BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF019E06

Length=580
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011083416.1|  PREDICTED: uncharacterized protein LOC105165954    259   7e-84   Sesamum indicum [beniseed]
gb|EYU36814.1|  hypothetical protein MIMGU_mgv1a013669mg                256   1e-82   Erythranthe guttata [common monkey flower]
ref|NP_001266237.1|  Hop-interacting protein THI120                     253   1e-81   
ref|NP_001274971.1|  uncharacterized protein LOC102584137               253   2e-81   Solanum tuberosum [potatoes]
ref|XP_009776939.1|  PREDICTED: uncharacterized protein LOC104226608    237   3e-75   Nicotiana sylvestris
ref|XP_009620058.1|  PREDICTED: uncharacterized protein LOC104111945    237   3e-75   Nicotiana tomentosiformis
ref|XP_011074724.1|  PREDICTED: DNL-type zinc finger protein-like       235   2e-74   Sesamum indicum [beniseed]
emb|CDP07337.1|  unnamed protein product                                235   3e-74   Coffea canephora [robusta coffee]
ref|XP_006435267.1|  hypothetical protein CICLE_v10002475mg             234   4e-74   Citrus clementina [clementine]
ref|XP_010664127.1|  PREDICTED: uncharacterized protein LOC100243759    229   3e-72   Vitis vinifera
ref|XP_002307755.2|  hypothetical protein POPTR_0005s26750g             224   5e-70   Populus trichocarpa [western balsam poplar]
gb|KDP36867.1|  hypothetical protein JCGZ_08158                         223   5e-70   Jatropha curcas
ref|XP_011003097.1|  PREDICTED: uncharacterized protein LOC105109924    224   6e-70   Populus euphratica
ref|XP_007017922.1|  Zim17-type zinc finger protein                     223   1e-69   
gb|KJB14347.1|  hypothetical protein B456_002G120700                    221   3e-69   Gossypium raimondii
gb|KHG11073.1|  Mitochondrial import protein ZIM17                      221   4e-69   Gossypium arboreum [tree cotton]
gb|AIA63975.1|  transcription factor ZFP130                             219   1e-68   Gossypium hirsutum [American cotton]
ref|XP_010539089.1|  PREDICTED: uncharacterized protein LOC104813220    218   7e-68   Tarenaya hassleriana [spider flower]
ref|XP_002510604.1|  conserved hypothetical protein                     218   7e-68   Ricinus communis
ref|XP_010063286.1|  PREDICTED: uncharacterized protein LOC104450433    216   6e-67   
gb|EPS65916.1|  hypothetical protein M569_08860                         211   8e-66   Genlisea aurea
gb|KFK32942.1|  hypothetical protein AALP_AA6G309400                    211   5e-65   Arabis alpina [alpine rockcress]
ref|XP_010690316.1|  PREDICTED: uncharacterized protein LOC104903883    209   7e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010455142.1|  PREDICTED: uncharacterized protein LOC104736...    206   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_008806155.1|  PREDICTED: uncharacterized protein LOC103718920    206   4e-63   Phoenix dactylifera
ref|XP_010421646.1|  PREDICTED: uncharacterized protein LOC104707...    206   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010266915.1|  PREDICTED: uncharacterized protein LOC104604317    204   2e-62   Nelumbo nucifera [Indian lotus]
ref|XP_008447918.1|  PREDICTED: uncharacterized protein LOC103490262    204   3e-62   Cucumis melo [Oriental melon]
ref|XP_004144863.1|  PREDICTED: uncharacterized protein LOC101212325    203   4e-62   Cucumis sativus [cucumbers]
ref|XP_010086843.1|  Mitochondrial protein import protein ZIM17         202   9e-62   Morus notabilis
ref|XP_002874388.1|  hypothetical protein ARALYDRAFT_489599             202   1e-61   
ref|XP_010941361.1|  PREDICTED: uncharacterized protein LOC105059672    201   3e-61   Elaeis guineensis
ref|XP_008358361.1|  PREDICTED: uncharacterized protein LOC103422104    201   4e-61   
ref|XP_010935184.1|  PREDICTED: uncharacterized protein LOC105055145    200   6e-61   Elaeis guineensis
ref|XP_002300678.2|  hypothetical protein POPTR_0002s01730g             200   7e-61   Populus trichocarpa [western balsam poplar]
ref|XP_011034950.1|  PREDICTED: uncharacterized protein LOC105132906    200   8e-61   Populus euphratica
ref|XP_010455141.1|  PREDICTED: uncharacterized protein LOC104736...    200   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006288620.1|  hypothetical protein CARUB_v10001922mg             199   1e-60   Capsella rubella
ref|XP_010421645.1|  PREDICTED: uncharacterized protein LOC104707...    200   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_007200461.1|  hypothetical protein PRUPE_ppa011293mg             198   5e-60   Prunus persica
ref|XP_004497201.1|  PREDICTED: uncharacterized protein LOC101505438    198   7e-60   Cicer arietinum [garbanzo]
ref|XP_008236070.1|  PREDICTED: uncharacterized protein LOC103334867    197   2e-59   Prunus mume [ume]
ref|NP_198080.1|  Zim17-type zinc finger protein                        196   4e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64347.1|  unknown                                                 195   8e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008811775.1|  PREDICTED: uncharacterized protein LOC103722...    194   1e-58   Phoenix dactylifera
ref|XP_010494029.1|  PREDICTED: uncharacterized protein LOC104771232    194   4e-58   Camelina sativa [gold-of-pleasure]
gb|KHN37381.1|  Hypothetical protein glysoja_013596                     193   4e-58   Glycine soja [wild soybean]
ref|XP_009414426.1|  PREDICTED: uncharacterized protein LOC103995548    193   4e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001235094.1|  uncharacterized protein LOC100527113               193   4e-58   Glycine max [soybeans]
ref|XP_006588421.1|  PREDICTED: uncharacterized protein LOC100527...    192   7e-58   Glycine max [soybeans]
ref|XP_006605315.1|  PREDICTED: uncharacterized protein LOC100527...    192   9e-58   Glycine max [soybeans]
ref|XP_006405268.1|  hypothetical protein EUTSA_v10027929mg             192   1e-57   Eutrema salsugineum [saltwater cress]
ref|NP_001236547.1|  uncharacterized protein LOC100527474               192   1e-57   
ref|XP_006588420.1|  PREDICTED: uncharacterized protein LOC100527...    192   1e-57   
ref|XP_009391023.1|  PREDICTED: uncharacterized protein LOC103977...    192   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009355592.1|  PREDICTED: uncharacterized protein LOC103946591    192   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_008811782.1|  PREDICTED: uncharacterized protein LOC103722...    189   5e-57   
emb|CDY12988.1|  BnaC02g29950D                                          190   5e-57   Brassica napus [oilseed rape]
ref|XP_008348928.1|  PREDICTED: uncharacterized protein LOC103412108    190   5e-57   
gb|AFK34110.1|  unknown                                                 190   1e-56   Lotus japonicus
gb|KJB14348.1|  hypothetical protein B456_002G120700                    186   2e-56   Gossypium raimondii
ref|XP_007142794.1|  hypothetical protein PHAVU_007G017400g             188   5e-56   Phaseolus vulgaris [French bean]
gb|AFK48753.1|  unknown                                                 188   6e-56   Medicago truncatula
gb|KEH44399.1|  DNL zinc finger protein                                 188   6e-56   Medicago truncatula
ref|XP_011458699.1|  PREDICTED: uncharacterized protein LOC105349780    187   8e-56   Fragaria vesca subsp. vesca
ref|XP_009418558.1|  PREDICTED: uncharacterized protein LOC103998726    186   3e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK39869.1|  unknown                                                 186   4e-55   Lotus japonicus
ref|XP_009391021.1|  PREDICTED: uncharacterized protein LOC103977...    186   8e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ38321.1|  hypothetical protein OsJ_22696                          184   8e-55   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058612.2|  Os06g0724400                                       184   1e-54   
ref|XP_009391022.1|  PREDICTED: uncharacterized protein LOC103977...    185   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ02398.1|  hypothetical protein OsI_24501                          182   4e-54   Oryza sativa Indica Group [Indian rice]
ref|NP_001131303.1|  uncharacterized protein LOC100192616               182   5e-54   Zea mays [maize]
ref|XP_008643737.1|  PREDICTED: LOC100283270 isoform X1                 182   7e-54   
gb|ABK21254.1|  unknown                                                 182   1e-53   Picea sitchensis
ref|XP_010028773.1|  PREDICTED: uncharacterized protein LOC104418983    181   2e-53   Eucalyptus grandis [rose gum]
ref|XP_004966483.1|  PREDICTED: uncharacterized protein LOC101768670    178   2e-52   Setaria italica
ref|XP_006828828.1|  hypothetical protein AMTR_s00001p00142230          177   4e-52   Amborella trichopoda
ref|XP_002439041.1|  hypothetical protein SORBIDRAFT_10g030440          177   1e-51   Sorghum bicolor [broomcorn]
ref|XP_006656504.1|  PREDICTED: uncharacterized protein LOC102700628    174   1e-50   
ref|XP_003563260.1|  PREDICTED: uncharacterized protein LOC100844750    174   1e-50   Brachypodium distachyon [annual false brome]
dbj|BAJ94825.1|  predicted protein                                      172   8e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006386156.1|  hypothetical protein POPTR_0002s01730g             167   2e-48   
ref|NP_001149644.1|  LOC100283270                                       162   6e-47   
ref|XP_002977585.1|  hypothetical protein SELMODRAFT_58719              148   4e-42   
gb|EMS65438.1|  hypothetical protein TRIUR3_05242                       156   3e-41   Triticum urartu
ref|XP_001760208.1|  predicted protein                                  139   3e-36   
gb|EMT02176.1|  hypothetical protein F775_14553                         134   2e-33   
gb|EYU17552.1|  hypothetical protein MIMGU_mgv1a023730mg              96.3    3e-21   Erythranthe guttata [common monkey flower]
emb|CAO02549.1|  putative zinc finger (DNL type) family protein       90.1    2e-19   Vigna unguiculata
ref|XP_010470860.1|  PREDICTED: uncharacterized protein LOC104750716  85.5    4e-17   Camelina sativa [gold-of-pleasure]
tpg|DAA58876.1|  TPA: etched1 isoform 1                               80.1    5e-16   
ref|XP_010511888.1|  PREDICTED: uncharacterized protein LOC104787...  81.6    7e-16   
ref|XP_006301666.1|  hypothetical protein CARUB_v10022115mg           82.0    8e-16   
ref|XP_004969096.1|  PREDICTED: DNL-type zinc finger protein-like     80.9    1e-15   Setaria italica
ref|NP_001043517.2|  Os01g0605200                                     80.5    1e-15   
gb|ABK26747.1|  unknown                                               80.5    1e-15   Picea sitchensis
ref|NP_001150527.1|  zinc ribbon 1                                    80.9    1e-15   
ref|XP_002458121.1|  hypothetical protein SORBIDRAFT_03g027210        80.9    1e-15   Sorghum bicolor [broomcorn]
tpg|DAA58878.1|  TPA: etched1                                         80.9    2e-15   
gb|EEC71043.1|  hypothetical protein OsI_02763                        80.1    2e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001105722.1|  etched1                                          80.5    2e-15   
ref|XP_008446529.1|  PREDICTED: uncharacterized protein C24H6.02c...  79.3    5e-15   Cucumis melo [Oriental melon]
gb|KFK41298.1|  hypothetical protein AALP_AA2G112200                  79.3    5e-15   Arabis alpina [alpine rockcress]
ref|NP_001105159.1|  zinc ribbon 1                                    79.3    5e-15   Zea mays [maize]
ref|XP_010470865.1|  PREDICTED: uncharacterized protein LOC104750723  79.3    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002438978.1|  hypothetical protein SORBIDRAFT_10g029320        79.0    6e-15   
ref|XP_002888678.1|  zinc finger family protein                       79.3    6e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_009392908.1|  PREDICTED: uncharacterized protein LOC103978730  79.0    7e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010511887.1|  PREDICTED: uncharacterized protein LOC104787...  79.0    7e-15   Camelina sativa [gold-of-pleasure]
gb|AFW81000.1|  putative tify domain/CCT motif transcription fact...  79.7    8e-15   
ref|XP_010066771.1|  PREDICTED: uncharacterized protein LOC104453...  78.6    8e-15   Eucalyptus grandis [rose gum]
ref|XP_001777870.1|  predicted protein                                78.6    1e-14   
ref|XP_006644344.1|  PREDICTED: uncharacterized protein C24H6.02c...  77.4    2e-14   
ref|XP_008777543.1|  PREDICTED: uncharacterized protein LOC103697...  77.8    2e-14   Phoenix dactylifera
ref|NP_177040.2|  Zim17-type zinc finger protein                      77.4    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008777542.1|  PREDICTED: uncharacterized protein LOC103697...  77.8    2e-14   Phoenix dactylifera
ref|XP_010925225.1|  PREDICTED: uncharacterized protein LOC105047...  77.4    2e-14   Elaeis guineensis
ref|XP_010925241.1|  PREDICTED: uncharacterized protein LOC105047...  77.4    2e-14   Elaeis guineensis
ref|XP_010925233.1|  PREDICTED: uncharacterized protein LOC105047...  77.4    3e-14   Elaeis guineensis
ref|XP_010925248.1|  PREDICTED: uncharacterized protein LOC105047...  77.4    3e-14   Elaeis guineensis
ref|XP_004135125.1|  PREDICTED: uncharacterized protein LOC101206910  77.4    3e-14   Cucumis sativus [cucumbers]
ref|XP_002314899.2|  zinc finger family protein                       76.3    6e-14   
ref|XP_010681378.1|  PREDICTED: DNL-type zinc finger protein isof...  75.9    6e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010262339.1|  PREDICTED: uncharacterized protein LOC104600...  75.9    8e-14   Nelumbo nucifera [Indian lotus]
ref|XP_005652036.1|  zf-DNL-domain-containing protein                 76.3    9e-14   Coccomyxa subellipsoidea C-169
ref|XP_011008859.1|  PREDICTED: mitochondrial protein import prot...  75.9    1e-13   Populus euphratica
gb|EPS62111.1|  hypothetical protein M569_12682                       73.2    1e-13   Genlisea aurea
ref|XP_003518825.1|  PREDICTED: DNL-type zinc finger protein-like     75.1    1e-13   Glycine max [soybeans]
ref|XP_002280593.1|  PREDICTED: mitochondrial protein import prot...  75.5    1e-13   Vitis vinifera
gb|KJB50817.1|  hypothetical protein B456_008G188300                  74.7    2e-13   Gossypium raimondii
ref|XP_009356516.1|  PREDICTED: uncharacterized protein LOC103947335  75.1    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_008360068.1|  PREDICTED: uncharacterized protein LOC103423766  75.1    2e-13   
ref|XP_010425752.1|  PREDICTED: uncharacterized protein LOC104710796  75.1    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_011070860.1|  PREDICTED: DNL-type zinc finger protein isof...  73.9    2e-13   
ref|XP_007153312.1|  hypothetical protein PHAVU_003G024500g           74.3    2e-13   Phaseolus vulgaris [French bean]
ref|XP_009614441.1|  PREDICTED: uncharacterized protein C24H6.02c     74.7    2e-13   Nicotiana tomentosiformis
ref|XP_003569318.1|  PREDICTED: uncharacterized protein C24H6.02c...  74.3    2e-13   Brachypodium distachyon [annual false brome]
ref|XP_009791194.1|  PREDICTED: uncharacterized protein C24H6.02c     74.7    2e-13   Nicotiana sylvestris
gb|KEH29577.1|  DNL zinc finger protein                               74.3    3e-13   Medicago truncatula
ref|XP_006391103.1|  hypothetical protein EUTSA_v10019239mg           74.3    3e-13   Eutrema salsugineum [saltwater cress]
ref|XP_006348591.1|  PREDICTED: uncharacterized protein C24H6.02c...  74.3    3e-13   Solanum tuberosum [potatoes]
ref|XP_004238981.1|  PREDICTED: uncharacterized protein C24H6.02c     74.3    3e-13   Solanum lycopersicum
ref|XP_008246043.1|  PREDICTED: mitochondrial protein import prot...  74.3    3e-13   Prunus mume [ume]
ref|XP_008339721.1|  PREDICTED: uncharacterized protein LOC103402741  74.3    4e-13   
ref|XP_009355956.1|  PREDICTED: uncharacterized protein LOC103946868  74.3    4e-13   Pyrus x bretschneideri [bai li]
ref|XP_010523289.1|  PREDICTED: DNL-type zinc finger protein          73.9    4e-13   Tarenaya hassleriana [spider flower]
emb|CDM83104.1|  unnamed protein product                              73.6    4e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008361865.1|  PREDICTED: uncharacterized protein LOC103425553  74.3    4e-13   
gb|KHG19418.1|  DNL-type zinc finger                                  73.6    4e-13   Gossypium arboreum [tree cotton]
ref|NP_001239683.1|  uncharacterized protein LOC100786955             73.6    5e-13   Glycine max [soybeans]
ref|XP_004505313.1|  PREDICTED: mitochondrial protein import prot...  73.6    5e-13   
