHEAYLLFPVHMDGTL  537
              E YLLFP   +GTL
Sbjct  127  TFEYYLLFPFMENGTL  142



>dbj|GAM27617.1| hypothetical protein SAMD00019534_107930 [Acytostelium subglobosum 
LB1]
Length=306

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 23/119 (19%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQN  366
            IN  ++   R L EGGF++VYLVK+                    +    YA+K +L Q 
Sbjct  15   INGKKYICSRLLAEGGFSFVYLVKD--------------------ASGRRYALKSMLCQT  54

Query  367  SEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            +E   +   EI+V + F+HPN+L L+DH+V      +G     E  +L P + DG+L D
Sbjct  55   AESEQVANREIQVFNKFNHPNILRLIDHSVCKSHKVQG---AKEYNMLMPFYKDGSLQD  110



>ref|XP_003389271.2| PREDICTED: serine/threonine-protein kinase 16-like [Amphimedon 
queenslandica]
Length=302

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 63/124 (51%), Gaps = 25/124 (20%)
 Frame = +1

Query  172  GGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKK  351
            G  + IN   +R+VR++GEGGF+YV LV+                      +   +A+K+
Sbjct  10   GRTLSINGESYRVVRRIGEGGFSYVDLVR--------------------GRNGEQFALKQ  49

Query  352  VLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDG  531
            +LIQ  EQ + V+ EI +    +HPN+L L+D  +     +E  + +    LLFP +  G
Sbjct  50   LLIQVEEQRESVEREIYMHQTVTHPNVLQLVDSQI-----TEQGNGEARGLLLFPFYQYG  104

Query  532  TLLD  543
            TL D
Sbjct  105  TLED  108



>gb|AAH05703.1| Stk16 protein [Mus musculus]
Length=227

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  V++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ +++    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSLKERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKKGTL  106



>ref|XP_001561379.1| hypothetical protein BC1G_00464 [Botrytis cinerea B05.10]
 emb|CCD45514.1| similar to serine/threonine protein kinase [Botrytis cinerea 
T4]
 gb|EMR86035.1| putative serine threonine protein [Botrytis cinerea BcDW1]
Length=413

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 71/142 (50%), Gaps = 30/142 (21%)
 Frame = +1

Query  142  LNALYDAVN------GGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKF  303
            L+ LY   N      G   + IN+  F+I+R LGEGGF+YVYLV++              
Sbjct  6    LDLLYTLTNCMSCFPGSPQLKINNRSFKILRLLGEGGFSYVYLVQDT-------------  52

Query  304  KDPSHASDNGTYAMKKVLIQ-NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASE  477
                 +SDN TYA+KK+      E + L  +E+   +LFS HPN++  +D+ V A ++  
Sbjct  53   -----SSDN-TYAVKKIRCPFGQESVALAMKEVEAYALFSPHPNIIHSVDYCVSADRSDP  106

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
            G       Y+L P +  G L D
Sbjct  107  G---AKTVYILLPYYRRGNLQD  125



>gb|EDL00385.1| serine/threonine kinase 16, isoform CRA_b [Mus musculus]
Length=229

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  V++LGEGGF+YV LV+ +                    D   Y
Sbjct  8    CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFY  48

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ +++    A      KHEA+LL P 
Sbjct  49   ALKRILCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSLKERGA------KHEAWLLLPF  102

Query  520  HMDGTL  537
               GTL
Sbjct  103  FKKGTL  108



>ref|XP_005395633.1| PREDICTED: serine/threonine-protein kinase 16 isoform X6 [Chinchilla 
lanigera]
Length=273

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 29/128 (23%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G + I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTIIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW--KHEAYLLF  513
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        + W  KHEA+LL 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFHHPNILRLVAYCL--------KEWGTKHEAWLLL  98

Query  514  PVHMDGTL  537
            P H  GTL
Sbjct  99   PFHKRGTL  106



>ref|XP_001594653.1| hypothetical protein SS1G_04461 [Sclerotinia sclerotiorum 1980]
 gb|EDO01985.1| hypothetical protein SS1G_04461 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=413

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 69/142 (49%), Gaps = 30/142 (21%)
 Frame = +1

Query  142  LNALYDAVN------GGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKF  303
            L+ LY   N      G   + IN+  F+I+R LGEGGF+YVYLV++              
Sbjct  6    LDLLYTLTNCMSCFPGSPQLKINNRSFKILRLLGEGGFSYVYLVQD--------------  51

Query  304  KDPSHASDNGTYAMKKVLIQ-NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASE  477
                  SD+ TYA+KK+      E +    +E+   +LFS HPN++  +D+ V A ++  
Sbjct  52   -----TSDDNTYAVKKIRCPFGQESVAQAMKEVEAYALFSPHPNIIHSVDYCVSADRSDP  106

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
            G       Y+L P +  G L D
Sbjct  107  G---AKTVYILLPYYRRGNLQD  125



>ref|XP_005395632.1| PREDICTED: serine/threonine-protein kinase 16 isoform X5 [Chinchilla 
lanigera]
Length=305

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 29/128 (23%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G + I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTIIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW--KHEAYLLF  513
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        + W  KHEA+LL 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFHHPNILRLVAYCL--------KEWGTKHEAWLLL  98

Query  514  PVHMDGTL  537
            P H  GTL
Sbjct  99   PFHKRGTL  106



>gb|AAV38392.1| serine/threonine kinase 16 [Homo sapiens]
Length=310

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 62/126 (49%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    + L+  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDLEEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>gb|EPQ64769.1| protein kinase [Blumeria graminis f. sp. tritici 96224]
Length=393

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 66/143 (46%), Gaps = 35/143 (24%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGC F G   L           IN+  F+I R LGEGGF+YVYLV++             
Sbjct  16   MGC-FPGTPTLK----------INNRSFKIARLLGEGGFSYVYLVQD-------------  51

Query  301  FKDPSHASDNGTYAMKKVLIQ-NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKAS  474
                   S+   YA+KK+      E + L   E++  +LFS HPN++  +DH V + K+ 
Sbjct  52   ------TSNEALYALKKIRCPFGQESVSLALREVKAYALFSPHPNIIQSIDHCVSSDKSD  105

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
             G       Y++ P +  G L D
Sbjct  106  PG---AKTVYIVLPYYRRGNLQD  125



>emb|CCU78988.1| serine/threonine protein kinase [Blumeria graminis f. sp. hordei 
DH14]
Length=393

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 66/143 (46%), Gaps = 35/143 (24%)
 Frame = +1

Query  121  MGCSFSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKK  300
            MGC F G   L           IN+  F+I R LGEGGF+YVYLV++             
Sbjct  16   MGC-FPGTPTLK----------INNRSFKIARLLGEGGFSYVYLVQD-------------  51

Query  301  FKDPSHASDNGTYAMKKVLIQ-NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKAS  474
                   S+   YA+KK+      E + L   E++  +LFS HPN++  +DH V + K+ 
Sbjct  52   ------TSNEALYALKKIRCPFGQESVSLALREVKAYALFSPHPNIIQSIDHCVSSDKSD  105

Query  475  EGQSWKHEAYLLFPVHMDGTLLD  543
             G       Y++ P +  G L D
Sbjct  106  PG---AKTVYIVLPYYRRGNLQD  125



>gb|EGW11867.1| Serine/threonine-protein kinase 16 [Cricetulus griseus]
Length=213

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  D  + E  +  LF HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQDEAQREADMHRLFHHPNILRLVAYCL------KERGAKHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_005395628.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005395629.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Chinchilla 
lanigera]
 ref|XP_005395630.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Chinchilla 
lanigera]
 ref|XP_005395631.1| PREDICTED: serine/threonine-protein kinase 16 isoform X4 [Chinchilla 
lanigera]
Length=332

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 29/128 (23%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G + I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTIIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW--KHEAYLLF  513
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        + W  KHEA+LL 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFHHPNILRLVAYCL--------KEWGTKHEAWLLL  98

Query  514  PVHMDGTL  537
            P H  GTL
Sbjct  99   PFHKRGTL  106



>ref|XP_006496525.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Mus 
musculus]
 gb|ABK42418.1| MPSK1 [synthetic construct]
Length=273

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  V++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ +++    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSLKERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKKGTL  106



>dbj|BAC27732.1| unnamed protein product [Mus musculus]
Length=305

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  V++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ +++    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSLKERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKKGTL  106



>gb|AAD02811.1| palmitylated serine/threonine kinase [Mus musculus]
Length=305

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  V++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ +++    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSLKERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKKGTL  106



>ref|XP_007519784.1| PREDICTED: serine/threonine-protein kinase 16 [Erinaceus europaeus]
Length=305

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V +++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVVLDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGRFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+LPL+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFHHPNILPLMAYCL------KERGTKHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  IKRGTL  106



>ref|NP_035624.3| serine/threonine-protein kinase 16 [Mus musculus]
 ref|NP_001264921.1| serine/threonine-protein kinase 16 [Mus musculus]
 ref|XP_006496524.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Mus 
musculus]
 sp|O88697.3|STK16_MOUSE RecName: Full=Serine/threonine-protein kinase 16; AltName: Full=Embryo-derived 
protein kinase; Short=Edpk; AltName: Full=Myristoylated 
and palmitoylated serine/threonine-protein kinase; 
Short=MPSK; AltName: Full=Protein kinase Krct; AltName: 
Full=Protein kinase PKL12; AltName: Full=TGF-beta-stimulated 
factor 1; Short=TSF-1; AltName: Full=Tyrosine-protein kinase 
STK16 [Mus musculus]
 emb|CAA06699.1| PKL12 protein [Mus musculus]
 gb|AAC98502.1| serine/threonine kinase 16 [Mus musculus]
 dbj|BAA74457.1| EDPK [Mus musculus]
 gb|AAH28999.1| Serine/threonine kinase 16 [Mus musculus]
 dbj|BAE28946.1| unnamed protein product [Mus musculus]
 gb|ABK42419.1| MPSK1 [synthetic construct]
 gb|EDL00383.1| serine/threonine kinase 16, isoform CRA_a [Mus musculus]
 gb|EDL00384.1| serine/threonine kinase 16, isoform CRA_a [Mus musculus]
 gb|EDL00386.1| serine/threonine kinase 16, isoform CRA_a [Mus musculus]
Length=305

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  V++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ +++    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSLKERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKKGTL  106



>ref|XP_007445878.1| PREDICTED: serine/threonine-protein kinase 16 [Lipotes vexillifer]
Length=305

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 25/128 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGQFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFRHPNILRLVAYCL------KERGTKHEAWLLLPF  100

Query  520  HMDGTLLD  543
               GTL D
Sbjct  101  FKRGTLWD  108



>dbj|BAC26947.1| unnamed protein product [Mus musculus]
Length=305

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  V++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ +++    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREAEMHRLFQHPNILRLMAYSLKERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKKGTL  106



>gb|EDL75404.1| serine/threonine kinase 16, isoform CRA_b [Rattus norvegicus]
Length=205

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  V++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ +++    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFQHPNILRLMAYSLKERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>gb|EKG22262.1| hypothetical protein MPH_00441 [Macrophomina phaseolina MS6]
Length=421

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 63/136 (46%), Gaps = 24/136 (18%)
 Frame = +1

Query  142  LNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHA  321
            L        G   + IN   F+I+R LGEGGF+YVYLV++                    
Sbjct  15   LTNCMSCFPGTPQLKINGRSFKILRLLGEGGFSYVYLVQD-------------------N  55