ref|XP_010096705.1|  DNL-type zinc finger protein                     73.6    6e-13   Morus notabilis
ref|XP_011070859.1|  PREDICTED: uncharacterized protein LOC105156...  73.6    6e-13   Sesamum indicum [beniseed]
ref|XP_010227814.1|  PREDICTED: DNL-type zinc finger protein-like     73.2    6e-13   
ref|XP_006858707.1|  hypothetical protein AMTR_s00066p00105400        73.6    6e-13   Amborella trichopoda
gb|EMT29434.1|  hypothetical protein F775_05239                       72.8    7e-13   
ref|XP_006437770.1|  hypothetical protein CICLE_v10032948mg           73.2    8e-13   
dbj|BAJ89579.1|  predicted protein                                    72.8    9e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP00540.1|  unnamed protein product                              73.2    9e-13   Coffea canephora [robusta coffee]
ref|XP_007046358.1|  Zim17-type zinc finger protein, putative iso...  72.0    1e-12   
ref|XP_007223547.1|  hypothetical protein PRUPE_ppa012145mg           72.8    1e-12   Prunus persica
emb|CDX95993.1|  BnaA07g27380D                                        72.0    2e-12   
ref|XP_004297161.1|  PREDICTED: uncharacterized protein LOC101312048  71.6    3e-12   Fragaria vesca subsp. vesca
ref|XP_009127663.1|  PREDICTED: uncharacterized protein LOC103852...  71.6    3e-12   Brassica rapa
ref|XP_009127664.1|  PREDICTED: uncharacterized protein LOC103852...  71.2    3e-12   
emb|CDY54500.1|  BnaA02g35640D                                        71.2    3e-12   Brassica napus [oilseed rape]
emb|CDX81538.1|  BnaC02g18420D                                        70.9    5e-12   
ref|XP_009105422.1|  PREDICTED: mitochondrial protein import prot...  70.1    9e-12   Brassica rapa
emb|CDY38613.1|  BnaC06g30360D                                        69.7    1e-11   Brassica napus [oilseed rape]
ref|XP_003063279.1|  predicted protein                                69.7    2e-11   Micromonas pusilla CCMP1545
emb|CDY28109.1|  BnaC06g02900D                                        65.5    7e-11   Brassica napus [oilseed rape]
ref|XP_005847953.1|  hypothetical protein CHLNCDRAFT_52093            67.8    2e-10   Chlorella variabilis
ref|XP_005844772.1|  hypothetical protein CHLNCDRAFT_138626           63.2    2e-09   Chlorella variabilis
dbj|BAJ23062.1|  hypothetical protein                                 62.8    4e-09   Pseudocentrotus depressus
gb|EXX72907.1|  Zim17p                                                62.8    5e-09   Rhizophagus irregularis DAOM 197198w
ref|XP_001421744.1|  predicted protein                                62.0    6e-09   Ostreococcus lucimarinus CCE9901
ref|XP_011397348.1|  Fructose-1-phosphate phosphatase YqaB            63.9    7e-09   Auxenochlorella protothecoides
emb|CDY36477.1|  BnaC03g48360D                                        60.5    1e-08   Brassica napus [oilseed rape]
emb|CDX97891.1|  BnaC04g40480D                                        58.9    1e-08   
dbj|GAN02263.1|  conserved hypothetical protein                       60.8    2e-08   Mucor ambiguus
ref|XP_003083615.1|  ETCHED1 protein (ISS)                            60.8    2e-08   Ostreococcus tauri
gb|KHJ41186.1|  ribosomal protein S15                                 61.6    3e-08   Trichuris suis
emb|CEG63113.1|  Putative Zf-DNL-domain-containing protein            59.7    4e-08   Rhizopus microsporus
gb|EPB86614.1|  hypothetical protein HMPREF1544_06590                 59.7    4e-08   Mucor circinelloides f. circinelloides 1006PhL
emb|CEI97298.1|  Putative Zf-DNL-domain-containing protein            59.7    4e-08   Rhizopus microsporus
emb|CCK72609.1|  hypothetical protein KNAG_0K02460                    59.3    4e-08   Kazachstania naganishii CBS 8797
emb|CEG80750.1|  hypothetical protein RMATCC62417_15046               59.7    4e-08   Rhizopus microsporus
emb|CEI95525.1|  Putative Piso0_002320 protein                        59.7    5e-08   Rhizopus microsporus
ref|XP_003725494.1|  PREDICTED: DNL-type zinc finger protein-like     58.5    1e-07   Strongylocentrotus purpuratus [purple urchin]
emb|CDW52158.1|  Coq4 and Ribosomal S13 N and Ribosomal S15 and z...  60.1    2e-07   Trichuris trichiura
gb|AFW71389.1|  hypothetical protein ZEAMMB73_297185                  60.1    2e-07   
emb|CEP08401.1|  hypothetical protein                                 58.2    2e-07   Parasitella parasitica
ref|XP_001691699.1|  Hsp70 escorting protein 2                        58.2    2e-07   Chlamydomonas reinhardtii
ref|XP_004346924.1|  hypothetical protein CAOG_05239                  58.5    2e-07   Capsaspora owczarzaki ATCC 30864
ref|XP_008191756.1|  PREDICTED: DNL-type zinc finger protein-like     57.0    3e-07   Tribolium castaneum [rust-red flour beetle]
gb|ABK24010.1|  unknown                                               57.8    3e-07   Picea sitchensis
emb|CDH58781.1|  hypothetical protein RO3G_11646                      56.6    5e-07   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS07381.1|  hypothetical protein LRAMOSA01330                    56.6    6e-07   Lichtheimia ramosa
ref|XP_001992524.1|  GH24157                                          56.6    6e-07   Drosophila grimshawi
emb|CEP62412.1|  LALA0S05e05072g1_1                                   55.8    8e-07   Lachancea lanzarotensis
emb|CCC46977.1|  conserved hypothetical protein                       55.8    9e-07   Trypanosoma vivax Y486
ref|NP_081104.1|  DNL-type zinc finger protein isoform 1              55.8    9e-07   Mus musculus [mouse]
gb|EIE86935.1|  hypothetical protein RO3G_11646                       56.2    9e-07   Rhizopus delemar RA 99-880
ref|XP_002495780.1|  ZYRO0C02882p                                     55.5    9e-07   Zygosaccharomyces rouxii
gb|AGO11609.1|  AaceriADL173Cp                                        55.8    1e-06   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_002059602.1|  GJ14731                                          55.8    1e-06   Drosophila virilis
ref|XP_002010480.1|  GI14660                                          55.8    1e-06   Drosophila mojavensis
ref|XP_007637235.1|  PREDICTED: LOW QUALITY PROTEIN: DNL-type zin...  55.1    1e-06   
gb|ERE70542.1|  DNL-type zinc finger protein                          55.8    1e-06   Cricetulus griseus [Chinese hamsters]
ref|XP_002555014.1|  KLTH0F19052p                                     55.5    1e-06   Lachancea thermotolerans CBS 6340
ref|XP_002493869.1|  Heat shock protein with a zinc finger motif      55.5    1e-06   Komagataella phaffii GS115
gb|ETN66741.1|  hypothetical protein AND_001480                       54.7    1e-06   Anopheles darlingi [American malaria mosquito]
ref|XP_008840170.1|  PREDICTED: DNL-type zinc finger protein isof...  55.8    2e-06   
ref|NP_983923.1|  ADL173Cp                                            55.5    2e-06   Eremothecium gossypii ATCC 10895
gb|EIF45938.1|  zim17p                                                55.5    2e-06   Brettanomyces bruxellensis AWRI1499
ref|XP_006687723.1|  zf-DNL-domain-containing protein                 55.1    2e-06   Yamadazyma tenuis ATCC 10573
ref|XP_005760580.1|  DNL zinc finger protein                          56.2    2e-06   Emiliania huxleyi CCMP1516
ref|XP_002024413.1|  GL15020                                          55.1    2e-06   Drosophila persimilis
ref|XP_009862369.1|  PREDICTED: DNL-type zinc finger protein-like     55.1    2e-06   Ciona intestinalis [sea vase]
tpg|DAA51711.1|  TPA: hypothetical protein ZEAMMB73_994626            56.6    2e-06   
ref|XP_001354904.1|  GA20897                                          55.1    2e-06   Drosophila pseudoobscura pseudoobscura
ref|XP_002614239.1|  hypothetical protein CLUG_05725                  54.7    2e-06   Clavispora lusitaniae ATCC 42720
ref|XP_005083712.1|  PREDICTED: DNL-type zinc finger protein          54.7    2e-06   Mesocricetus auratus [Syrian golden hamster]
gb|KGK37232.1|  hypothetical protein JL09_g3628                       55.1    3e-06   Pichia kudriavzevii
ref|XP_315385.4|  AGAP005377-PA                                       53.9    3e-06   Anopheles gambiae str. PEST
gb|KFH66652.1|  hypothetical protein MVEG_07177                       55.5    3e-06   Mortierella verticillata NRRL 6337
gb|EGW12770.1|  DNL-type zinc finger protein                          53.9    3e-06   Cricetulus griseus [Chinese hamsters]
ref|XP_006863874.1|  PREDICTED: DNL-type zinc finger protein          54.3    3e-06   Chrysochloris asiatica
ref|XP_010736167.1|  PREDICTED: DNL-type zinc finger protein          54.3    4e-06   
gb|EEH05800.1|  DNL zinc finger domain-containing protein             54.7    4e-06   Histoplasma capsulatum G186AR
ref|XP_006674935.1|  hypothetical protein BATDEDRAFT_7290             52.0    4e-06   Batrachochytrium dendrobatidis JAM81
gb|EEQ92563.1|  DNL zinc finger domain-containing protein             54.7    4e-06   Blastomyces dermatitidis ER-3
ref|XP_003644612.1|  hypothetical protein Ecym_2037                   54.3    4e-06   Eremothecium cymbalariae DBVPG#7215
emb|CBK20169.2|  Zim17                                                53.1    4e-06   Blastocystis hominis
ref|XP_004198925.1|  Piso0_002320                                     54.3    4e-06   
ref|XP_002626197.1|  DNL zinc finger domain-containing protein        54.7    4e-06   Blastomyces gilchristii SLH14081
ref|XP_009308557.1|  zf-DNL-domain-containing protein                 54.3    4e-06   Trypanosoma grayi
ref|XP_004199776.1|  Piso0_002320                                     53.9    5e-06   
ref|XP_002107042.1|  GD17233                                          54.3    5e-06   Drosophila simulans
emb|CDH12975.1|  related to Mitochondrial protein import protein ...  53.5    5e-06   Zygosaccharomyces bailii ISA1307
ref|XP_008482374.1|  PREDICTED: DNL-type zinc finger protein-like     54.3    5e-06   
ref|XP_002100710.1|  GE17213                                          53.9    5e-06   Drosophila yakuba
emb|CDK25150.1|  unnamed protein product                              54.7    5e-06   Kuraishia capsulata CBS 1993
ref|XP_003688733.1|  hypothetical protein TPHA_0P01410                53.9    5e-06   Tetrapisispora phaffii CBS 4417
ref|NP_573064.1|  CG8206, isoform A                                   53.9    5e-06   Drosophila melanogaster
ref|XP_003510907.1|  PREDICTED: DNL-type zinc finger protein isof...  53.9    5e-06   Cricetulus griseus [Chinese hamsters]
ref|XP_001978045.1|  GG17905                                          53.9    5e-06   Drosophila erecta
ref|XP_010681379.1|  PREDICTED: uncharacterized protein LOC104896...  52.8    5e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008840169.1|  PREDICTED: DNL-type zinc finger protein isof...  55.1    5e-06   
ref|XP_002594862.1|  hypothetical protein BRAFLDRAFT_86030            53.5    6e-06   Branchiostoma floridae
gb|EYU22609.1|  hypothetical protein MIMGU_mgv1a026408mg              52.4    6e-06   Erythranthe guttata [common monkey flower]
emb|CDF87706.1|  BN860_12596g1_1                                      53.1    7e-06   Zygosaccharomyces bailii CLIB 213
ref|XP_010607176.1|  PREDICTED: DNL-type zinc finger protein          53.5    7e-06   Fukomys damarensis [Damara mole rat]
ref|XP_009173620.1|  hypothetical protein T265_09323                  54.7    7e-06   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_006675484.1|  hypothetical protein BATDEDRAFT_22160            54.3    8e-06   Batrachochytrium dendrobatidis JAM81
ref|XP_002071136.1|  GK25634                                          53.5    8e-06   Drosophila willistoni
dbj|GAK62655.1|  zf-DNL-domain-containing protein                     53.5    9e-06   Moesziomyces antarcticus
ref|XP_007095644.1|  PREDICTED: uncharacterized protein LOC102959539  54.7    9e-06   
ref|XP_001483464.1|  hypothetical protein PGUG_04193                  52.8    9e-06   Meyerozyma guilliermondii ATCC 6260
ref|XP_004593704.1|  PREDICTED: DNL-type zinc finger protein          52.4    9e-06   Ochotona princeps [southern American pika]
ref|XP_003473033.1|  PREDICTED: DNL-type zinc finger protein isof...  53.1    1e-05   Cavia porcellus [guinea pig]
ref|XP_004285091.1|  PREDICTED: DNL-type zinc finger protein          52.8    1e-05   Orcinus orca [Orca]
ref|XP_004640585.1|  PREDICTED: DNL-type zinc finger protein          53.1    1e-05   Octodon degus
ref|XP_449518.1|  hypothetical protein                                53.1    1e-05   [Candida] glabrata
gb|ACN37055.1|  unknown                                               53.1    1e-05   Zea mays [maize]
gb|ETE59988.1|  DNL-type zinc finger protein                          52.4    1e-05   Ophiophagus hannah
ref|XP_820850.1|  hypothetical protein                                53.1    1e-05   Trypanosoma cruzi strain CL Brener
ref|NP_001150499.1|  LOC100284130                                     53.1    1e-05   
ref|XP_461045.2|  DEHA2F15774p                                        53.1    1e-05   Debaryomyces hansenii CBS767
ref|XP_004799780.1|  PREDICTED: DNL-type zinc finger protein          52.8    1e-05   
gb|KIY98188.1|  Hsp70 escorting protein 2                             53.5    1e-05   Monoraphidium neglectum
ref|XP_003965336.1|  PREDICTED: DNL-type zinc finger protein-like     52.0    1e-05   
emb|CCW63414.1|  unnamed protein product                              53.1    1e-05   Phytomonas sp. isolate EM1
ref|XP_008446528.1|  PREDICTED: uncharacterized protein LOC103489...  52.8    1e-05   
ref|XP_004410770.1|  PREDICTED: DNL-type zinc finger protein          52.8    1e-05   Odobenus rosmarus divergens
gb|KFM78808.1|  DNL-type zinc finger protein                          52.4    1e-05   Stegodyphus mimosarum
ref|XP_007508671.1|  predicted protein                                53.1    1e-05   Bathycoccus prasinos
ref|NP_001124462.1|  DNL-type zinc finger protein                     52.8    1e-05   Rattus norvegicus [brown rat]
ref|XP_006403530.1|  hypothetical protein EUTSA_v10010741mg           52.8    1e-05   
ref|XP_001385314.1|  hypothetical protein PICST_59964                 51.6    1e-05   
ref|XP_011109584.1|  hypothetical protein H072_3614                   53.9    1e-05   
dbj|GAA84039.1|  mitochondrial import protein Zim17                   52.8    1e-05   
ref|XP_002311410.2|  hypothetical protein POPTR_0008s11030g           51.6    2e-05   
ref|XP_454278.1|  hypothetical protein                                52.8    2e-05   
ref|XP_009523416.1|  hypothetical protein PHYSODRAFT_259700           52.8    2e-05   
gb|EER41665.1|  DNL zinc finger protein                               53.1    2e-05   
gb|EGC49531.1|  DNL zinc finger domain-containing protein             53.1    2e-05   
emb|CBH09890.1|  hypothetical protein, conserved                      52.8    2e-05   
ref|XP_843824.1|  hypothetical protein                                52.8    2e-05   
emb|CCW70893.1|  unnamed protein product                              53.1    2e-05   
ref|XP_001394190.1|  DNL zinc finger domain protein                   52.8    2e-05   
ref|XP_011122970.1|  hypothetical protein AOL_s00080g293              52.8    2e-05   
ref|XP_001966034.1|  GF19477                                          52.4    2e-05   
ref|XP_004207823.1|  PREDICTED: DNL-type zinc finger protein-like     52.4    2e-05   
ref|XP_010262345.1|  PREDICTED: uncharacterized protein LOC104600...  51.6    2e-05   
ref|XP_003941416.1|  PREDICTED: DNL-type zinc finger protein          52.0    2e-05   
ref|XP_520365.2|  PREDICTED: DNL-type zinc finger protein             52.0    2e-05   
ref|XP_002454792.1|  hypothetical protein SORBIDRAFT_04g037475        52.8    2e-05   
ref|XP_010112217.1|  DNL-type zinc finger protein                     52.4    2e-05   
ref|XP_007521583.1|  PREDICTED: DNL-type zinc finger protein          52.0    3e-05   
ref|XP_001642186.1|  hypothetical protein Kpol_167p1                  52.0    3e-05   
ref|XP_005189472.1|  PREDICTED: DNL-type zinc finger protein          52.0    3e-05   
ref|XP_004307372.1|  PREDICTED: uncharacterized protein LOC101291376  52.8    3e-05   
ref|XP_003673948.1|  hypothetical protein NCAS_0A10090                52.0    3e-05   
ref|XP_003426587.1|  PREDICTED: DNL-type zinc finger protein-like     52.0    3e-05   
ref|XP_002951711.1|  hypothetical protein VOLCADRAFT_117941           52.8    3e-05   
ref|XP_849286.1|  PREDICTED: DNL-type zinc finger protein             51.6    3e-05   
gb|KJB50818.1|  hypothetical protein B456_008G188300                  50.8    3e-05   
gb|EAY88046.1|  hypothetical protein OsI_09474                        52.0    3e-05   
ref|XP_007945125.1|  PREDICTED: DNL-type zinc finger protein          51.6    3e-05   
emb|CDY07518.1|  BnaC06g15460D                                        52.0    3e-05   
ref|XP_010925256.1|  PREDICTED: uncharacterized protein LOC105047...  50.8    3e-05   
ref|NP_001048537.1|  Os02g0819700                                     51.6    3e-05   
ref|NP_001074318.1|  DNL-type zinc finger protein                     51.6    4e-05   
ref|XP_008243140.1|  PREDICTED: uncharacterized protein LOC103341403  51.2    4e-05   
ref|XP_003668024.1|  hypothetical protein NDAI_0A06270                52.0    4e-05   
ref|XP_005408560.1|  PREDICTED: DNL-type zinc finger protein-like     51.6    4e-05   
ref|XP_008890456.1|  hypothetical protein PPTG_00743                  51.6    4e-05   
ref|XP_007901068.1|  PREDICTED: DNL-type zinc finger protein isof...  51.6    4e-05   
dbj|BAE99394.1|  hypothetical protein                                 52.0    4e-05   
ref|XP_006918169.1|  PREDICTED: DNL-type zinc finger protein          51.2    4e-05   
emb|CDI50951.1|  related to ZIM17-Zinc finger Motif protein, mito...  52.0    4e-05   
gb|EPY24030.1|  hypothetical protein AGDE_12563                       51.6    4e-05   
gb|AAO64784.1|  At3g54830                                             51.6    5e-05   
gb|EMT16528.1|  hypothetical protein F775_30154                       51.6    5e-05   
ref|XP_002908206.1|  conserved hypothetical protein                   51.2    5e-05   
ref|XP_011442194.1|  PREDICTED: DNL-type zinc finger protein-like     50.8    5e-05   
dbj|BAO40425.1|  DNL zinc finger domain-containing protein            51.2    5e-05   
gb|EYE95089.1|  DNL zinc finger domain protein                        51.2    5e-05   
ref|NP_974434.2|  protein ZINC RIBBON 3                               52.0    5e-05   
gb|EMS46743.1|  hypothetical protein TRIUR3_16284                     51.2    5e-05   
ref|XP_009103937.1|  PREDICTED: uncharacterized protein LOC103829...  51.2    5e-05   
ref|XP_007901069.1|  PREDICTED: DNL-type zinc finger protein isof...  50.8    5e-05   
ref|XP_009103936.1|  PREDICTED: uncharacterized protein LOC103829...  51.2    5e-05   
gb|EMG47278.1|  hypothetical protein G210_2410                        50.8    5e-05   
ref|XP_006062284.1|  PREDICTED: DNL-type zinc finger protein-like     50.4    5e-05   
pdb|2E2Z|A  Chain A, Solution Nmr Structure Of Yeast Tim15, Co-Ch...  49.7    6e-05   
ref|XP_003582892.1|  PREDICTED: DNL-type zinc finger protein          50.8    6e-05   
ref|XP_004178081.1|  hypothetical protein TBLA_0A07730                51.2    6e-05   
gb|EJK62092.1|  hypothetical protein THAOC_17311                      52.0    6e-05   
ref|XP_004459655.1|  PREDICTED: DNL-type zinc finger protein          50.8    6e-05   
ref|XP_006292193.1|  hypothetical protein CARUB_v10018399mg           51.2    6e-05   
ref|XP_011229908.1|  PREDICTED: DNL-type zinc finger protein          50.4    6e-05   
gb|ETO15024.1|  hypothetical protein RFI_22345                        50.8    6e-05   
gb|EHB04827.1|  DNL-type zinc finger protein                          50.8    6e-05   
ref|XP_011368287.1|  PREDICTED: DNL-type zinc finger protein          49.7    7e-05   
gb|KEH29576.1|  DNL zinc finger protein                               50.1    7e-05   
ref|XP_008003840.1|  PREDICTED: DNL-type zinc finger protein isof...  50.8    7e-05   
ref|XP_003911135.1|  PREDICTED: DNL-type zinc finger protein          50.8    7e-05   
ref|XP_006572853.1|  PREDICTED: uncharacterized protein LOC100786...  50.1    7e-05   
ref|XP_006572854.1|  PREDICTED: uncharacterized protein LOC100786...  49.7    7e-05   
ref|XP_003795003.1|  PREDICTED: DNL-type zinc finger protein          50.8    7e-05   
ref|NP_001181664.1|  DNL-type zinc finger protein                     50.8    7e-05   
ref|XP_002175448.1|  TIM23 translocase complex subunit Tim15          50.4    7e-05   
ref|XP_010371036.1|  PREDICTED: DNL-type zinc finger protein          50.8    8e-05   
gb|AFW82607.1|  hypothetical protein ZEAMMB73_891096                  52.4    8e-05   
gb|EJK52589.1|  hypothetical protein THAOC_28119                      51.2    8e-05   
gb|EJT44486.1|  ZIM17-like protein                                    50.4    8e-05   
gb|KGO65606.1|  Zinc finger, DNL-type                                 50.8    8e-05   
tpg|DAA34189.1|  TPA: hypothetical secreted protein 1840              50.1    8e-05   
gb|AJT21325.1|  Zim17p                                                50.4    8e-05   
gb|EEH19415.1|  hypothetical protein PABG_01734                       51.2    8e-05   
gb|EFB22703.1|  hypothetical protein PANDA_014080                     49.7    9e-05   
gb|EFX88143.1|  hypothetical protein DAPPUDRAFT_221352                50.1    9e-05   
ref|XP_002797301.1|  DNL zinc finger domain-containing protein        51.2    9e-05   
gb|AFW82608.1|  hypothetical protein ZEAMMB73_891096                  52.0    9e-05   
ref|XP_006955786.1|  zf-DNL-domain-containing protein                 49.7    9e-05   
ref|XP_007875933.1|  hypothetical protein PFL1_00245                  50.4    9e-05   
ref|XP_004613455.1|  PREDICTED: DNL-type zinc finger protein          50.4    9e-05   
gb|KIY70132.1|  zf-DNL-domain-containing protein                      50.4    9e-05   
ref|XP_009003700.1|  PREDICTED: DNL-type zinc finger protein          50.4    9e-05   
ref|XP_006981043.1|  PREDICTED: DNL-type zinc finger protein isof...  50.4    9e-05   
ref|XP_003230644.1|  PREDICTED: DNL-type zinc finger protein          50.1    9e-05   
gb|AJT03343.1|  Zim17p                                                50.4    9e-05   
dbj|BAP71913.1|  DNL zinc finger domain-containing protein            50.4    9e-05   
ref|XP_002421339.1|  heat shock protein, mitochondrial protein im...  50.4    1e-04   
ref|XP_009790582.1|  PREDICTED: uncharacterized protein LOC104238023  50.8    1e-04   
emb|CDO94518.1|  unnamed protein product                              52.0    1e-04   
gb|EKC36353.1|  DNL-type zinc finger protein                          48.9    1e-04   
ref|XP_010759549.1|  hypothetical protein PADG_03669                  51.2    1e-04   
gb|AFW73227.1|  hypothetical protein ZEAMMB73_020663                  51.6    1e-04   
ref|XP_011166011.1|  PREDICTED: DNL-type zinc finger protein-like     50.1    1e-04   
gb|EEQ46935.1|  conserved hypothetical protein                        50.4    1e-04   
ref|NP_014089.2|  Zim17p                                              50.1    1e-04   
gb|EGA73237.1|  Zim17p                                                48.9    1e-04   
gb|AJT25380.1|  Zim17p                                                50.1    1e-04   
ref|XP_005336996.1|  PREDICTED: DNL-type zinc finger protein          50.1    1e-04   
gb|KHC45981.1|  hypothetical protein MEW_05039                        50.4    1e-04   
gb|KGU23610.1|  hypothetical protein MGK_05083                        50.4    1e-04   
ref|XP_712488.1|  potential mitochondrial zinc finger protein Fmp28   50.4    1e-04   
ref|XP_008663906.1|  PREDICTED: uncharacterized protein LOC103642403  51.6    1e-04   
gb|AJT21703.1|  Zim17p                                                50.1    1e-04   
ref|XP_001978049.1|  GG19380                                          49.3    1e-04   
dbj|GAC93970.1|  hypothetical protein PHSY_001539                     50.8    1e-04   
gb|KGQ86723.1|  hypothetical protein MG1_05095                        50.4    1e-04   
emb|CDS33652.1|  RING finger protein 145                              52.0    1e-04   
gb|AJT30888.1|  Zim17p                                                50.1    1e-04   
gb|AJT26115.1|  Zim17p                                                50.1    1e-04   
ref|XP_001652366.1|  AAEL006952-PA                                    49.3    1e-04   
gb|KGU20502.1|  hypothetical protein MG7_05086                        50.4    1e-04   
emb|CDX67612.1|  BnaA07g16520D                                        50.4    1e-04   
gb|AJT02226.1|  Zim17p                                                50.1    1e-04   
gb|EHN00667.1|  Zim17p                                                48.9    1e-04   
ref|XP_006648130.1|  PREDICTED: DNL-type zinc finger protein-like     49.7    1e-04   
gb|AJT05212.1|  Zim17p                                                50.1    1e-04   
ref|XP_002044172.1|  GM22535                                          48.9    1e-04   
gb|AJT18360.1|  Zim17p                                                50.1    1e-04   
ref|XP_002107038.1|  GD15783                                          48.9    1e-04   
ref|XP_004954410.1|  PREDICTED: uncharacterized protein LOC101753987  50.4    1e-04   
ref|XP_002312005.1|  hypothetical protein POPTR_0008s03710g           50.4    1e-04   
ref|XP_005792601.1|  DNL zinc finger protein                          50.4    1e-04   
ref|XP_009620945.1|  PREDICTED: uncharacterized protein LOC104112666  50.8    1e-04   
ref|XP_004388748.1|  PREDICTED: DNL-type zinc finger protein          50.1    1e-04   
ref|XP_008546021.1|  PREDICTED: DNL-type zinc finger protein-like     49.7    1e-04   
ref|XP_004505316.1|  PREDICTED: mitochondrial protein import prot...  48.9    1e-04   
ref|XP_005107608.1|  PREDICTED: DNL-type zinc finger protein-like     50.1    1e-04   
ref|XP_003570413.1|  PREDICTED: uncharacterized protein LOC100837...  50.1    1e-04   
ref|XP_006437769.1|  hypothetical protein CICLE_v10032948mg           48.9    1e-04   
ref|XP_002064300.1|  GK20094                                          48.5    1e-04   
ref|XP_010235979.1|  PREDICTED: uncharacterized protein LOC100837...  50.1    1e-04   
emb|CBQ67388.1|  related to ZIM17-Zinc finger Motif protein, mito...  50.4    1e-04   
ref|XP_006824976.1|  PREDICTED: DNL-type zinc finger protein-like     50.1    1e-04   
ref|XP_002820433.1|  PREDICTED: DNL-type zinc finger protein          50.1    1e-04   
ref|XP_006485642.1|  PREDICTED: DNL-type zinc finger protein-like     50.1    1e-04   
ref|XP_003861413.1|  hypothetical protein, conserved                  50.8    1e-04   
ref|XP_007046359.1|  Zim17-type zinc finger protein, putative iso...  48.9    2e-04   
ref|XP_006218420.1|  PREDICTED: DNL-type zinc finger protein-like     50.4    2e-04   
ref|XP_008539605.1|  PREDICTED: caspase recruitment domain-contai...  51.2    2e-04   
emb|CEL61778.1|  DNL-type zinc finger protein OS=Mus musculus GN=...  49.7    2e-04   
ref|XP_001992035.1|  GH24435                                          49.7    2e-04   
ref|XP_006827446.1|  hypothetical protein AMTR_s00009p00104670        50.1    2e-04   
ref|XP_002100706.1|  GE16027                                          49.7    2e-04   
ref|XP_009116160.1|  PREDICTED: uncharacterized protein LOC103841...  50.1    2e-04   
ref|XP_009116161.1|  PREDICTED: uncharacterized protein LOC103841...  50.1    2e-04   
ref|XP_001466113.1|  conserved hypothetical protein                   50.4    2e-04   
ref|XP_006163455.1|  PREDICTED: DNL-type zinc finger protein-like     48.5    2e-04   
gb|ETS63278.1|  hypothetical protein PaG_01554                        50.1    2e-04   
ref|XP_011385998.1|  hypothetical protein UMAG_00012                  50.1    2e-04   
emb|CAY82303.1|  Zim17p                                               50.1    2e-04   
dbj|GAC73252.1|  uncharacterized conserved protein                    50.1    2e-04   
emb|CAA86385.1|  NO381                                                50.1    2e-04   
ref|XP_004142433.1|  PREDICTED: uncharacterized protein LOC101207740  49.7    2e-04   
ref|XP_010954228.1|  PREDICTED: DNL-type zinc finger protein          49.3    2e-04   
emb|CCE41063.1|  hypothetical protein CPAR2_300520                    49.3    2e-04   
ref|XP_008150888.1|  PREDICTED: DNL-type zinc finger protein          49.3    2e-04   
ref|XP_001692507.1|  predicted protein                                50.4    2e-04   
ref|XP_011031705.1|  PREDICTED: uncharacterized protein LOC105130744  50.4    2e-04   
gb|EGA81223.1|  Zim17p                                                50.1    2e-04   
ref|XP_002530932.1|  conserved hypothetical protein                   49.7    2e-04   
emb|CCD13482.1|  unnamed protein product                              49.7    2e-04   
gb|EKG17804.1|  Signal recognition particle SRP14 subunit             48.1    2e-04   
gb|AAS15675.1|  LP13032p                                              49.3    2e-04   
ref|NP_573061.2|  CG12379                                             49.3    2e-04   
ref|XP_001683834.1|  conserved hypothetical protein                   50.1    2e-04   
ref|XP_008003839.1|  PREDICTED: DNL-type zinc finger protein isof...  49.7    2e-04   
ref|XP_002011097.1|  GI16194                                          48.1    2e-04   
ref|XP_001267979.1|  DNL zinc finger domain protein                   49.7    2e-04   
ref|XP_003955415.1|  hypothetical protein KAFR_0A08460                49.3    2e-04   
ref|XP_008324040.1|  PREDICTED: DNL-type zinc finger protein          49.7    3e-04   
ref|XP_008495513.1|  PREDICTED: DNL-type zinc finger protein          48.5    3e-04   
emb|CAX74294.1|  hypothetical protein                                 48.5    3e-04   
ref|XP_001235328.1|  PREDICTED: DNL-type zinc finger protein          48.9    3e-04   
gb|KGQ83341.1|  hypothetical protein MEO_05025                        49.3    3e-04   
gb|KHC31172.1|  hypothetical protein MGQ_05052                        49.3    3e-04   
ref|XP_003871301.1|  Zim17 protein                                    48.9    3e-04   
gb|KGR03075.1|  hypothetical protein MG5_05060                        49.3    3e-04   
ref|XP_003876134.1|  conserved hypothetical protein                   50.1    3e-04   
ref|XP_004714568.1|  PREDICTED: caspase recruitment domain-contai...  50.4    3e-04   
ref|XP_007363106.1|  zf-DNL-domain-containing protein                 48.1    3e-04   
ref|XP_002951440.1|  hypothetical protein VOLCADRAFT_91932            48.1    3e-04   
gb|EDL08302.1|  mCG128376                                             50.4    3e-04   
gb|AAW27649.1|  SJCHGC08976 protein                                   48.5    3e-04   
ref|XP_009267964.1|  DNL-type zinc finger protein                     48.1    3e-04   
emb|CDX78266.1|  BnaA09g34610D                                        49.7    3e-04   
ref|XP_010067323.1|  PREDICTED: mitochondrial protein import prot...  48.9    3e-04   
ref|XP_002550560.1|  hypothetical protein CTRG_04858                  48.9    3e-04   
ref|XP_010765447.1|  PREDICTED: DNL-type zinc finger protein          49.3    4e-04   
ref|XP_750712.1|  mitochondrial import protein Zim17                  48.9    4e-04   
ref|XP_004164220.1|  PREDICTED: uncharacterized protein LOC101230...  49.3    4e-04   
gb|AFK38270.1|  unknown                                               48.9    4e-04   
ref|XP_002057102.1|  GJ16534                                          48.5    4e-04   
ref|XP_010699652.1|  hypothetical protein LPMP_250820                 49.7    4e-04   
gb|KGN52257.1|  hypothetical protein Csa_5G622720                     49.3    4e-04   
gb|EFW21924.1|  TIM23 translocase complex subunit Tim15               48.9    4e-04   
gb|KGO43691.1|  Zinc finger, DNL-type                                 48.9    4e-04   
ref|XP_001609028.1|  DNL zinc finger domain containing protein        48.1    4e-04   
gb|ENN77479.1|  hypothetical protein YQE_06007                        47.8    4e-04   
gb|EUC59744.1|  DNL zinc finger protein                               48.5    4e-04   
gb|EST09649.1|  hypothetical protein PSEUBRA_SCAF1g00088              49.7    4e-04   
ref|XP_003066019.1|  DNL zinc finger family protein                   48.9    4e-04   
gb|AJT25018.1|  Zim17p                                                48.5    4e-04   
ref|XP_006436453.1|  hypothetical protein CICLE_v10030991mg           50.1    5e-04   
gb|EWM23067.1|  zinc finger protein                                   49.3    5e-04   
ref|XP_009368896.1|  PREDICTED: mitochondrial protein import prot...  48.9    5e-04   
ref|XP_010569399.1|  PREDICTED: DNL-type zinc finger protein          47.8    5e-04   
ref|XP_001247362.1|  hypothetical protein CIMG_01133                  48.9    5e-04   
ref|XP_001215012.1|  predicted protein                                48.9    5e-04   
ref|XP_002541557.1|  predicted protein                                48.5    5e-04   
ref|XP_001257939.1|  DNL zinc finger domain protein                   48.5    5e-04   