Query  322  SDNGTYAMKKVLIQ-NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASEGQSWKH  495
            S    YA+KK+      E + L  +E+   SLFS HPN++  +DH++ + K+  G     
Sbjct  56   SGQNLYALKKIRCPFGQESVSLALKEVEAYSLFSPHPNIIHCIDHSIASDKSDPG---AK  112

Query  496  EAYLLFPVHMDGTLLD  543
              Y+L P +  G L D
Sbjct  113  TVYILLPYYRRGNLQD  128



>gb|KIX94689.1| hypothetical protein Z520_09735 [Fonsecaea multimorphosa CBS 
102226]
Length=465

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 68/149 (46%), Gaps = 33/149 (22%)
 Frame = +1

Query  133  FSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDP  312
            F  L++          + IN+  FR++R LGEGGF+YVYLV++                 
Sbjct  9    FYSLSSCICCFPSSPQLKINNRSFRMLRLLGEGGFSYVYLVQDT----------------  52

Query  313  SHASDNGTYAMKKVLIQ-NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAV----------  456
               SD+  YA+KK+      E +    +E+   +LF+ HPN++  +DHAV          
Sbjct  53   ---SDSALYALKKIRCPFGQESVSQALKEVEAYTLFAPHPNIIHAVDHAVQTDSTTKVSG  109

Query  457  IAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            I   AS G S     Y+L P +  G L D
Sbjct  110  IGTDASNGAS--KTVYILLPYYRRGNLQD  136



>gb|KIW55799.1| hypothetical protein PV05_04522 [Exophiala xenobiotica]
Length=449

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 63/128 (49%), Gaps = 28/128 (22%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ-  363
            IN+  FR++R LGEGGF+YVYLV++                    SD+  YA+KK+    
Sbjct  30   INNRSFRMLRLLGEGGFSYVYLVQD-------------------TSDSALYALKKIRCPF  70

Query  364  NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAV-------IAVKASEGQSWKHEAYLLFPV  519
              E +    +E+   +LF+ HPN++  +DHAV       ++   +E  S     Y+L P 
Sbjct  71   GQESVSQALKEVEAYTLFAPHPNIIHSIDHAVQNDSSTKVSGIGNEASSTSKTVYILLPY  130

Query  520  HMDGTLLD  543
            +  G L D
Sbjct  131  YRRGNLQD  138



>ref|XP_009181397.1| PREDICTED: serine/threonine-protein kinase 16 [Papio anubis]
Length=295

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LFSHPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFSHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>gb|KIX02735.1| hypothetical protein Z518_08677 [Rhinocladiella mackenziei CBS 
650.93]
Length=455

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 28/128 (22%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ-  363
            IN+  FR++R LGEGGF+YVYLV++                    SD+  YA+KK+    
Sbjct  27   INNRSFRMLRLLGEGGFSYVYLVQD-------------------TSDSALYALKKIRCPF  67

Query  364  NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAV-------IAVKASEGQSWKHEAYLLFPV  519
              E +    +E+   SLF+ HPN++  +DHAV       ++   +E  S     Y+L P 
Sbjct  68   GQESVSQALKEVEAYSLFAPHPNIIHSIDHAVQNDSTTKVSGIGAETGSASKTVYILLPY  127

Query  520  HMDGTLLD  543
            +  G L D
Sbjct  128  YRRGNLQD  135



>ref|XP_005574406.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Macaca 
fascicularis]
 ref|XP_005574407.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Macaca 
fascicularis]
Length=305

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LFSHPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFSHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|NP_001253902.1| serine/threonine-protein kinase 16 [Macaca mulatta]
 ref|XP_007964536.1| PREDICTED: serine/threonine-protein kinase 16 [Chlorocebus sabaeus]
 ref|XP_007964537.1| PREDICTED: serine/threonine-protein kinase 16 [Chlorocebus sabaeus]
Length=305

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LFSHPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFSHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>gb|EWM24320.1| serine threonine protein kinase [Nannochloropsis gaditana]
Length=401

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 55/116 (47%), Gaps = 19/116 (16%)
 Frame = +1

Query  196  NRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQNSEQ  375
             + RIV+QL EGGF YV+L ++     A                   +A+K++L Q  EQ
Sbjct  38   RKVRIVKQLAEGGFGYVFLAQDRRTGEA-------------------FALKRMLCQTQEQ  78

Query  376  LDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            +  VK E+     F HPNLLP++D  V      +  S     YLLFP    G+L D
Sbjct  79   IYAVKREMLYHREFQHPNLLPVIDTHVQQQHRPQSGSTGIYVYLLFPYLSGGSLRD  134



>dbj|GAA94070.1| hypothetical protein E5Q_00717 [Mixia osmundae IAM 14324]
 gb|KEI41783.1| hypothetical protein L969DRAFT_45043 [Mixia osmundae IAM 14324]
Length=421

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 56/122 (46%), Gaps = 25/122 (20%)
 Frame = +1

Query  178  DVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVL  357
            DV +N   F+IVR LGEGGFA+VYL ++                    S    +A+KK+ 
Sbjct  19   DVKLNGRTFKIVRLLGEGGFAFVYLAEDT-------------------SSGRQFALKKIR  59

Query  358  IQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTL  537
             Q+SE   +  +E+     F HP  +  LD  VI  +  EGQ      YL  P +  G L
Sbjct  60   CQSSEGYRIAMKEVEAYKRFRHPYCIRCLDSCVI--QDEEGQVI----YLFLPFYKRGNL  113

Query  538  LD  543
             D
Sbjct  114  QD  115



>ref|XP_007122499.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Physeter 
catodon]
Length=273

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 25/128 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGQFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  520  HMDGTLLD  543
               GTL D
Sbjct  101  FKRGTLWD  108



>ref|XP_007188028.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Balaenoptera 
acutorostrata scammoni]
Length=273