>ref|XP_011083416.1| PREDICTED: uncharacterized protein LOC105165954 [Sesamum indicum]
Length=212

 Score =   259 bits (661),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 150/177 (85%), Gaps = 15/177 (8%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSS-KRILRFSASPRGNGNEP-----DLRSNSN  242
            MEAL ++TT A+   SLPIFSP+KS   SS +RILRFS SPR + N       DL+S+S+
Sbjct  1    MEAL-TTTTGAV---SLPIFSPMKSKDASSSRRILRFSTSPRNDHNSNNDSGNDLKSDSS  56

Query  243  DSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPW  407
            DS+LVP+L     S+DAAMGLVLSAANVRGWTTGSGMEGPSVPAGS+ ++GMEQVSTFPW
Sbjct  57   DSALVPVLRHQTLSKDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSDSDSGMEQVSTFPW  116

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            SLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  117  SLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  173



>gb|EYU36814.1| hypothetical protein MIMGU_mgv1a013669mg [Erythranthe guttata]
Length=213

 Score =   256 bits (654),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 149/177 (84%), Gaps = 15/177 (8%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGN------EPDLRSNSN  242
            MEAL ++TT A+   SLPIFSP KS   SS+R+LRFS SP+ + N      EPD + +S+
Sbjct  1    MEAL-TTTTGAV---SLPIFSPNKSREPSSRRLLRFSTSPKNDANRSNSGGEPDFKPDSS  56

Query  243  DSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPW  407
            +SSLVPI     +SQDAAMGLVLSAANVRGWTTGSGMEGPS+PAGS+P +GM++VSTFPW
Sbjct  57   ESSLVPINRNRFISQDAAMGLVLSAANVRGWTTGSGMEGPSMPAGSDPNSGMDRVSTFPW  116

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            SLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  117  SLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  173



>ref|NP_001266237.1| Hop-interacting protein THI120 [Solanum lycopersicum]
 gb|AEW69817.1| Hop-interacting protein THI120 [Solanum lycopersicum]
Length=206

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 146/172 (85%), Gaps = 10/172 (6%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSND-SSLV  257
            ME L SS TT   +PSL +F+P KS  LSS++I++FS S + NGNE DL+S++ND +S+V
Sbjct  1    METLTSSATT---TPSLSVFAP-KSKHLSSRKIVKFSVSRKNNGNESDLQSDANDNTSIV  56

Query  258  PI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTK  422
            PI     LS+DAAMGLVLSAANVRGWTTGSGMEGP VPAGS+ E+  +Q+STFPWSLFTK
Sbjct  57   PIFNNPTLSKDAAMGLVLSAANVRGWTTGSGMEGPPVPAGSDSESNTDQISTFPWSLFTK  116

Query  423  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            SPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  117  SPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  168



>ref|NP_001274971.1| uncharacterized protein LOC102584137 [Solanum tuberosum]
 gb|AFX67003.1| hypothetical protein [Solanum tuberosum]
Length=206

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 145/172 (84%), Gaps = 10/172 (6%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSND-SSLV  257
            ME L SS TT   +PSL +F+P KS  LSS++ ++FS S + NGNEPDL+S+ N+ +S+V
Sbjct  1    METLTSSATT---TPSLSVFAP-KSKHLSSRKFVKFSVSRKNNGNEPDLQSDGNEGTSIV  56

Query  258  PI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTK  422
            PI     LS+DAAMGLVLSAANVRGWTTGSGMEGP VPAGS+ E+  EQ+STFPWSLFTK
Sbjct  57   PIFNNPTLSKDAAMGLVLSAANVRGWTTGSGMEGPPVPAGSDSESSTEQISTFPWSLFTK  116

Query  423  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            SPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  117  SPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  168



>ref|XP_009776939.1| PREDICTED: uncharacterized protein LOC104226608 [Nicotiana sylvestris]
Length=207

 Score =   237 bits (604),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 137/167 (82%), Gaps = 10/167 (6%)
 Frame = +3

Query  105  TTAILSPSLPIFSPLKSNRLSS---KRILRFSASPRGNGNEPDLRSNSND-SSLVPIL--  266
            T    SPSL IFSP KS  L S   ++ ++FS S + NGNEPD +S++ D +S+VPIL  
Sbjct  3    TLTAYSPSLSIFSP-KSKDLPSSVSRKFVKFSVSRKNNGNEPDFQSDAIDCTSIVPILNN  61

Query  267  ---SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRR  437
               S+DAAMGLVLSAANVRGWTTGSGMEGP VPAGS+ E+  +Q+STFPWSLFTKSPRRR
Sbjct  62   PTLSKDAAMGLVLSAANVRGWTTGSGMEGPPVPAGSDSESNTDQISTFPWSLFTKSPRRR  121

Query  438  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            M VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  122  MRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  168



>ref|XP_009620058.1| PREDICTED: uncharacterized protein LOC104111945 [Nicotiana tomentosiformis]
Length=208

 Score =   237 bits (604),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 141/176 (80%), Gaps = 17/176 (10%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRL----SSKRILRFSASPRGNGNEPDLRSNSND-  245
            ME L S       SPSL IFSP KS  L    SS++ ++FS S + NGNEPD +S++ND 
Sbjct  1    METLTS------YSPSLSIFSP-KSKDLPSSSSSRKFVKFSVSRKNNGNEPDFQSDANDC  53

Query  246  SSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWS  410
            +S+VPIL     S+D AMGLVLSAANVRGWTTGSGMEGP VPAGS+ E+  +Q+STFPWS
Sbjct  54   TSIVPILNNPTLSKDDAMGLVLSAANVRGWTTGSGMEGPPVPAGSDSESSTDQISTFPWS  113

Query  411  LFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            LFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  114  LFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  169



>ref|XP_011074724.1| PREDICTED: DNL-type zinc finger protein-like [Sesamum indicum]
Length=213

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 141/177 (80%), Gaps = 14/177 (8%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGN------EPDLRSNSN  242
            MEAL +++  A+   SLP+FS  KS   SS+  LR S SP+ + +      EPD++ +S+
Sbjct  1    MEALTATSAGAV---SLPMFSANKSRGPSSRPRLRCSPSPKNDSDNINTNSEPDIKPDSS  57

Query  243  DSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPW  407
             S L P+L     S+DAAMGLVLSAANVRGWTTGSGMEGPS+PAGS+P+ G E+VSTFPW
Sbjct  58   HSRLAPVLRNRTLSKDAAMGLVLSAANVRGWTTGSGMEGPSMPAGSDPDPGTERVSTFPW  117

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            SLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNL
Sbjct  118  SLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNL  174



>emb|CDP07337.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   235 bits (599),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 129/145 (89%), Gaps = 9/145 (6%)
 Frame = +3

Query  171  KRILRFSASPRGNGNEPDLRSNSNDSS--LVPIL-----SQDAAMGLVLSAANVRGWTTG  329
            +R+LRFS SP+ NGN+ D++S+SNDSS  LVP+L     S+DAAMGLVLSAANVRGWTTG
Sbjct  46   RRLLRFSTSPKNNGNQRDIQSDSNDSSTSLVPMLRNHTLSKDAAMGLVLSAANVRGWTTG  105

Query  330  SGMEGPSVPAG--SNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHA  503
            SGMEGPSVPAG  S+ E+G E++STFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHA
Sbjct  106  SGMEGPSVPAGAGSDSESGTERISTFPWSLFTKSPRRRMRVAFTCSVCGQRTTRAINPHA  165

Query  504  YTDGTVFVQCCGCNIYHKLVDNLNL  578
            YTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  166  YTDGTVFVQCCGCNVFHKLVDNLNL  190



>ref|XP_006435267.1| hypothetical protein CICLE_v10002475mg [Citrus clementina]
 ref|XP_006473726.1| PREDICTED: uncharacterized protein LOC102623239 [Citrus sinensis]
 gb|ESR48507.1| hypothetical protein CICLE_v10002475mg [Citrus clementina]
 gb|KDO84977.1| hypothetical protein CISIN_1g028299mg [Citrus sinensis]
Length=211

 Score =   234 bits (596),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 139/174 (80%), Gaps = 12/174 (7%)
 Frame = +3

Query  81   MEALASSTTTAILSPS---LPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSS  251
            ME L+SS T  I+SPS   L IFS    N  S  R++RF A  + NGN+ DL+SNS ++S
Sbjct  1    METLSSSAT--IVSPSSSPLTIFSIKSKN--SPARLVRFPAPSKKNGNDSDLQSNSKETS  56

Query  252  LVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLF  416
            +VP+     LS+D AMGLVLSAA+VRGWTTGSGMEGPSVPAG+   +  E+VSTFPWSLF
Sbjct  57   IVPLFGNQTLSKDEAMGLVLSAASVRGWTTGSGMEGPSVPAGAEEGSSTEKVSTFPWSLF  116

Query  417  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            TKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  117  TKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  170



>ref|XP_010664127.1| PREDICTED: uncharacterized protein LOC100243759 [Vitis vinifera]
 emb|CBI18909.3| unnamed protein product [Vitis vinifera]
Length=209

 Score =   229 bits (584),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 134/171 (78%), Gaps = 7/171 (4%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            MEAL+SS T    S S P     +  +  S R LR + SP+ NGN+ D+RS S++SSLVP
Sbjct  1    MEALSSSATIIAASSSSPSIFSPR--KRDSPRFLRVNVSPKDNGNDSDVRSESDESSLVP  58

Query  261  IL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKS  425
            IL     S+DAAMGLVLSAA+VRGWTT SGMEGPSVPA +   +  E++STFPWSLFTKS
Sbjct  59   ILTNRTLSKDAAMGLVLSAASVRGWTTDSGMEGPSVPAAAEARSSTERISTFPWSLFTKS  118

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  119  PRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  169



>ref|XP_002307755.2| hypothetical protein POPTR_0005s26750g [Populus trichocarpa]
 gb|EEE94751.2| hypothetical protein POPTR_0005s26750g [Populus trichocarpa]
Length=218

 Score =   224 bits (570),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 5/140 (4%)
 Frame = +3

Query  174  RILRFSASPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGM  338
            R+LRF  S + +  + DL+SNSNDSS+VP+     LS+DAAMGLVLSAA+VRGWTTGSGM
Sbjct  33   RLLRFHTSSKKDNKDSDLQSNSNDSSIVPLFSNPTLSKDAAMGLVLSAASVRGWTTGSGM  92

Query  339  EGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGT  518
            EGPSVPAG+   +  E+VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGT
Sbjct  93   EGPSVPAGAEDGSNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGT  152

Query  519  VFVQCCGCNIYHKLVDNLNL  578
            VFVQCCGCN++HKLVDNLNL
Sbjct  153  VFVQCCGCNVFHKLVDNLNL  172



>gb|KDP36867.1| hypothetical protein JCGZ_08158 [Jatropha curcas]
Length=213

 Score =   223 bits (569),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 121/146 (83%), Gaps = 6/146 (4%)
 Frame = +3

Query  159  RLSS-KRILRFSASPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGW  320
            RL S  R LRF  S + N +E DLRS SNDSS+VP      LS+DAAMGLVLSAA+VRGW
Sbjct  25   RLDSPARFLRFHTSSKKNESESDLRSESNDSSIVPFFNNPTLSKDAAMGLVLSAASVRGW  84

Query  321  TTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPH  500
            TTGSGMEGP VPAG++  +  E+VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPH
Sbjct  85   TTGSGMEGPPVPAGADEGSNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPH  144

Query  501  AYTDGTVFVQCCGCNIYHKLVDNLNL  578
            AYTDGTVFVQCCGCNI+HKLVDNLNL
Sbjct  145  AYTDGTVFVQCCGCNIFHKLVDNLNL  170



>ref|XP_011003097.1| PREDICTED: uncharacterized protein LOC105109924 [Populus euphratica]
Length=219

 Score =   224 bits (570),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 5/140 (4%)
 Frame = +3

Query  174  RILRFSASPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGM  338
            R+LRF  S + +  + DL+SNSNDSS+VP+     LS+DAAMGLVLSAA+VRGWTTGSGM
Sbjct  33   RLLRFHTSSKKDNKDSDLQSNSNDSSIVPLFNNPTLSKDAAMGLVLSAASVRGWTTGSGM  92

Query  339  EGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGT  518
            EGPSVPAG+   +  E+VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGT
Sbjct  93   EGPSVPAGAEDGSNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGT  152

Query  519  VFVQCCGCNIYHKLVDNLNL  578
            VFVQCCGCN++HKLVDNLNL
Sbjct  153  VFVQCCGCNVFHKLVDNLNL  172



>ref|XP_007017922.1| Zim17-type zinc finger protein [Theobroma cacao]
 gb|EOY15147.1| Zim17-type zinc finger protein [Theobroma cacao]
Length=214

 Score =   223 bits (568),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 131/171 (77%), Gaps = 5/171 (3%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            ME L S     + S    +       + S  RI+RF  S + +GN+ DL+S++N++S+VP
Sbjct  1    METLGSPAAAMVSSSPSSLSIFSPKRKDSPARIIRFPTSSKKDGNDSDLQSDANNTSIVP  60

Query  261  IL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKS  425
            +      S+D AMGLVLSAA+VRGWTTGSGMEGPSVPA ++ ++  E+VSTFPWSLFTKS
Sbjct  61   LFGNQTFSKDEAMGLVLSAASVRGWTTGSGMEGPSVPARTDDQSNTEKVSTFPWSLFTKS  120

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  121  PRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  171