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 25/128 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGQFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILHLVAYCL------RERGTKHEAWLLLPF  100

Query  520  HMDGTLLD  543
               GTL D
Sbjct  101  FKRGTLWD  108



>dbj|BAG63548.1| unnamed protein product [Homo sapiens]
Length=213

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_007122498.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Physeter 
catodon]
Length=305

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 25/128 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGQFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  520  HMDGTLLD  543
               GTL D
Sbjct  101  FKRGTLWD  108



>gb|KIW66504.1| hypothetical protein PV04_05833 [Capronia semiimmersa]
Length=452

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 62/130 (48%), Gaps = 30/130 (23%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ-  363
            IN   FR++R LGEGGF+YVYLV++                    +DN  YA+KK+    
Sbjct  27   INSRSFRMLRLLGEGGFSYVYLVQDT-------------------NDNALYALKKIRCPF  67

Query  364  NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASEGQSWKHEA---------YLLF  513
              E +    +E+   +LF+ HPN++  +DHAV+A   ++      E          Y+L 
Sbjct  68   GQESVSQALKEVEAYTLFAPHPNIIASVDHAVLADSTTKVSGIGQETGNGGASKTVYILL  127

Query  514  PVHMDGTLLD  543
            P +  G L D
Sbjct  128  PYYRRGNLQD  137



>ref|XP_007188026.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007188027.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=305

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 25/128 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGQFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILHLVAYCL------RERGTKHEAWLLLPF  100

Query  520  HMDGTLLD  543
               GTL D
Sbjct  101  FKRGTLWD  108



>ref|XP_004262741.1| PREDICTED: serine/threonine-protein kinase 16 [Orcinus orca]
 ref|XP_004320388.1| PREDICTED: serine/threonine-protein kinase 16 [Tursiops truncatus]
Length=305

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 25/128 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGQFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  520  HMDGTLLD  543
               GTL D
Sbjct  101  FKRGTLWD  108



>ref|XP_007722449.1| NAK protein kinase [Capronia coronata CBS 617.96]
 gb|EXJ90255.1| NAK protein kinase [Capronia coronata CBS 617.96]
Length=458

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 70/149 (47%), Gaps = 33/149 (22%)
 Frame = +1

Query  133  FSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDP  312
            +S  N LY    G   + IN+  FR++R LGEGGF+YVYLV++                 
Sbjct  10   YSLCNCLY-CFPGTPQLKINNRSFRMLRLLGEGGFSYVYLVQD-----------------  51

Query  313  SHASDNGTYAMKKVLIQ-NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAV----------  456
               +D+  YA+KK+      E +    +E+   +LF+ HPN++  +DHAV          
Sbjct  52   --TTDSALYALKKIRCPFGQESVSQALKEVEAYTLFAPHPNIIRSIDHAVQNDSTTKVSG  109

Query  457  IAVKASEGQSWKHEAYLLFPVHMDGTLLD  543
            I    S G + K   Y+L P +  G L D
Sbjct  110  IGNDTSAGAASK-TVYILLPYYRRGNLQD  137



>ref|XP_006245222.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Rattus 
norvegicus]
Length=273

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 62/126 (49%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  V++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ +++      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFQHPNILRLMAYSL------KERGAKHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_008723761.1| hypothetical protein G647_09545 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI27355.1| hypothetical protein G647_09545 [Cladophialophora carrionii CBS 
160.54]
Length=458

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 63/131 (48%), Gaps = 32/131 (24%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ-  363
            IN   FR++R LGEGGF+YVYLV++                    SD+  YA+KK+    
Sbjct  27   INSRSFRMLRLLGEGGFSYVYLVQDT-------------------SDSALYALKKIRCPF  67

Query  364  NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAV----------IAVKASEGQSWKHEAYLL  510
              E +    +E+   +LF+ HPN++  +DHAV          I  +A  G + K   Y+L
Sbjct  68   GQESVSQALKEVEAYTLFAPHPNIIASIDHAVLNDSTTKVSGIGAEAGNGGASK-TVYIL  126

Query  511  FPVHMDGTLLD  543
             P +  G L D
Sbjct  127  LPYYRRGNLQD  137



>ref|XP_010610139.1| PREDICTED: serine/threonine-protein kinase 16 [Fukomys damarensis]
 ref|XP_010610140.1| PREDICTED: serine/threonine-protein kinase 16 [Fukomys damarensis]
 gb|KFO20162.1| Serine/threonine-protein kinase 16 [Fukomys damarensis]
Length=305

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREAEMHRLFHHPNILHLVAYCL------KERGTKHEAWLLLPF  100

Query  520  HMDGTL  537
            +  GTL
Sbjct  101  YKRGTL  106



>ref|XP_007646375.1| PREDICTED: serine/threonine-protein kinase 16 [Cricetulus griseus]
 ref|XP_007614240.1| PREDICTED: serine/threonine-protein kinase 16 [Cricetulus griseus]
 gb|ERE86579.1| serine/threonine-protein kinase 16-like protein [Cricetulus griseus]
Length=305

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  D  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQDEAQREADMHRLFHHPNILRLVAYCLKERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_007757578.1| NAK protein kinase [Cladophialophora yegresii CBS 114405]
 gb|EXJ57955.1| NAK protein kinase [Cladophialophora yegresii CBS 114405]
Length=458

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 63/131 (48%), Gaps = 32/131 (24%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ-  363
            IN   FR++R LGEGGF+YVYLV++                    SD+  YA+KK+    
Sbjct  27   INSRSFRMLRLLGEGGFSYVYLVQDT-------------------SDSALYALKKIRCPF  67

Query  364  NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAV----------IAVKASEGQSWKHEAYLL  510
              E +    +E+   +LF+ HPN++  +DHAV          I  +A  G + K   Y+L
Sbjct  68   GQESVSQALKEVEAYTLFAPHPNIIASIDHAVLTDSTTKVSGIGAEAGNGGASK-TVYIL  126

Query  511  FPVHMDGTLLD  543
             P +  G L D
Sbjct  127  LPYYRRGNLQD  137



>gb|EMF10956.1| serine/threonine protein kinase [Sphaerulina musiva SO2202]
Length=433

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 62/121 (51%), Gaps = 23/121 (19%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ-  363
            IN   F+I+R LGEGGF++VYLV+        PG      DP+       YA+KK+    
Sbjct  35   INGRSFKILRLLGEGGFSFVYLVQ-------SPG------DPT------LYALKKIRCPF  75

Query  364  NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLL  540
              E + L  +E+   SLFS HPN++  +DHAV   +   G +     Y+L P +  G L 
Sbjct  76   GEESVSLALKEVEAYSLFSPHPNIIHAIDHAVETDRG--GDAGSKTVYILLPYYRRGNLQ  133

Query  541  D  543
            D
Sbjct  134  D  134



>ref|NP_775165.1| serine/threonine-protein kinase 16 [Rattus norvegicus]
 sp|P57760.2|STK16_RAT RecName: Full=Serine/threonine-protein kinase 16; AltName: Full=Myristoylated 
and palmitoylated serine/threonine-protein 
kinase; Short=MPSK; AltName: Full=Protein kinase PKL12; AltName: 
Full=TGF-beta-stimulated factor 1; Short=TSF-1; AltName: 
Full=Tyrosine-protein kinase STK16 [Rattus norvegicus]
 dbj|BAB16310.1| F52 [Rattus norvegicus]
 gb|EDL75402.1| serine/threonine kinase 16, isoform CRA_a [Rattus norvegicus]
 gb|EDL75403.1| serine/threonine kinase 16, isoform CRA_a [Rattus norvegicus]
 gb|EDL75405.1| serine/threonine kinase 16, isoform CRA_a [Rattus norvegicus]
Length=305

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  V++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ +++    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFQHPNILRLMAYSLKERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_005001103.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Cavia 
porcellus]
Length=273

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 29/128 (23%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW--KHEAYLLF  513
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        + W  KHEA+LL 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFHHPNILRLVAYCL--------KEWGSKHEAWLLL  98

Query  514  PVHMDGTL  537
            P +  GTL
Sbjct  99   PFYKRGTL  106



>ref|XP_003464049.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Cavia 
porcellus]
 ref|XP_005001102.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Cavia 
porcellus]
Length=305

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 29/128 (23%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW--KHEAYLLF  513
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        + W  KHEA+LL 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFHHPNILRLVAYCL--------KEWGSKHEAWLLL  98

Query  514  PVHMDGTL  537
            P +  GTL
Sbjct  99   PFYKRGTL  106



>ref|XP_008823981.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Nannospalax 
galili]
Length=273

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        Q  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHHLFHHPNVLRLVAYCL------REQGAKHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>gb|KEY70585.1| hypothetical protein S7711_02189 [Stachybotrys chartarum IBT 
7711]
 gb|KFA54892.1| hypothetical protein S40293_08545 [Stachybotrys chartarum IBT 
40293]
Length=229

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 64/140 (46%), Gaps = 22/140 (16%)
 Frame = +1

Query  133  FSGLNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDP  312
            F       +   G   + IN+  F+I R LGEGGF+YVYLV++                 
Sbjct  9    FYSFGNCLNCFPGSPTLKINNRSFKIQRLLGEGGFSYVYLVED-----------------  51

Query  313  SHASDNGTYAMKKVLIQ-NSEQLDLVKEEIRVSSLFSH-PNLLPLLDHAVIAVKASEGQS  486
               S + T+A+KK+     +E + L   E+    LF+H P ++  +DHAV   +   G  
Sbjct  52   --TSSHETFALKKIRCPFGAESVQLAMREVDAYRLFAHIPTIISAVDHAVATERGGGGAD  109

Query  487  WKHEA-YLLFPVHMDGTLLD  543
              ++  Y+L P +  G L D
Sbjct  110  ESNKTVYVLLPYYRRGNLQD  129



>ref|XP_007751990.1| NAK protein kinase [Cladophialophora psammophila CBS 110553]
 gb|EXJ53562.1| NAK protein kinase [Cladophialophora psammophila CBS 110553]
Length=464

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 63/131 (48%), Gaps = 33/131 (25%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ-  363
            IN+  FR++R LGEGGF+YVYLV++                    SD+  YA+KK+    
Sbjct  27   INNRSFRMLRLLGEGGFSYVYLVQDT-------------------SDSALYALKKIRCPF  67

Query  364  NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAV----------IAVKASEGQSWKHEAYLL  510
              E +    +E+   +LF+ HPN++  +DHAV          I   A+ G S     Y+L
Sbjct  68   GQESVSQALKEVEAYTLFAPHPNIIHAVDHAVQTDSTTKVSGIGTDAANGAS--KTVYIL  125

Query  511  FPVHMDGTLLD  543
             P +  G L D
Sbjct  126  LPYYRRGNLQD  136



>ref|XP_007777376.1| NAK protein kinase [Coniosporium apollinis CBS 100218]
 gb|EON62059.1| NAK protein kinase [Coniosporium apollinis CBS 100218]
Length=418

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 64/136 (47%), Gaps = 24/136 (18%)
 Frame = +1

Query  142  LNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHA  321
            L        G   + IN+  F+I+R LGEGGF+YVYLV++                    
Sbjct  15   LTNCMSCFPGSPQLRINNKSFKILRLLGEGGFSYVYLVQD-------------------T  55

Query  322  SDNGTYAMKKVLIQ-NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASEGQSWKH  495
            S +  YA+KK+      E +    +E+   SLF+ HPN++  +DH+V + K+  G     
Sbjct  56   STSTLYALKKIRCPFGQESVSQALKEVEAYSLFAPHPNIIRAIDHSVESDKSDPGAKT--  113