>gb|KJB14347.1| hypothetical protein B456_002G120700 [Gossypium raimondii]
Length=206

 Score =   221 bits (564),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 137/172 (80%), Gaps = 13/172 (8%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            MEAL SS   A+LS    IFSP + +  +  RI+RF    + +GN+ D++ + N++S+VP
Sbjct  1    MEAL-SSQPLALLS----IFSPKRKDFPA--RIIRFPTHSKKDGNDSDIQYDPNNTSIVP  53

Query  261  I-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPE-TGMEQVSTFPWSLFTK  422
            +      SQDAAMGLVLSAA+VRGWTTGSGMEGPSVPA ++ + +  EQVSTFPWSLFTK
Sbjct  54   LVGNQTFSQDAAMGLVLSAASVRGWTTGSGMEGPSVPARTDDDQSNTEQVSTFPWSLFTK  113

Query  423  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            SPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  114  SPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  165



>gb|KHG11073.1| Mitochondrial import protein ZIM17 [Gossypium arboreum]
Length=206

 Score =   221 bits (563),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 136/172 (79%), Gaps = 13/172 (8%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            MEAL S    A+LS    IFSP + +  +  RI+RF    + +GN+ D++S+ N+ S+VP
Sbjct  1    MEALGSQPL-ALLS----IFSPKRKDFPA--RIIRFPTHSKKDGNDSDIQSDPNNISIVP  53

Query  261  I-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPE-TGMEQVSTFPWSLFTK  422
            +      SQDAAMGLVLSAA+VRGWTTGSGMEGPSVPA ++ + +  EQVSTFPWSLFTK
Sbjct  54   LVGNQTFSQDAAMGLVLSAASVRGWTTGSGMEGPSVPARTDDDQSNTEQVSTFPWSLFTK  113

Query  423  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            SPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  114  SPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  165



>gb|AIA63975.1| transcription factor ZFP130 [Gossypium hirsutum]
Length=206

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 136/172 (79%), Gaps = 13/172 (8%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            MEAL SS   A+LS    IFSP   +  +  RI+RF    + +GN+ D++ + N++S+VP
Sbjct  1    MEAL-SSQPLALLS----IFSPKPKDFPA--RIIRFPTHSKKDGNDSDIQYDPNNTSIVP  53

Query  261  I-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPE-TGMEQVSTFPWSLFTK  422
            +      SQDAAMGLVLSAA+VRGWTTGSGMEGPSVPA ++ + +  EQVSTFPWSLFTK
Sbjct  54   LVGNQTFSQDAAMGLVLSAASVRGWTTGSGMEGPSVPARTDDDQSNTEQVSTFPWSLFTK  113

Query  423  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            SPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  114  SPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  165



>ref|XP_010539089.1| PREDICTED: uncharacterized protein LOC104813220 [Tarenaya hassleriana]
Length=209

 Score =   218 bits (555),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 117/140 (84%), Gaps = 8/140 (6%)
 Frame = +3

Query  174  RILRFSASPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGM  338
            RI+RFS   + N  E DL+S SN SSLVP+     LS+D AMGLVLS+A+VRGWTTGSGM
Sbjct  35   RIVRFS---KNNDKESDLQSESNSSSLVPLFGYRTLSRDEAMGLVLSSASVRGWTTGSGM  91

Query  339  EGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGT  518
            EGPSVPAG+   +  E VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGT
Sbjct  92   EGPSVPAGAEERSVTENVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGT  151

Query  519  VFVQCCGCNIYHKLVDNLNL  578
            VFVQCCGCN++HKLVDNLNL
Sbjct  152  VFVQCCGCNVFHKLVDNLNL  171



>ref|XP_002510604.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52791.1| conserved hypothetical protein [Ricinus communis]
Length=209

 Score =   218 bits (555),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 119/140 (85%), Gaps = 6/140 (4%)
 Frame = +3

Query  174  RILRFSASPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGM  338
            R+LR   S + + N+ DLRS+SNDSS+VP      LS+DAAMGLVLSAA+VRGWTTGSGM
Sbjct  31   RLLRIHTSSKKDENDSDLRSDSNDSSIVPFFNNSTLSKDAAMGLVLSAASVRGWTTGSGM  90

Query  339  EGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGT  518
            EGPSVPAG++  +  E VST PWSLFTKSPRRRM VAFTC +CGQRTTRAINPHAYTDGT
Sbjct  91   EGPSVPAGTD-GSNTENVSTLPWSLFTKSPRRRMRVAFTCNICGQRTTRAINPHAYTDGT  149

Query  519  VFVQCCGCNIYHKLVDNLNL  578
            VFVQCCGCN++HKLVDNLNL
Sbjct  150  VFVQCCGCNVFHKLVDNLNL  169



>ref|XP_010063286.1| PREDICTED: uncharacterized protein LOC104450433 [Eucalyptus grandis]
 gb|KCW70496.1| hypothetical protein EUGRSUZ_F03705 [Eucalyptus grandis]
Length=222

 Score =   216 bits (550),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 124/158 (78%), Gaps = 6/158 (4%)
 Frame = +3

Query  120  SPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVPILS-----QDAAM  284
            SP L IFSP +    S  R +RF A  + N  +  LRS+S + +L+P+LS     +DAAM
Sbjct  25   SPPLSIFSPARPTD-SPARFVRFLAPSKKNDGDSGLRSDSGEPNLLPVLSNRTLSKDAAM  83

Query  285  GLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKV  464
            GLVLSAA+VRGWTT SGMEGP  PAG+   +G E+VSTFPWSLFTKSPRRRM VAFTC V
Sbjct  84   GLVLSAASVRGWTTDSGMEGPVAPAGAEGGSGTERVSTFPWSLFTKSPRRRMRVAFTCNV  143

Query  465  CGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            CGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNL
Sbjct  144  CGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNL  181



>gb|EPS65916.1| hypothetical protein M569_08860, partial [Genlisea aurea]
Length=166

 Score =   211 bits (537),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 109/128 (85%), Gaps = 5/128 (4%)
 Frame = +3

Query  210  GNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPE  374
            G E DL SN ++ SLVPI     LS+DAAMG+VLSAANVRGWTTGSGMEGPS+P G +P 
Sbjct  12   GREADLSSNPSEFSLVPISKTYFLSEDAAMGMVLSAANVRGWTTGSGMEGPSIPLGPDPN  71

Query  375  TGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYH  554
            +  E  STFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNIYH
Sbjct  72   SITETASTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIYH  131

Query  555  KLVDNLNL  578
            KLVDNLNL
Sbjct  132  KLVDNLNL  139



>gb|KFK32942.1| hypothetical protein AALP_AA6G309400 [Arabis alpina]
Length=207

 Score =   211 bits (536),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 121/153 (79%), Gaps = 10/153 (7%)
 Frame = +3

Query  129  LPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVPI---LSQDAAMGLVLS  299
            LPIFSP K     S RI+R S   + +  + D +S SN SSLVP+   LS D AMGLVLS
Sbjct  20   LPIFSPKKRTDSFSPRIVRVS---KKDDTDHDPQSESNSSSLVPMFRTLSNDEAMGLVLS  76

Query  300  AANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRT  479
            AA+VRGWTTGSGMEGPS+PA S+ ET    VSTFPWSLFTKSPRRRM VAFTC VCGQRT
Sbjct  77   AASVRGWTTGSGMEGPSLPAKSDSET----VSTFPWSLFTKSPRRRMRVAFTCNVCGQRT  132

Query  480  TRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            TRAINPHAYTDGTVFVQCCGC ++HKLVDNL+L
Sbjct  133  TRAINPHAYTDGTVFVQCCGCYVFHKLVDNLDL  165



>ref|XP_010690316.1| PREDICTED: uncharacterized protein LOC104903883 [Beta vulgaris 
subsp. vulgaris]
Length=237

 Score =   209 bits (531),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 130/186 (70%), Gaps = 20/186 (11%)
 Frame = +3

Query  69   LLSTMEALASSTTTAILSPS------LPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLR  230
            L STME L  S+ TA L  S      L IFSP + +R     ILRFS S +G  +E  ++
Sbjct  18   LRSTMETLTMSSATATLKSSSSSSSPLSIFSPKQPSR---PNILRFSLSSKGRDDESHIQ  74

Query  231  SNSNDSSLVPI----------LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETG  380
            S S D  +VP+          LS+D AMGLVL+AA  +GWTTGSGMEGP   AG + E+ 
Sbjct  75   SESKDMRIVPLADNQRLSLSPLSKDCAMGLVLNAATGKGWTTGSGMEGPPESAG-DAESS  133

Query  381  MEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKL  560
              ++STFPWSLFTKSPRRRML+AFTC +C QRTTRAINPHAYTDGTVFVQCCGCN YHKL
Sbjct  134  NAKISTFPWSLFTKSPRRRMLIAFTCNICSQRTTRAINPHAYTDGTVFVQCCGCNAYHKL  193

Query  561  VDNLNL  578
            VDNLNL
Sbjct  194  VDNLNL  199



>ref|XP_010455142.1| PREDICTED: uncharacterized protein LOC104736783 isoform X2 [Camelina 
sativa]
Length=218

 Score =   206 bits (524),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 113/143 (79%), Gaps = 9/143 (6%)
 Frame = +3

Query  165  SSKRILRFSASPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTG  329
            SS RI+R S        +P  +S SN SSLVP+     LS D AMGLVLSAA+V+GWTTG
Sbjct  33   SSPRIVRLSKKKEDKDYDPPQQSESNSSSLVPLFQNRTLSNDEAMGLVLSAASVKGWTTG  92

Query  330  SGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYT  509
            SGMEGPS+PA  + ET    VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYT
Sbjct  93   SGMEGPSLPAKPDTET----VSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYT  148

Query  510  DGTVFVQCCGCNIYHKLVDNLNL  578
            DGTVFVQCCGCN++HKLVDNLNL
Sbjct  149  DGTVFVQCCGCNVFHKLVDNLNL  171



>ref|XP_008806155.1| PREDICTED: uncharacterized protein LOC103718920 [Phoenix dactylifera]
Length=209

 Score =   206 bits (523),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 125/175 (71%), Gaps = 12/175 (7%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            ME++A+S         L +F P   NR  SKR      + + N  E D+ S+S  ++LVP
Sbjct  1    MESIAASAAIPASPSPLSLFYP---NRTFSKRPALLPVASKHNEGESDIHSDSESTNLVP  57

Query  261  IL---------SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSL  413
             L         S+DAAMGLVLSAA  RGWTTGSGMEGP +PA S+ ++    VSTFPWSL
Sbjct  58   FLNNSASISPLSKDAAMGLVLSAAAGRGWTTGSGMEGPPIPAESDSDSTDRTVSTFPWSL  117

Query  414  FTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            FTKSPRRRMLVAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  118  FTKSPRRRMLVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  172



>ref|XP_010421646.1| PREDICTED: uncharacterized protein LOC104707070 isoform X2 [Camelina 
sativa]
Length=223

 Score =   206 bits (524),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 116/148 (78%), Gaps = 9/148 (6%)
 Frame = +3

Query  150  KSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVR  314
            +++  SS RI+R S        +P  +S SN SSLVP+     LS D AMGLVLSAA+V+
Sbjct  28   RTDSSSSPRIVRLSKKKEDKDYDPPQQSESNSSSLVPLFQNRTLSNDEAMGLVLSAASVK  87

Query  315  GWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAIN  494
            GWTTGSGMEGPS+PA  + ET    VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAIN
Sbjct  88   GWTTGSGMEGPSLPAKPDTET----VSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAIN  143

Query  495  PHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  144  PHAYTDGTVFVQCCGCNVFHKLVDNLNL  171



>ref|XP_010266915.1| PREDICTED: uncharacterized protein LOC104604317 [Nelumbo nucifera]
Length=210

 Score =   204 bits (518),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 115/142 (81%), Gaps = 10/142 (7%)
 Frame = +3

Query  180  LRFSASPRGNGNEPDLRSNSNDSSLVPIL---------SQDAAMGLVLSAANVRGWTTGS  332
            LRF  + +    + + ++NSN+ ++VP+L         S+DAAMGLVLSAA  RGWTTGS
Sbjct  31   LRFPIASKNKDGDAE-QTNSNEMNIVPLLNNRMPLSPLSKDAAMGLVLSAAAGRGWTTGS  89

Query  333  GMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTD  512
            GMEGPSVPAG+  E+  E++STFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTD
Sbjct  90   GMEGPSVPAGAESESSTEKISTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTD  149

Query  513  GTVFVQCCGCNIYHKLVDNLNL  578
            GTVFVQCCGCN++HKLVDNLNL
Sbjct  150  GTVFVQCCGCNVFHKLVDNLNL  171



>ref|XP_008447918.1| PREDICTED: uncharacterized protein LOC103490262 [Cucumis melo]
Length=216

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 111/145 (77%), Gaps = 10/145 (7%)
 Frame = +3

Query  174  RILRFSASPRGNGNEPDLRSNSNDSSLVPILSQ----------DAAMGLVLSAANVRGWT  323
            R  +   + +GN NE D +S+SN+   +PILS+          D AMG+VLSAA  RGWT
Sbjct  31   RSFQVPHASKGNDNESDSQSDSNNIRNLPILSKRHLSLSPLSKDVAMGMVLSAATGRGWT  90

Query  324  TGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHA  503
            TGSGMEGP  PAG   ++G E VSTFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHA
Sbjct  91   TGSGMEGPPAPAGLEAKSGTENVSTFPWSLFTKSPRRRMLVAFTCNICGQRTTRAINPHA  150

Query  504  YTDGTVFVQCCGCNIYHKLVDNLNL  578
            YTDGTVFVQCCGCN YHKLVDNLNL
Sbjct  151  YTDGTVFVQCCGCNAYHKLVDNLNL  175



>ref|XP_004144863.1| PREDICTED: uncharacterized protein LOC101212325 [Cucumis sativus]
 ref|XP_004167745.1| PREDICTED: uncharacterized LOC101212325 [Cucumis sativus]
 gb|KGN43276.1| hypothetical protein Csa_7G016610 [Cucumis sativus]
Length=216

 Score =   203 bits (517),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 111/145 (77%), Gaps = 10/145 (7%)
 Frame = +3

Query  174  RILRFSASPRGNGNEPDLRSNSNDSSLVPILSQ----------DAAMGLVLSAANVRGWT  323
            R  +   + +GN NE D +S+S ++  +PILS+          D AMG+VLSAA  RGWT
Sbjct  31   RSFQVPHASKGNDNESDSQSDSKNTRNLPILSKRHLSLSPLSKDVAMGMVLSAATGRGWT  90

Query  324  TGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHA  503
            TGSGMEGP  PAG   ++G E VSTFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHA
Sbjct  91   TGSGMEGPPAPAGMEAKSGTENVSTFPWSLFTKSPRRRMLVAFTCNICGQRTTRAINPHA  150

Query  504  YTDGTVFVQCCGCNIYHKLVDNLNL  578
            YTDGTVFVQCCGCN YHKLVDNLNL
Sbjct  151  YTDGTVFVQCCGCNAYHKLVDNLNL  175



>ref|XP_010086843.1| Mitochondrial protein import protein ZIM17 [Morus notabilis]
 gb|EXB24041.1| Mitochondrial protein import protein ZIM17 [Morus notabilis]
Length=211

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            M++ ASS      S S  +F      R+   R   FS + + N +E D  S S D   VP
Sbjct  1    MDSRASSCYAPFTSSSSILFP----RRILPSRPAHFSLASKSNDSEADPESASKDVKSVP  56

Query  261  IL----------SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWS  410
            IL          S+DAAMGLVLSAA  RGWTTGSGMEGP VP GS  ++  E VSTFPWS
Sbjct  57   ILKNLNLSLSPLSKDAAMGLVLSAAAGRGWTTGSGMEGPPVPDGSEAKSSTENVSTFPWS  116

Query  411  LFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            LFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGC+ +HKLVDNLNL
Sbjct  117  LFTKSPRRRMLVAFTCNICGQRTTRAINPHAYTDGTVFVQCCGCSAFHKLVDNLNL  172



>ref|XP_002874388.1| hypothetical protein ARALYDRAFT_489599 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50647.1| hypothetical protein ARALYDRAFT_489599 [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 112/142 (79%), Gaps = 10/142 (7%)
 Frame = +3

Query  168  SKRILRFSASPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGS  332
            S RI+R S        +P  +S SN SSLVP+     LS D AMGLVLSAA+V+GWTTGS
Sbjct  34   SPRIVRLSKKKEDKDYDPQ-QSESNSSSLVPLFRNRTLSNDEAMGLVLSAASVKGWTTGS  92

Query  333  GMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTD  512
            GMEGPS+PA  + ET    VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTD
Sbjct  93   GMEGPSLPAKPDTET----VSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTD  148

Query  513  GTVFVQCCGCNIYHKLVDNLNL  578
            GTVFVQCCGCN++HKLVDNLNL
Sbjct  149  GTVFVQCCGCNVFHKLVDNLNL  170



>ref|XP_010941361.1| PREDICTED: uncharacterized protein LOC105059672 [Elaeis guineensis]
Length=207

 Score =   201 bits (510),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 130/177 (73%), Gaps = 18/177 (10%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPI--FSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSL  254
            ME++A+S   AIL+   PI  FSP   +R  SKR      + +  G+E DL S+S  ++L
Sbjct  1    MESVAASA--AILASPSPISLFSP---SRTFSKRPSFLPIASKHKGDEADLHSDSESTNL  55

Query  255  VPIL---------SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPW  407
            VP L         S+DAAMGLVL+AA  RGWTTGSGMEGPS+PA  + E+    VSTFP 
Sbjct  56   VPFLNNNASISPLSKDAAMGLVLNAAAGRGWTTGSGMEGPSMPA--DLESPDRTVSTFPL  113

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            SLFTKSPRRRMLVAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  114  SLFTKSPRRRMLVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  170



>ref|XP_008358361.1| PREDICTED: uncharacterized protein LOC103422104 [Malus domestica]
Length=217

 Score =   201 bits (511),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 122/176 (69%), Gaps = 11/176 (6%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            MEAL SS +  I S +           L S R  +   + +GN NE + +S+S + + +P
Sbjct  1    MEALISSASPTIXSSASSFSVFSPRKSLPS-RPFQLPLASKGNENESNPKSDSKEINRLP  59

Query  261  ILS----------QDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWS  410
            ILS          +DAAMGLV+ AA  RGWTTGSGMEGP  PAG   E+  E VSTFPWS
Sbjct  60   ILSNRHLSLSPLSKDAAMGLVMGAATGRGWTTGSGMEGPPAPAGVQTESSTENVSTFPWS  119

Query  411  LFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            LFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGCN +HKLVDNLNL
Sbjct  120  LFTKSPRRRMLVAFTCNICGQRTTRAINPHAYTDGTVFVQCCGCNAFHKLVDNLNL  175



>ref|XP_010935184.1| PREDICTED: uncharacterized protein LOC105055145 [Elaeis guineensis]
Length=207

 Score =   200 bits (509),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 125/175 (71%), Gaps = 14/175 (8%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            ME++A+S         L +FSP   NR  SKR      + +   +E DL ++S  ++LVP
Sbjct  1    MESIAASAAIPASPSPLSLFSP---NRTFSKRPSLLPVASKHKEDEADLHADSESTNLVP  57

Query  261  IL---------SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSL  413
             L         S+DAAMGLVL+AA  RGWTTGSGMEGP +PA S  ++    VSTFPWSL
Sbjct  58   FLKNSTSVSPLSKDAAMGLVLNAAAGRGWTTGSGMEGPPIPADS--DSTNRTVSTFPWSL  115

Query  414  FTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            FTKSPRRRMLVAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  116  FTKSPRRRMLVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  170



>ref|XP_002300678.2| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
 ref|XP_006386157.1| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
 gb|EEE79951.2| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
 gb|ERP63954.1| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
Length=210

 Score =   200 bits (509),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 115/139 (83%), Gaps = 5/139 (4%)
 Frame = +3

Query  177  ILRFSASPRGNGNEPDLRSNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGME  341
            +LRF  S + +  + DL+S+S+DSS+VP+      S+DAAMGLVLSAA+VRGWTTGSGME
Sbjct  30   LLRFHVSSKKDKKDSDLQSSSHDSSIVPLFNNPSFSKDAAMGLVLSAASVRGWTTGSGME  89

Query  342  GPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTV  521
            GPSV A S      E+VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTV
Sbjct  90   GPSVTAVSEDGFNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTV  149

Query  522  FVQCCGCNIYHKLVDNLNL  578
            FVQCCGCN++HKLVDNLNL
Sbjct  150  FVQCCGCNVFHKLVDNLNL  168



>ref|XP_011034950.1| PREDICTED: uncharacterized protein LOC105132906 [Populus euphratica]
Length=206

 Score =   200 bits (508),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 115/139 (83%), Gaps = 5/139 (4%)
 Frame = +3

Query  177  ILRFSASPRGNGNEPDLRSNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGME  341
            +LRF  S + +  + DL+S+S+DSS+VP+      S+DAAMGLVLSAA+VRGWTTGSGME
Sbjct  30   LLRFHVSSKKDKKDSDLQSSSHDSSIVPLFNNHSFSKDAAMGLVLSAASVRGWTTGSGME  89

Query  342  GPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTV  521
            GPSV A S      E+VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTV
Sbjct  90   GPSVTAVSEDGFNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTV  149

Query  522  FVQCCGCNIYHKLVDNLNL  578
            FVQCCGCN++HKLVDNLNL
Sbjct  150  FVQCCGCNVFHKLVDNLNL  168



>ref|XP_010455141.1| PREDICTED: uncharacterized protein LOC104736783 isoform X1 [Camelina 
sativa]
Length=229

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 117/159 (74%), Gaps = 20/159 (13%)
 Frame = +3

Query  150  KSNRLSSKRILRFSAS-----------PRGNGNEPDLRSNSNDSSLVPI-----LSQDAA  281
            +++  SS RI+R S S                 +P  +S SN SSLVP+     LS D A
Sbjct  28   RTDSSSSPRIVRLSKSIQNLISISSSEKEDKDYDPPQQSESNSSSLVPLFQNRTLSNDEA  87

Query  282  MGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCK  461
            MGLVLSAA+V+GWTTGSGMEGPS+PA  + ET    VSTFPWSLFTKSPRRRM VAFTC 
Sbjct  88   MGLVLSAASVKGWTTGSGMEGPSLPAKPDTET----VSTFPWSLFTKSPRRRMRVAFTCN  143

Query  462  VCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  144  VCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  182



>ref|XP_006288620.1| hypothetical protein CARUB_v10001922mg [Capsella rubella]
 gb|EOA21518.1| hypothetical protein CARUB_v10001922mg [Capsella rubella]
Length=220

 Score =   199 bits (507),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 113/143 (79%), Gaps = 8/143 (6%)
 Frame = +3

Query  165  SSKRILRFSASPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTG  329
            SS RI+R S     N  +P    +++ SSLVP+     LS D AMGLVLSAA+V+GWTTG
Sbjct  33   SSPRIVRLSKKKEDNDYDPQQSESNSSSSLVPLFQNRTLSNDEAMGLVLSAASVKGWTTG  92

Query  330  SGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYT  509
            SGMEGPS+PA  +   G E VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYT
Sbjct  93   SGMEGPSLPAKPD---GTETVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYT  149

Query  510  DGTVFVQCCGCNIYHKLVDNLNL  578
            DGTVFVQCCGCN++HKLVDNLNL
Sbjct  150  DGTVFVQCCGCNVFHKLVDNLNL  172



>ref|XP_010421645.1| PREDICTED: uncharacterized protein LOC104707070 isoform X1 [Camelina 
sativa]
Length=234

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 117/159 (74%), Gaps = 20/159 (13%)
 Frame = +3

Query  150  KSNRLSSKRILRFSAS-----------PRGNGNEPDLRSNSNDSSLVPI-----LSQDAA  281
            +++  SS RI+R S S                 +P  +S SN SSLVP+     LS D A
Sbjct  28   RTDSSSSPRIVRLSKSIQNLISISSSEKEDKDYDPPQQSESNSSSLVPLFQNRTLSNDEA  87

Query  282  MGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCK  461
            MGLVLSAA+V+GWTTGSGMEGPS+PA  + ET    VSTFPWSLFTKSPRRRM VAFTC 
Sbjct  88   MGLVLSAASVKGWTTGSGMEGPSLPAKPDTET----VSTFPWSLFTKSPRRRMRVAFTCN  143

Query  462  VCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  144  VCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  182



>ref|XP_007200461.1| hypothetical protein PRUPE_ppa011293mg [Prunus persica]
 gb|EMJ01660.1| hypothetical protein PRUPE_ppa011293mg [Prunus persica]
Length=216

 Score =   198 bits (503),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 109/145 (75%), Gaps = 10/145 (7%)
 Frame = +3

Query  174  RILRFSASPRGNGNEPDLRSNSNDSSLVPILS----------QDAAMGLVLSAANVRGWT  323
            R ++   + +GN NE    S+S D   VP+LS          +DAAMGLV+SAA  RGWT
Sbjct  31   RPVQLPLASKGNENESSPSSDSKDIKNVPVLSNRHLSLSPLSKDAAMGLVMSAATGRGWT  90

Query  324  TGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHA  503
            TGSGMEGP  PAG +  +  E VSTFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHA
Sbjct  91   TGSGMEGPPAPAGIHTHSSTENVSTFPWSLFTKSPRRRMLVAFTCNICGQRTTRAINPHA  150

Query  504  YTDGTVFVQCCGCNIYHKLVDNLNL  578
            YTDGTVFVQCCGCN +HKLVDNLNL
Sbjct  151  YTDGTVFVQCCGCNAFHKLVDNLNL  175



>ref|XP_004497201.1| PREDICTED: uncharacterized protein LOC101505438 [Cicer arietinum]
Length=231

 Score =   198 bits (504),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 131/185 (71%), Gaps = 21/185 (11%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRI----LRFSASPRGNGNEPDLRSNSNDS  248
            ME+L+SS+++A L PS  IF P  + R S         R  +S R +G++ D +S S D 
Sbjct  1    MESLSSSSSSATL-PSFSIFFPSSTTRTSLSSSKPTHFRLPSSKRDDGHDLDSKSKSKDE  59

Query  249  --------------SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA-GSNPETGM  383
                          SL P LS DAAMGLVLSAA  RGWTTGSGMEGPSVPA GS+ + G 
Sbjct  60   INNINLPILSHRRLSLSP-LSNDAAMGLVLSAATGRGWTTGSGMEGPSVPAVGSDDQLGT  118

Query  384  EQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLV  563
              +STFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGCN YHKLV
Sbjct  119  GNISTFPWSLFTKSPRRRMLVAFTCTICGQRTTRAINPHAYTDGTVFVQCCGCNAYHKLV  178

Query  564  DNLNL  578
            D+LNL
Sbjct  179  DHLNL  183



>ref|XP_008236070.1| PREDICTED: uncharacterized protein LOC103334867 [Prunus mume]
Length=254

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 110/145 (76%), Gaps = 10/145 (7%)
 Frame = +3

Query  174  RILRFSASPRGNGNEPDLRSNSNDSSLVPILS----------QDAAMGLVLSAANVRGWT  323
            R ++   + +GN NE +  S+S D   +P+LS          +DAAMGLV+SAA  RGWT
Sbjct  69   RPVQLPLASKGNENESNPSSDSKDIKNLPVLSNRHLSLSPLSKDAAMGLVMSAATGRGWT  128

Query  324  TGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHA  503
            TGSGMEGP  PAG +  +  E VSTFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHA
Sbjct  129  TGSGMEGPPAPAGIHTHSSTENVSTFPWSLFTKSPRRRMLVAFTCNICGQRTTRAINPHA  188

Query  504  YTDGTVFVQCCGCNIYHKLVDNLNL  578
            YTDGTVFVQCCGCN +HKLVDNLNL
Sbjct  189  YTDGTVFVQCCGCNAFHKLVDNLNL  213



>ref|NP_198080.1| Zim17-type zinc finger protein [Arabidopsis thaliana]
 gb|AAB61076.1| A_TM021B04.14 gene product [Arabidopsis thaliana]
 gb|AAL24413.1| unknown protein [Arabidopsis thaliana]
 gb|AAM10131.1| unknown protein [Arabidopsis thaliana]
 gb|AED93666.1| Zim17-type zinc finger protein [Arabidopsis thaliana]
Length=212

 Score =   196 bits (497),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 108/137 (79%), Gaps = 7/137 (5%)
 Frame = +3

Query  174  RILRFSASPRGNGNEPDLRSNSNDSSLVP--ILSQDAAMGLVLSAANVRGWTTGSGMEGP  347
            RI+R S        +P   S SN SSL     LS D AMGLVLSAA+V+GWTTGSGMEGP
Sbjct  36   RIVRLSNKKEDKDYDPQ-HSESNSSSLFRNRTLSNDEAMGLVLSAASVKGWTTGSGMEGP  94

Query  348  SVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFV  527
            S+PA ++ +T    VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFV
Sbjct  95   SLPAKTDTDT----VSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFV  150

Query  528  QCCGCNIYHKLVDNLNL  578
            QCCGCN++HKLVDNLNL
Sbjct  151  QCCGCNVFHKLVDNLNL  167



>gb|AAM64347.1| unknown [Arabidopsis thaliana]
Length=212

 Score =   195 bits (495),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 108/137 (79%), Gaps = 7/137 (5%)
 Frame = +3

Query  174  RILRFSASPRGNGNEPDLRSNSNDSSLVP--ILSQDAAMGLVLSAANVRGWTTGSGMEGP  347
            RI+R S        +P   S SN  SL    ILS D AMGLVLSAA+V+GWTTGSGMEGP
Sbjct  36   RIVRLSNKKEDKDYDPQ-HSESNSPSLFRNRILSNDEAMGLVLSAASVKGWTTGSGMEGP  94

Query  348  SVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFV  527
            S+PA ++ +T    VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFV
Sbjct  95   SLPAKTDTDT----VSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFV  150

Query  528  QCCGCNIYHKLVDNLNL  578
            QCCGCN++HKLVDNLNL
Sbjct  151  QCCGCNVFHKLVDNLNL  167



>ref|XP_008811775.1| PREDICTED: uncharacterized protein LOC103722853 isoform X1 [Phoenix 
dactylifera]
Length=210

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 117/157 (75%), Gaps = 14/157 (9%)
 Frame = +3

Query  135  IFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVPIL---------SQDAAMG  287
            +FSP   NR  SKR      + +   +E +L S+S  ++++P L         S+DAAMG
Sbjct  22   LFSP---NRAFSKRPSFLPIASKHKEDEANLHSDSKSTNIIPFLNNSTSISPLSKDAAMG  78

Query  288  LVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVC  467
            LVL+A   RGWTTGSGMEGPS+PA  +PE+    VST PWSLFTKSPRRRMLVAFTC VC
Sbjct  79   LVLNAVAGRGWTTGSGMEGPSMPA--DPESPDRTVSTVPWSLFTKSPRRRMLVAFTCNVC  136

Query  468  GQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            GQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  137  GQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  173



>ref|XP_010494029.1| PREDICTED: uncharacterized protein LOC104771232 [Camelina sativa]
Length=223

 Score =   194 bits (492),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 112/143 (78%), Gaps = 9/143 (6%)
 Frame = +3

Query  165  SSKRILRFSASPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTG  329
            SS RI+R S        +   +S SN SSLVP+     LS D AMGLVLSAA+V+GWTTG
Sbjct  33   SSPRIVRLSKKKEDKDYDHQQQSESNSSSLVPLFQNRTLSNDEAMGLVLSAASVKGWTTG  92

Query  330  SGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYT  509
            SGMEGPS+PA  + ET    VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYT
Sbjct  93   SGMEGPSLPAKPDTET----VSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYT  148

Query  510  DGTVFVQCCGCNIYHKLVDNLNL  578
            DGTVFVQCCGCN++HKLVDNLNL
Sbjct  149  DGTVFVQCCGCNVFHKLVDNLNL  171



>gb|KHN37381.1| Hypothetical protein glysoja_013596 [Glycine soja]
Length=217

 Score =   193 bits (491),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 108/139 (78%), Gaps = 4/139 (3%)
 Frame = +3

Query  165  SSKRILRFSASPRGNGNEPDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEG  344
            SSKR   F +  +     P L       SL P LS+DAAMGLVLSAA  RGWTTGSGMEG
Sbjct  42   SSKRDDAFDSDSKEKNKLPILSDRC--LSLSP-LSKDAAMGLVLSAATGRGWTTGSGMEG  98

Query  345  PSVPA-GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTV  521
            PSVPA G + E+G   +STFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTV
Sbjct  99   PSVPAVGRDSESGTGNISTFPWSLFTKSPRRRMLVAFTCTICGQRTTRAINPHAYTDGTV  158

Query  522  FVQCCGCNIYHKLVDNLNL  578
            FVQCCGCN YHKLVD+LNL
Sbjct  159  FVQCCGCNAYHKLVDHLNL  177



>ref|XP_009414426.1| PREDICTED: uncharacterized protein LOC103995548 [Musa acuminata 
subsp. malaccensis]
Length=205