Query  496  EAYLLFPVHMDGTLLD  543
              Y+L P +  G L D
Sbjct  114  -VYILLPYYRRGNLQD  128



>ref|XP_004876210.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004876211.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004876212.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Heterocephalus 
glaber]
 ref|XP_004864601.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004864602.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004864603.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Heterocephalus 
glaber]
 gb|EHA97559.1| Serine/threonine-protein kinase 16 [Heterocephalus glaber]
Length=305

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHHLFYHPNILRLVAYCLKERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
            +  GTL
Sbjct  101  YKRGTL  106



>ref|XP_003272445.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
16 [Nomascus leucogenys]
Length=305

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVTIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_005672285.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Sus 
scrofa]
Length=273

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------RDGQFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>emb|CAA06700.1| PKL12 protein [Homo sapiens]
Length=310

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_008823979.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Nannospalax 
galili]
 ref|XP_008823980.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Nannospalax 
galili]
Length=305

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        Q  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHHLFHHPNVLRLVAYCL------REQGAKHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>gb|AAC28337.1| myristilated and palmitylated serine-threonine kinase MPSK [Homo 
sapiens]
Length=305

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>emb|CCA71061.1| related to Prk1p [Piriformospora indica DSM 11827]
Length=471

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 58/121 (48%), Gaps = 23/121 (19%)
 Frame = +1

Query  181  VWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLI  360
            V +N   ++IV+ LGEGGF++VYL ++                    S    +A+KK+ +
Sbjct  36   VKVNGRTYKIVKALGEGGFSFVYLAQD-------------------ESTGREFALKKIRV  76

Query  361  QNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLL  540
             NSE +     EI     F HPN++ + D +V+   + EG+      YL  P++  G L 
Sbjct  77   HNSEGVKGAMREIEAYRRFRHPNIIRIYDSSVVQDPSGEGKI----VYLFLPLYKRGNLQ  132

Query  541  D  543
            D
Sbjct  133  D  133



>gb|AAH02618.1| Serine/threonine kinase 16 [Homo sapiens]
 emb|CAG28603.1| STK16 [Homo sapiens]
 gb|ACE86734.1| serine/threonine kinase 16 protein [synthetic construct]
 gb|AIC55438.1| STK16, partial [synthetic construct]
 gb|AIC62641.1| STK16, partial [synthetic construct]
Length=305

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_003852606.1| hypothetical protein MYCGRDRAFT_72191 [Zymoseptoria tritici IPO323]
 gb|EGP87582.1| hypothetical protein MYCGRDRAFT_72191 [Zymoseptoria tritici IPO323]
Length=431

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 62/121 (51%), Gaps = 23/121 (19%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ-  363
            IN   F+I+R LGEGGF+YVYLV+        PG      DP+       YA+KK+    
Sbjct  35   INGRSFKILRLLGEGGFSYVYLVQ-------SPG------DPT------LYALKKIRCPF  75

Query  364  NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLL  540
              E + L  +E+   SLF+ HPN++  +DH+V   +   G +     Y+L P +  G L 
Sbjct  76   GEESVSLALKEVEAYSLFTPHPNIIHAIDHSVETDRG--GDAGSKTVYILLPYYRRGNLQ  133

Query  541  D  543
            D
Sbjct  134  D  134



>emb|CAA09387.1| serine/threonine kinase [Homo sapiens]
Length=305

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_001162451.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Pan 
troglodytes]
 ref|XP_001162494.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Pan 
troglodytes]
Length=305

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>gb|ESZ99238.1| serine/threonine protein kinase [Sclerotinia borealis F-4157]
Length=413

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 68/142 (48%), Gaps = 30/142 (21%)
 Frame = +1

Query  142  LNALYDAVN------GGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKF  303
            L+ LY   N      G   + IN+  F+I+R LGEGGF+YVYLV++              
Sbjct  6    LDLLYTLTNCMSCFPGSPQLKINNRSFKILRLLGEGGFSYVYLVQD--------------  51

Query  304  KDPSHASDNGTYAMKKVLIQ-NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASE  477
                 +S   +YA+KK+      E +    +E+   +LFS HPN++  +D+ V A ++  
Sbjct  52   -----SSSEASYALKKIRCPFGQESVAQAMKEVEAYALFSPHPNIIQSVDYCVSADRSDP  106

Query  478  GQSWKHEAYLLFPVHMDGTLLD  543
            G       Y+L P +  G L D
Sbjct  107  G---AKTVYILLPYYRRGNLQD  125



>gb|ACE87420.1| serine/threonine kinase 16 protein [synthetic construct]
Length=305

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_003818698.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Pan 
paniscus]
 ref|XP_003818699.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Pan 
paniscus]
Length=305

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>dbj|BAF85383.1| unnamed protein product [Homo sapiens]
Length=305

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|NP_001008910.1| serine/threonine-protein kinase 16 [Homo sapiens]
 ref|XP_002812932.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Pongo 
abelii]
 ref|XP_004033297.1| PREDICTED: serine/threonine-protein kinase 16 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004033298.1| PREDICTED: serine/threonine-protein kinase 16 isoform 2 [Gorilla 
gorilla gorilla]
 sp|O75716.4|STK16_HUMAN RecName: Full=Serine/threonine-protein kinase 16; AltName: Full=Myristoylated 
and palmitoylated serine/threonine-protein 
kinase; Short=MPSK; AltName: Full=Protein kinase PKL12; AltName: 
Full=TGF-beta-stimulated factor 1; Short=TSF-1; AltName: 
Full=Tyrosine-protein kinase STK16; AltName: Full=hPSK [Homo 
sapiens]
 gb|AAG23728.1|AF203910_1 serine/threonine kinase KRCT [Homo sapiens]
 dbj|BAB16311.1| F5-2 [Homo sapiens]
 gb|AAH53998.1| Serine/threonine kinase 16 [Homo sapiens]
 gb|EAW70714.1| serine/threonine kinase 16, isoform CRA_a [Homo sapiens]
 gb|EAW70717.1| serine/threonine kinase 16, isoform CRA_a [Homo sapiens]
 gb|AIC50153.1| STK16, partial [synthetic construct]
Length=305