 Score =   193 bits (490),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 121/175 (69%), Gaps = 14/175 (8%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            ME++A+S         L +FSP   +R   +R   F  + +   +E DL S S  +SLVP
Sbjct  1    MESVAASVAIPSSPSPLALFSP---SRSVPRRPSFFPIASKNREDEADLSSKSESTSLVP  57

Query  261  ILS---------QDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSL  413
             LS         +D AMGLVLSAA  RGWTTGSGMEGP VPA +  ++  + V TFPWSL
Sbjct  58   FLSNRAPISPLPKDTAMGLVLSAATGRGWTTGSGMEGPPVPADT--DSADQAVLTFPWSL  115

Query  414  FTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +T+SPRRRM V FTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  116  YTRSPRRRMRVVFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  170



>ref|NP_001235094.1| uncharacterized protein LOC100527113 [Glycine max]
 gb|ACU16158.1| unknown [Glycine max]
 gb|KHN11510.1| Hypothetical protein glysoja_015405 [Glycine soja]
Length=215

 Score =   193 bits (490),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 110/142 (77%), Gaps = 12/142 (8%)
 Frame = +3

Query  180  LRFSASPRGNGNEPDLRSNSNDS--------SLVPILSQDAAMGLVLSAANVRGWTTGSG  335
             R  +S R +  + D  SN N+         SL P LS+DAAMGLVLSAA  RGWTTGSG
Sbjct  38   FRLPSSKRDDARDSD--SNQNNLPILSDRCLSLSP-LSKDAAMGLVLSAATGRGWTTGSG  94

Query  336  MEGPSVPA-GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTD  512
            MEGPSVPA G + E+G   +STFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTD
Sbjct  95   MEGPSVPAVGRDSESGTGNISTFPWSLFTKSPRRRMLVAFTCTICGQRTTRAINPHAYTD  154

Query  513  GTVFVQCCGCNIYHKLVDNLNL  578
            GTVFVQCCGCN YHKLVD+LNL
Sbjct  155  GTVFVQCCGCNAYHKLVDHLNL  176



>ref|XP_006588421.1| PREDICTED: uncharacterized protein LOC100527474 isoform X2 [Glycine 
max]
Length=210

 Score =   192 bits (489),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 99/111 (89%), Gaps = 2/111 (2%)
 Frame = +3

Query  249  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKS  425
            SL P LS+DAAMGLVLSAA  RGWTTGSGMEGPSVPA G + E+G   +STFPWSLFTKS
Sbjct  61   SLSP-LSKDAAMGLVLSAATGRGWTTGSGMEGPSVPAVGRDSESGTGNISTFPWSLFTKS  119

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNL
Sbjct  120  PRRRMLVAFTCTICGQRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNL  170



>ref|XP_006605315.1| PREDICTED: uncharacterized protein LOC100527113 isoform X1 [Glycine 
max]
Length=220

 Score =   192 bits (489),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 110/149 (74%), Gaps = 21/149 (14%)
 Frame = +3

Query  180  LRFSASPRGNGNEPDLRSNSNDSSLVPILS---------------QDAAMGLVLSAANVR  314
             R  +S R +  + D  SN N+   +PILS               QDAAMGLVLSAA  R
Sbjct  38   FRLPSSKRDDARDSD--SNQNN---LPILSDRCLSLSPLSKNLWGQDAAMGLVLSAATGR  92

Query  315  GWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAI  491
            GWTTGSGMEGPSVPA G + E+G   +STFPWSLFTKSPRRRMLVAFTC +CGQRTTRAI
Sbjct  93   GWTTGSGMEGPSVPAVGRDSESGTGNISTFPWSLFTKSPRRRMLVAFTCTICGQRTTRAI  152

Query  492  NPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            NPHAYTDGTVFVQCCGCN YHKLVD+LNL
Sbjct  153  NPHAYTDGTVFVQCCGCNAYHKLVDHLNL  181



>ref|XP_006405268.1| hypothetical protein EUTSA_v10027929mg [Eutrema salsugineum]
 gb|ESQ46721.1| hypothetical protein EUTSA_v10027929mg [Eutrema salsugineum]
Length=215

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 125/174 (72%), Gaps = 15/174 (9%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFS---PLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSS  251
            MEA A S+   I+S S    S   P K    S  RI+R S     +  + D +S  N SS
Sbjct  1    MEATALSSAATIVSSSSSPLSIFSPKKRTDSSFPRIVRLSKK---DDKDYDPKSELNSSS  57

Query  252  LVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLF  416
            LVP+      S D AMGLVL+AA+VRGWTTGSGMEGPS+PA ++ ET    VSTFPWSLF
Sbjct  58   LVPLFQNRTFSDDEAMGLVLNAASVRGWTTGSGMEGPSLPAKADTET----VSTFPWSLF  113

Query  417  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            TKSPRRRM VAFTC VCGQRTTRAINPHAY+DGTVFVQCCGCN++HKLVDNLNL
Sbjct  114  TKSPRRRMRVAFTCNVCGQRTTRAINPHAYSDGTVFVQCCGCNVFHKLVDNLNL  167



>ref|NP_001236547.1| uncharacterized protein LOC100527474 [Glycine max]
 gb|ACU16568.1| unknown [Glycine max]
Length=217

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 108/139 (78%), Gaps = 4/139 (3%)
 Frame = +3

Query  165  SSKRILRFSASPRGNGNEPDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEG  344
            SSKR   F +  +     P L       SL P LS+DAAMGLVLSAA  RGWTTGSGMEG
Sbjct  42   SSKRDDAFDSDSKEKNKLPILSDRC--LSLSP-LSKDAAMGLVLSAATGRGWTTGSGMEG  98

Query  345  PSVPA-GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTV  521
            PSVPA G + E+G   +STFPWSLFTKSPRRRML+AFTC +CGQRTTRAINPHAYTDGTV
Sbjct  99   PSVPAVGRDSESGTGNISTFPWSLFTKSPRRRMLMAFTCTICGQRTTRAINPHAYTDGTV  158

Query  522  FVQCCGCNIYHKLVDNLNL  578
            FVQCCGCN YHKLVD+LNL
Sbjct  159  FVQCCGCNAYHKLVDHLNL  177



>ref|XP_006588420.1| PREDICTED: uncharacterized protein LOC100527474 isoform X1 [Glycine 
max]
Length=222

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 104/132 (79%), Gaps = 16/132 (12%)
 Frame = +3

Query  231  SNSNDSSLVPILS---------------QDAAMGLVLSAANVRGWTTGSGMEGPSVPA-G  362
            S+S + + +PILS               QDAAMGLVLSAA  RGWTTGSGMEGPSVPA G
Sbjct  51   SDSKEKNKLPILSDRCLSLSPLSKKLWGQDAAMGLVLSAATGRGWTTGSGMEGPSVPAVG  110

Query  363  SNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGC  542
             + E+G   +STFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGC
Sbjct  111  RDSESGTGNISTFPWSLFTKSPRRRMLVAFTCTICGQRTTRAINPHAYTDGTVFVQCCGC  170

Query  543  NIYHKLVDNLNL  578
            N YHKLVD+LNL
Sbjct  171  NAYHKLVDHLNL  182



>ref|XP_009391023.1| PREDICTED: uncharacterized protein LOC103977279 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=207

 Score =   192 bits (487),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 119/177 (67%), Gaps = 16/177 (9%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            ME++A+S         L  FSP    R+  +R    S + +   N+ DL S S  +SLVP
Sbjct  1    MESVAASAAIPSSPSHLSFFSP---KRIVPRRQSLVSIASKSRENDADLNSVSESTSLVP  57

Query  261  ILSQ-----------DAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPW  407
             L             D AMGLVLSAA  RGWTTGSGMEGP +PA S  ++  + V TFPW
Sbjct  58   FLGNRARAPLSPFPNDTAMGLVLSAAAGRGWTTGSGMEGPRIPAYS--DSADQTVLTFPW  115

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            SL+T+SPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  116  SLYTRSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  172



>ref|XP_009355592.1| PREDICTED: uncharacterized protein LOC103946591 [Pyrus x bretschneideri]
Length=216

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 122/176 (69%), Gaps = 12/176 (7%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            MEAL S ++  I S +           L S R  +   + +GN NE + +S+S + + +P
Sbjct  1    MEALISCSSPTITSSASSFSVFSPRKSLPS-RPFQLPLASKGNENESNPKSDSKEINRLP  59

Query  261  ILS----------QDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWS  410
            ILS          +DAAMGLV+ AA  RGWTTGSGMEGP  PAG   ++  E VSTFPWS
Sbjct  60   ILSNRHLSLSPLSKDAAMGLVMGAATGRGWTTGSGMEGPPAPAGVQTQS-TENVSTFPWS  118

Query  411  LFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            LFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGCN +HKLVD+LNL
Sbjct  119  LFTKSPRRRMLVAFTCNICGQRTTRAINPHAYTDGTVFVQCCGCNAFHKLVDHLNL  174



>ref|XP_008811782.1| PREDICTED: uncharacterized protein LOC103722853 isoform X2 [Phoenix 
dactylifera]
Length=181

 Score =   189 bits (481),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 106/131 (81%), Gaps = 11/131 (8%)
 Frame = +3

Query  213  NEPDLRSNSNDSSLVPIL---------SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGS  365
            +E +L S+S  ++++P L         S+DAAMGLVL+A   RGWTTGSGMEGPS+PA  
Sbjct  16   DEANLHSDSKSTNIIPFLNNSTSISPLSKDAAMGLVLNAVAGRGWTTGSGMEGPSMPA--  73

Query  366  NPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCN  545
            +PE+    VST PWSLFTKSPRRRMLVAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN
Sbjct  74   DPESPDRTVSTVPWSLFTKSPRRRMLVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCN  133

Query  546  IYHKLVDNLNL  578
            ++HKLVDNLNL
Sbjct  134  VFHKLVDNLNL  144



>emb|CDY12988.1| BnaC02g29950D [Brassica napus]
Length=214

 Score =   190 bits (483),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 114/150 (76%), Gaps = 12/150 (8%)
 Frame = +3

Query  144  PLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAAN  308
            P K    SS RI+R S     +  + D +  S+  SLVP+     LS D AMGLVLSAA+
Sbjct  25   PKKRTYSSSPRIVRLSKK---DDKDYDPKFESDSLSLVPLFQNRTLSNDEAMGLVLSAAS  81

Query  309  VRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRA  488
            VRGWTTGSGMEGPS+PA ++ ET    +STFPWSLFTKSPRRRM VAFTC VCGQRTTRA
Sbjct  82   VRGWTTGSGMEGPSLPAKADAET----ISTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRA  137

Query  489  INPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            INPHAYTDGTVFVQCCGC ++HKLVDNLNL
Sbjct  138  INPHAYTDGTVFVQCCGCYVFHKLVDNLNL  167



>ref|XP_008348928.1| PREDICTED: uncharacterized protein LOC103412108 [Malus domestica]
 ref|XP_008365921.1| PREDICTED: uncharacterized protein LOC103429551 [Malus domestica]
Length=216

 Score =   190 bits (483),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 121/176 (69%), Gaps = 12/176 (7%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            MEAL SS +  I S +           L S R  +   + +GN NE + + +S + + +P
Sbjct  1    MEALISSYSPTITSSASSFSVFSPRKSLPS-RPFQLPLASKGNENEXNPKLDSKEINRLP  59

Query  261  ILS----------QDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWS  410
            ILS          +DAAMGLV+ AA  RGWTTGSGMEGP  PAG   ++  E VSTFPWS
Sbjct  60   ILSNRHLSLSPLSKDAAMGLVMGAATGRGWTTGSGMEGPPAPAGVQTQS-TENVSTFPWS  118

Query  411  LFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            LFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGCN +HKLVD+LNL
Sbjct  119  LFTKSPRRRMLVAFTCNICGQRTTRAINPHAYTDGTVFVQCCGCNAFHKLVDHLNL  174



>gb|AFK34110.1| unknown [Lotus japonicus]
Length=244

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 98/111 (88%), Gaps = 2/111 (2%)
 Frame = +3

Query  249  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKS  425
            SL P LS+DAAMGLVLSAA  RGWTTGSGMEGPS PA G + E+G   +STFPWSLFTKS
Sbjct  90   SLSP-LSKDAAMGLVLSAAMGRGWTTGSGMEGPSAPAAGRDNESGTGNISTFPWSLFTKS  148

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNL
Sbjct  149  PRRRMLVAFTCTICGQRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNL  199



>gb|KJB14348.1| hypothetical protein B456_002G120700 [Gossypium raimondii]
Length=154

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 121/156 (78%), Gaps = 13/156 (8%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            MEAL SS   A+LS    IFSP + +     RI+RF    + +GN+ D++ + N++S+VP
Sbjct  1    MEAL-SSQPLALLS----IFSPKRKD--FPARIIRFPTHSKKDGNDSDIQYDPNNTSIVP  53

Query  261  IL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNP-ETGMEQVSTFPWSLFTK  422
            ++     SQDAAMGLVLSAA+VRGWTTGSGMEGPSVPA ++  ++  EQVSTFPWSLFTK
Sbjct  54   LVGNQTFSQDAAMGLVLSAASVRGWTTGSGMEGPSVPARTDDDQSNTEQVSTFPWSLFTK  113

Query  423  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQ  530
            SPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQ
Sbjct  114  SPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQ  149



>ref|XP_007142794.1| hypothetical protein PHAVU_007G017400g [Phaseolus vulgaris]
 gb|ESW14788.1| hypothetical protein PHAVU_007G017400g [Phaseolus vulgaris]
Length=214

 Score =   188 bits (477),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 115/147 (78%), Gaps = 11/147 (7%)
 Frame = +3

Query  162  LSSKRILRFSA-SPRGNGNEPDLRSNS----NDS--SLVPILSQDAAMGLVLSAANVRGW  320
            LS  + L+F   S R +  + D  +N+    +D   SL P LS+DAAMGLVLSAA  RGW
Sbjct  32   LSPPKTLQFRLPSKRDDARDSDTENNTFPIISDRCLSLSP-LSKDAAMGLVLSAAVGRGW  90

Query  321  TTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINP  497
            TTGSGMEGPSVPA G + E+G   +STFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINP
Sbjct  91   TTGSGMEGPSVPAVGRDNESG--NISTFPWSLFTKSPRRRMLVAFTCTICGQRTTRAINP  148

Query  498  HAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            HAYTDGTVFVQCCGCN YHKLVD+LNL
Sbjct  149  HAYTDGTVFVQCCGCNAYHKLVDHLNL  175



>gb|AFK48753.1| unknown [Medicago truncatula]
Length=230

 Score =   188 bits (477),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 109/149 (73%), Gaps = 17/149 (11%)
 Frame = +3

Query  180  LRFSASPRGNGNEPDLRSNSNDSS-----LVPIL----------SQDAAMGLVLSAANVR  314
             R  +S R +GN  D  S S  S+     L P+L          S DAAMGLVLSAA  R
Sbjct  43   FRLPSSKRDDGNN-DSESQSKSSNQINFNLSPVLTNRCFSISPLSNDAAMGLVLSAATGR  101

Query  315  GWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAI  491
            GWTTGSGMEGP VPA G + ++G E +STFPWSLFTKSPRRRML+AFTC +CGQRTTRAI
Sbjct  102  GWTTGSGMEGPPVPAVGKDGQSGTENISTFPWSLFTKSPRRRMLIAFTCTICGQRTTRAI  161

Query  492  NPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            NPHAYTDGTVFVQCC CN YHKLVD+LNL
Sbjct  162  NPHAYTDGTVFVQCCECNAYHKLVDHLNL  190



>gb|KEH44399.1| DNL zinc finger protein [Medicago truncatula]
Length=231

 Score =   188 bits (477),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 109/149 (73%), Gaps = 17/149 (11%)
 Frame = +3

Query  180  LRFSASPRGNGNEPDLRSNSNDSS-----LVPI----------LSQDAAMGLVLSAANVR  314
             R  +S R +GN  D  S S  S+     L P+          LS DAAMGLVLSAA  R
Sbjct  43   FRLPSSKRDDGNN-DSESQSKSSNQINFNLSPVPTNRCFSISPLSNDAAMGLVLSAATGR  101

Query  315  GWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAI  491
            GWTTGSGMEGP VPA G + ++G E +STFPWSLFTKSPRRRML+AFTC +CGQRTTRAI
Sbjct  102  GWTTGSGMEGPPVPAVGKDGQSGTENISTFPWSLFTKSPRRRMLIAFTCTICGQRTTRAI  161