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_011456099.1| PREDICTED: serine/threonine-protein kinase 16-like [Crassostrea 
gigas]
Length=318

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 65/130 (50%), Gaps = 20/130 (15%)
 Frame = +1

Query  157  DAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGT  336
            + V G   + IN+ RF I  +LGEGGF+YV L+++                   A ++  
Sbjct  12   NCVCGREALTINNRRFYIRNRLGEGGFSYVDLIED-------------------ARNHKD  52

Query  337  YAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAV-KASEGQSWKHEAYLLF  513
            YA+K++   + E+  +  +E+ +   F HPN++PL + A I V K S+      E  ++ 
Sbjct  53   YALKRITCHSKEEERVAAQEVELMRRFKHPNIIPLEESANIKVSKYSKTLDILSEVLIVM  112

Query  514  PVHMDGTLLD  543
            P +  G++ D
Sbjct  113  PYYCRGSIQD  122



>gb|AAQ02488.1| serine/threonine kinase 16, partial [synthetic construct]
Length=306

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>gb|KIW33065.1| hypothetical protein PV07_04563 [Cladophialophora immunda]
Length=464

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 62/131 (47%), Gaps = 33/131 (25%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ-  363
            IN+  FR++R LGEGGF+YVYLV++                    SD+  YA+KK+    
Sbjct  27   INNRSFRMLRLLGEGGFSYVYLVQD-------------------TSDSALYALKKIRCPF  67

Query  364  NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAV----------IAVKASEGQSWKHEAYLL  510
              E +    +E+   SLF+ HPN++  +DHAV          I    + G S     Y+L
Sbjct  68   GQESVSQALKEVEAYSLFAPHPNIIHAVDHAVQTDSTTKVSGIGTDTANGAS--KTVYIL  125

Query  511  FPVHMDGTLLD  543
             P +  G L D
Sbjct  126  LPYYRRGNLQD  136



>ref|XP_010358600.1| PREDICTED: serine/threonine-protein kinase 16 [Rhinopithecus 
roxellana]
 ref|XP_010358601.1| PREDICTED: serine/threonine-protein kinase 16 [Rhinopithecus 
roxellana]
 ref|XP_010358602.1| PREDICTED: serine/threonine-protein kinase 16 [Rhinopithecus 
roxellana]
Length=305

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_001928241.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Sus 
scrofa]
 ref|XP_005672284.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Sus 
scrofa]
Length=305

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------RDGQFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_011231795.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Ailuropoda 
melanoleuca]
Length=273

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_008688657.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Ursus 
maritimus]
Length=273

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_006972221.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Peromyscus 
maniculatus bairdii]
 ref|XP_006972222.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Peromyscus 
maniculatus bairdii]
Length=305

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 59/126 (47%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  + +LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIHKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFQHPNILRLMAYCLKERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_004638249.1| PREDICTED: serine/threonine-protein kinase 16 [Octodon degus]
Length=305

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 61/123 (50%), Gaps = 29/123 (24%)
 Frame = +1

Query  175  GDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKV  354
            G V I++ R+  +++LGEGGF+YV LV+ +                    D   YA+K++
Sbjct  11   GTVLIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFYALKRI  51

Query  355  LIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSW--KHEAYLLFPVHMD  528
            L    +  +  + E  +  LF HPN+L L+ + +        + W  KHEA+LL P +  
Sbjct  52   LCHEQQDQEEAQREADMHRLFHHPNILHLVAYCL--------KEWGTKHEAWLLLPFYKK  103

Query  529  GTL  537
            GTL
Sbjct  104  GTL  106



>ref|XP_004674323.1| PREDICTED: serine/threonine-protein kinase 16 [Condylura cristata]
Length=308

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V +++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIMDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  K E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAKREADMHRLFQHPNILHLVAYCL------RERGTKHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_002749858.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Callithrix 
jacchus]
 ref|XP_008997780.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Callithrix 
jacchus]
 ref|XP_008997781.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Callithrix 
jacchus]
 gb|ABY89799.1| serine/threonine kinase 16, isoform 2 (predicted) [Callithrix 
jacchus]
Length=305

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHHLFNHPNILHLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_006168694.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Tupaia 
chinensis]
Length=273

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEHQDREEAQREADMHRLFHHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKKGTL  106



>gb|KIV84313.1| hypothetical protein PV11_00101 [Exophiala sideris]
Length=452

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 63/128 (49%), Gaps = 28/128 (22%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ-  363
            IN   FR++R LGEGGF+YVYLV++                    +D+  YA+KK+    
Sbjct  27   INSRSFRMLRLLGEGGFSYVYLVQD-------------------TADSALYALKKIRCPF  67

Query  364  NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAV-------IAVKASEGQSWKHEAYLLFPV  519
              E +    +E+   +LF+ HPN++  +DHAV       ++   ++G S     Y+L P 
Sbjct  68   GQESVSQALKEVEAYTLFAPHPNIIHSIDHAVQNDSSTKVSGIGNDGGSSSKTVYILLPY  127

Query  520  HMDGTLLD  543
            +  G L D
Sbjct  128  YRRGNLQD  135



>ref|XP_545656.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Canis 
lupus familiaris]
Length=305

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVLIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_004662965.1| PREDICTED: serine/threonine-protein kinase 16 [Jaculus jaculus]
Length=305

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_007582065.1| putative serine threonine protein [Neofusicoccum parvum UCRNP2]
 gb|EOD50465.1| putative serine threonine protein [Neofusicoccum parvum UCRNP2]
Length=397

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 62/136 (46%), Gaps = 24/136 (18%)
 Frame = +1

Query  142  LNALYDAVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHA  321
            L        G   + IN   F+I+R LGEGGF+YVYLV++                    
Sbjct  15   LTNCMSCFPGTPQLKINGRSFKILRLLGEGGFSYVYLVQD-------------------N  55

Query  322  SDNGTYAMKKVLIQ-NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASEGQSWKH  495
            S    YA+KK+      E +    +E+   SLFS HPN++  +DH++ + K+  G     
Sbjct  56   SGQNLYALKKIRCPFGQESVSQALKEVEAYSLFSPHPNIIHCIDHSIASDKSDPG---AK  112

Query  496  EAYLLFPVHMDGTLLD  543
              Y+L P +  G L D
Sbjct  113  TVYILLPYYRRGNLQD  128



>gb|KEQ83345.1| kinase-like protein [Aureobasidium pullulans EXF-150]
Length=417

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 60/121 (50%), Gaps = 24/121 (20%)
 Frame = +1

Query  187  INDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTYAMKKVLIQ-  363
            IN   ++I+R LGEGGF+YVYLV+     P  P +               YA+KK+    
Sbjct  31   INGRSYKILRLLGEGGFSYVYLVQS----PPSPNL---------------YALKKIRCPF  71

Query  364  NSEQLDLVKEEIRVSSLFS-HPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPVHMDGTLL  540
             +E + L  +E+   SLF  HPN++  LDHAVI  ++          Y+L P +  G L 
Sbjct  72   GAESVALALKEVEAYSLFQPHPNIIHALDHAVIPDRSDPS---AKTVYILLPYYRRGNLQ  128

Query  541  D  543
            D
Sbjct  129  D  129



>ref|XP_005330559.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Ictidomys 
tridecemlineatus]
 ref|XP_005330560.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Ictidomys 
tridecemlineatus]
Length=305

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCLKERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_008585681.1| PREDICTED: serine/threonine-protein kinase 16 [Galeopterus variegatus]
 ref|XP_008585682.1| PREDICTED: serine/threonine-protein kinase 16 [Galeopterus variegatus]
Length=305

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_006168692.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Tupaia 
chinensis]
 ref|XP_006168693.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Tupaia 
chinensis]
 gb|ELV10670.1| Serine/threonine-protein kinase 16 [Tupaia chinensis]
Length=305

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEHQDREEAQREADMHRLFHHPNILRLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKKGTL  106



>ref|XP_003784978.1| PREDICTED: serine/threonine-protein kinase 16 [Otolemur garnettii]
Length=305

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_008688654.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Ursus 
maritimus]
 ref|XP_008688655.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Ursus 
maritimus]
Length=305

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +        +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHRLFHHPNILRLVAYCL------RERGTKHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_010334582.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_010334583.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_010334584.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_010334585.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Saimiri 
boliviensis boliviensis]
Length=351

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 25/128 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVVIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF+HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREEAQREADMHHLFNHPNVLHLVAYCLRERGA------KHEAWLLLPF  100

Query  520  HMDGTLLD  543
               GTL +
Sbjct  101  FKRGTLWN  108



>ref|XP_008528199.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Equus 
przewalskii]
Length=273

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +      + +  KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREDAQREADMHRLFHHPNILRLVAYCL------KERGAKHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>emb|CCI44431.1| unnamed protein product [Albugo candida]
Length=511

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 44/69 (64%), Gaps = 5/69 (7%)
 Frame = +1

Query  337  YAMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFP  516
            +A+KK++ Q+ EQ  + K E+++ ++F H N++PL+DHA +        S  HE YLLFP
Sbjct  32   FALKKIICQSEEQRRMAKHEVQLHNVFKHSNIMPLVDHAEVTAG-----SLCHEFYLLFP  86

Query  517  VHMDGTLLD  543
               +GTL D
Sbjct  87   YMQEGTLRD  95



>ref|XP_005070530.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Mesocricetus 
auratus]
 ref|XP_005070531.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Mesocricetus 
auratus]
Length=305

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDQEEAQREADMHRLFHHPNILRLVAYCLKERGA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



>ref|XP_002712533.1| PREDICTED: serine/threonine-protein kinase 16 [Oryctolagus cuniculus]
 ref|XP_008257430.1| PREDICTED: serine/threonine-protein kinase 16 [Oryctolagus cuniculus]
 ref|XP_008257431.1| PREDICTED: serine/threonine-protein kinase 16 [Oryctolagus cuniculus]
 ref|XP_008257432.1| PREDICTED: serine/threonine-protein kinase 16 [Oryctolagus cuniculus]
 ref|XP_008257433.1| PREDICTED: serine/threonine-protein kinase 16 [Oryctolagus cuniculus]
 ref|XP_008257434.1| PREDICTED: serine/threonine-protein kinase 16 [Oryctolagus cuniculus]
Length=305

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = +1

Query  160  AVNGGGDVWINDNRFRIVRQLGEGGFAYVYLVKEILADPAKPGVSKKFKDPSHASDNGTY  339
             V   G V I++ R+  +++LGEGGF+YV LV+ +                    D   Y
Sbjct  6    CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGL-------------------HDGHFY  46

Query  340  AMKKVLIQNSEQLDLVKEEIRVSSLFSHPNLLPLLDHAVIAVKASEGQSWKHEAYLLFPV  519
            A+K++L    +  +  + E  +  LF HPN+L L+ + +    A      KHEA+LL P 
Sbjct  47   ALKRILCHEQQDREDAQREADMHRLFHHPNILRLVAYCLRERDA------KHEAWLLLPF  100

Query  520  HMDGTL  537
               GTL
Sbjct  101  FKRGTL  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490