Query  492  NPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            NPHAYTDGTVFVQCC CN YHKLVD+LNL
Sbjct  162  NPHAYTDGTVFVQCCECNAYHKLVDHLNL  190



>ref|XP_011458699.1| PREDICTED: uncharacterized protein LOC105349780 [Fragaria vesca 
subsp. vesca]
Length=211

 Score =   187 bits (475),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  249  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSP  428
            SL P LS+DAAMGLV+ AA  RGWTTGSGMEGP  PAG +  +  E VSTFPWSLFTKSP
Sbjct  62   SLSP-LSKDAAMGLVMGAATGRGWTTGSGMEGPPTPAGIDSRSSTENVSTFPWSLFTKSP  120

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            RRRMLVAFTC +CGQRTTRAINPHA+TDGTVFVQCCGCN +HKLVDNLNL
Sbjct  121  RRRMLVAFTCNICGQRTTRAINPHAFTDGTVFVQCCGCNAFHKLVDNLNL  170



>ref|XP_009418558.1| PREDICTED: uncharacterized protein LOC103998726 [Musa acuminata 
subsp. malaccensis]
Length=205

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 103/132 (78%), Gaps = 11/132 (8%)
 Frame = +3

Query  210  GNEPDLRSNSNDSSLVPILS---------QDAAMGLVLSAANVRGWTTGSGMEGPSVPAG  362
            G++ DL S+S  +SLVP L          +D AMGLVLSAA  RGWTTGSGMEGP +PA 
Sbjct  41   GDDADLNSDSESTSLVPFLGNRAPISPLPKDKAMGLVLSAAAGRGWTTGSGMEGPPIPAD  100

Query  363  SNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGC  542
            S  ++    V TFPWSL+T+SPRRRM VAFTC +CGQRTTRAINPHAYTDGTVFVQCCGC
Sbjct  101  S--DSADRTVLTFPWSLYTRSPRRRMRVAFTCNICGQRTTRAINPHAYTDGTVFVQCCGC  158

Query  543  NIYHKLVDNLNL  578
            N++HKLVDNLNL
Sbjct  159  NVFHKLVDNLNL  170



>gb|AFK39869.1| unknown [Lotus japonicus]
Length=243

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 2/111 (2%)
 Frame = +3

Query  249  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKS  425
            SL P LS+DAAMGLVLSAA  RGWTTGSG+EGPS PA G + E+G   +STFPWSLFTKS
Sbjct  89   SLSP-LSKDAAMGLVLSAAMGRGWTTGSGVEGPSAPAAGRDNESGTGDISTFPWSLFTKS  147

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRRRMLVAFTC +CGQRTT+AINPHAYTDGTVFVQCCGCN YHKLVD+LNL
Sbjct  148  PRRRMLVAFTCTICGQRTTQAINPHAYTDGTVFVQCCGCNAYHKLVDHLNL  198



>ref|XP_009391021.1| PREDICTED: uncharacterized protein LOC103977279 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=246

 Score =   186 bits (471),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 103/140 (74%), Gaps = 13/140 (9%)
 Frame = +3

Query  192  ASPRGNGNEPDLRSNSNDSSLVPILSQ-----------DAAMGLVLSAANVRGWTTGSGM  338
            AS     N+ DL S S  +SLVP L             D AMGLVLSAA  RGWTTGSGM
Sbjct  74   ASKSSRENDADLNSVSESTSLVPFLGNRARAPLSPFPNDTAMGLVLSAAAGRGWTTGSGM  133

Query  339  EGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGT  518
            EGP +PA S  ++  + V TFPWSL+T+SPRRRM VAFTC VCGQRTTRAINPHAYTDGT
Sbjct  134  EGPRIPAYS--DSADQTVLTFPWSLYTRSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGT  191

Query  519  VFVQCCGCNIYHKLVDNLNL  578
            VFVQCCGCN++HKLVDNLNL
Sbjct  192  VFVQCCGCNVFHKLVDNLNL  211



>gb|EAZ38321.1| hypothetical protein OsJ_22696 [Oryza sativa Japonica Group]
Length=205

 Score =   184 bits (468),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 121/177 (68%), Gaps = 19/177 (11%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKR--ILRFSASPRGNGNEPDLRSNSNDS--  248
            ME++A +TT+  L P LP   P  SNR   +R   L  +AS R + ++ D          
Sbjct  1    MESVAIATTSRSLLP-LP---PFSSNRRCRRRASFLPVAASNRRHHDDDDEEVAKAHEPT  56

Query  249  -------SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPW  407
                   S++P LS+DAAMGLV+SAA  RGWTTGSGMEGP   AG        +VST PW
Sbjct  57   SLASYGLSILP-LSKDAAMGLVVSAATGRGWTTGSGMEGPPKAAGGGDRP---EVSTLPW  112

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            SLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNL
Sbjct  113  SLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNL  169



>ref|NP_001058612.2| Os06g0724400 [Oryza sativa Japonica Group]
 dbj|BAD61688.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD62532.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20526.2| Os06g0724400 [Oryza sativa Japonica Group]
Length=205

 Score =   184 bits (466),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 122/176 (69%), Gaps = 17/176 (10%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKR--ILRFSASPRGNGNEPD--LRSNSNDS  248
            ME++A +TT+  L P LP   P  SNR   +R   L  +AS R + ++ D  +      +
Sbjct  1    MESVAIATTSRSLLP-LP---PFSSNRRCRRRASFLPVAASNRRHHDDDDEEVAKAHEPT  56

Query  249  SL------VPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWS  410
            SL      +  LS+DAAMGLV+SAA  RGWTTGSGMEGP   AG        +VST PWS
Sbjct  57   SLASYGLSISPLSKDAAMGLVVSAATGRGWTTGSGMEGPPKAAGGGDRP---EVSTLPWS  113

Query  411  LFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            LFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNL
Sbjct  114  LFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNL  169



>ref|XP_009391022.1| PREDICTED: uncharacterized protein LOC103977279 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=245

 Score =   185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 101/133 (76%), Gaps = 13/133 (10%)
 Frame = +3

Query  213  NEPDLRSNSNDSSLVPILSQ-----------DAAMGLVLSAANVRGWTTGSGMEGPSVPA  359
            N+ DL S S  +SLVP L             D AMGLVLSAA  RGWTTGSGMEGP +PA
Sbjct  80   NDADLNSVSESTSLVPFLGNRARAPLSPFPNDTAMGLVLSAAAGRGWTTGSGMEGPRIPA  139

Query  360  GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCG  539
             S  ++  + V TFPWSL+T+SPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCG
Sbjct  140  YS--DSADQTVLTFPWSLYTRSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCG  197

Query  540  CNIYHKLVDNLNL  578
            CN++HKLVDNLNL
Sbjct  198  CNVFHKLVDNLNL  210



>gb|EAZ02398.1| hypothetical protein OsI_24501 [Oryza sativa Indica Group]
Length=205

 Score =   182 bits (463),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 122/176 (69%), Gaps = 17/176 (10%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKR--ILRFSASPRGNGNEPD--LRSNSNDS  248
            ME++A +TT+  L P LP   P  SNR   +R   L  +A+ R + ++ D  +      +
Sbjct  1    MESVAIATTSRSLLP-LP---PFSSNRRCRRRASFLPVAATNRRHHDDDDEEVAKAHEPT  56

Query  249  SL------VPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWS  410
            SL      +  LS+DAAMGLV+SAA  RGWTTGSGMEGP   AG        +VST PWS
Sbjct  57   SLASYGLSISPLSKDAAMGLVVSAATGRGWTTGSGMEGPPKAAGGGDRP---EVSTLPWS  113

Query  411  LFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            LFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNL
Sbjct  114  LFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNL  169



>ref|NP_001131303.1| uncharacterized protein LOC100192616 [Zea mays]
 gb|ACF79647.1| unknown [Zea mays]
Length=211

 Score =   182 bits (463),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 122/178 (69%), Gaps = 14/178 (8%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPI-FSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSND----  245
            ME++AS+   A  S SLP+ FS    +R      L  +AS R + ++   + +S++    
Sbjct  1    MESVASAAI-ATTSRSLPLPFSSAPVHRRRRAAFLPVAASKRHDDDKEAAKGSSSEPRRE  59

Query  246  -SSLVPI------LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFP  404
             +SL P       LS+DAAMGLV+SAA   GWTTGSGMEGP   A      G  +VST P
Sbjct  60   PTSLAPYGLSISPLSKDAAMGLVVSAATGSGWTTGSGMEGPPT-ASKAGGAGRPEVSTLP  118

Query  405  WSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            WSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  119  WSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  176



>ref|XP_008643737.1| PREDICTED: LOC100283270 isoform X1 [Zea mays]
 gb|AFW69541.1| DNL zinc finger family protein [Zea mays]
Length=208

 Score =   182 bits (462),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 121/184 (66%), Gaps = 29/184 (16%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRF---SASPR---------GNGNEPD  224
            MEA A +TT    S SLP+  P  S +L  +R   F   +AS R         G+G+EP 
Sbjct  1    MEAAAIATT----SRSLPL--PFSSTQLQRRRRATFIPIAASKRHEDDKETAKGSGSEP-  53

Query  225  LRSNSNDSSLVPI------LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGME  386
                   +SL P       LS+DAAMGLV+SAA   GWTTGSGMEGP   A      G  
Sbjct  54   ---RREPTSLAPYGISISPLSKDAAMGLVVSAATGSGWTTGSGMEGPPT-ASKAGGAGRP  109

Query  387  QVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVD  566
            +VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVD
Sbjct  110  EVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVD  169

Query  567  NLNL  578
            NLNL
Sbjct  170  NLNL  173



>gb|ABK21254.1| unknown [Picea sitchensis]
Length=214

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 119/183 (65%), Gaps = 23/183 (13%)
 Frame = +3

Query  87   ALASSTTTAILSPSLPIF-------SPLKSNRLSSKRILRFSASPRGNGNE---------  218
            A+ S   TA L   LPI+       SPL+S      R L  SA  + + +E         
Sbjct  2    AVESFGATATLRGGLPIWNCNRIGHSPLRSR----SRRLVVSAVNQKSDDEMNTEEAEKT  57

Query  219  ---PDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQ  389
               P ++ +   S+ +  LS++ AMGLVL AA  RGWTTGSGMEGP+V AG    T M +
Sbjct  58   TSFPLIKFHGKHSTSLQPLSKEVAMGLVLKAAGGRGWTTGSGMEGPAVSAGPKENTEMAE  117

Query  390  VSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDN  569
             S +PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQC GC+++HKLVDN
Sbjct  118  KSIYPWSLFTKSPRRRMRVAFTCGVCGQRTTRAINPHAYTDGTVFVQCAGCDVFHKLVDN  177

Query  570  LNL  578
            LNL
Sbjct  178  LNL  180



>ref|XP_010028773.1| PREDICTED: uncharacterized protein LOC104418983 [Eucalyptus grandis]
 gb|KCW55588.1| hypothetical protein EUGRSUZ_I01459 [Eucalyptus grandis]
Length=220

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 103/132 (78%), Gaps = 12/132 (9%)
 Frame = +3

Query  213  NEPDLRSNSNDSSLVPI----------LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAG  362
            NE D++S+S D S+ P+          LS++ AMGLVL+AA  RGWTTGSG+EGP VPA 
Sbjct  53   NEADVQSDSRDLSIAPVRKDRSLSISPLSKETAMGLVLNAAVGRGWTTGSGLEGPPVPAE  112

Query  363  SNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGC  542
            +  E+  E  ST P+SLFTKSPRRRMLVAFTC +C QRTTRAINPHAYTDGTVFVQCCGC
Sbjct  113  T--ESSSEDTSTLPFSLFTKSPRRRMLVAFTCNICRQRTTRAINPHAYTDGTVFVQCCGC  170

Query  543  NIYHKLVDNLNL  578
            N YHKLVDNLNL
Sbjct  171  NAYHKLVDNLNL  182



>ref|XP_004966483.1| PREDICTED: uncharacterized protein LOC101768670 [Setaria italica]
Length=209

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 121/177 (68%), Gaps = 14/177 (8%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPI-FSPLKSNRLSSKRILRFSASPRGNGNEPDLRSN--SNDSS  251
            ME++A++   A  S SLP+ FS    +R      L  +AS R N ++ ++ +      +S
Sbjct  1    MESVAAAAI-ATTSRSLPLPFSSTPLHRRCRPVFLPVAASKRHNDDDKEVANGPGREPTS  59

Query  252  LVPI-------LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGME-QVSTFPW  407
            L P        LS+DAAMGLV+SAA   GWTTGSGMEGP  PA S        +VST PW
Sbjct  60   LAPYGGLSISPLSKDAAMGLVVSAATGSGWTTGSGMEGP--PAASRAGGADRPEVSTLPW  117

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            SLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNL
Sbjct  118  SLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNL  174



>ref|XP_006828828.1| hypothetical protein AMTR_s00001p00142230 [Amborella trichopoda]
 gb|ERM96244.1| hypothetical protein AMTR_s00001p00142230 [Amborella trichopoda]
Length=201

 Score =   177 bits (450),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = +3

Query  207  NGNEPDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGME  386
            N  EP+  S     S  P  S+DAAMGLVLSAA  RGWTTGSGMEGP V + ++     +
Sbjct  46   NHGEPENTSIVPQVSFAP-FSKDAAMGLVLSAATGRGWTTGSGMEGPPV-SEADVSNAQQ  103

Query  387  QVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVD  566
             VSTFPWSLFT+SPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQC GCNI+HKLVD
Sbjct  104  PVSTFPWSLFTRSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCAGCNIFHKLVD  163

Query  567  NLNL  578
            NLNL
Sbjct  164  NLNL  167



>ref|XP_002439041.1| hypothetical protein SORBIDRAFT_10g030440 [Sorghum bicolor]
 gb|EER90408.1| hypothetical protein SORBIDRAFT_10g030440 [Sorghum bicolor]
Length=214

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 119/183 (65%), Gaps = 21/183 (11%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRF---SASPRGNGNEPDLRSNSNDS-  248
            M+++A++   A  S SLP+  P  S  L  +R   F   +AS R   +E   +   + + 
Sbjct  1    MDSVAAAAI-ATTSRSLPL--PFSSTPLHRRRRASFLPVAASKRYEDDEEAAKGKGSGTG  57

Query  249  ------SLVPI-------LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQ  389
                  SL P        LS+DAAMGLV+SAA   GWTTGSGMEGP   A      G  +
Sbjct  58   PGREPTSLAPYGGLSISPLSKDAAMGLVVSAATGSGWTTGSGMEGPPT-ASKAGGAGRPE  116

Query  390  VSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDN  569
            VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDN
Sbjct  117  VSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDN  176

Query  570  LNL  578
            LNL
Sbjct  177  LNL  179



>ref|XP_006656504.1| PREDICTED: uncharacterized protein LOC102700628 [Oryza brachyantha]
Length=205

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 99/138 (72%), Gaps = 4/138 (3%)
 Frame = +3

Query  165  SSKRILRFSASPRGNGNEPDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEG  344
            S +R         G G+E    +     SL P LS+DAAMGLV+SAA   GWTTGSGMEG
Sbjct  36   SKRRHDDDDDEEEGAGHEHTSLAPYAGLSLSP-LSKDAAMGLVVSAATGSGWTTGSGMEG  94

Query  345  PSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVF  524
            P   AG        +VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVF
Sbjct  95   PPKAAGGADR---PEVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVF  151

Query  525  VQCCGCNIYHKLVDNLNL  578
            VQCCGCNI+HKLVDNLNL
Sbjct  152  VQCCGCNIFHKLVDNLNL  169



>ref|XP_003563260.1| PREDICTED: uncharacterized protein LOC100844750 [Brachypodium 
distachyon]
Length=210

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 90/110 (82%), Gaps = 5/110 (5%)
 Frame = +3

Query  249  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSP  428
            SL P  S+DAAMGLV+SAA   GWTTGSGMEGP     +N      +VST PWSLFTKSP
Sbjct  69   SLSP-FSKDAAMGLVMSAATGSGWTTGSGMEGPPTAGAAN----RPEVSTLPWSLFTKSP  123

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            RRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  124  RRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  173



>dbj|BAJ94825.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=245

 Score =   172 bits (437),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 87/105 (83%), Gaps = 3/105 (3%)
 Frame = +3

Query  264  LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRML  443
             S+DAAMGLV+SAA   GWTTGSGMEGP    G+       +VST PWSLFTKSPRRRM 
Sbjct  106  FSKDAAMGLVMSAATGSGWTTGSGMEGPPTAGGA---ANRPEVSTLPWSLFTKSPRRRMR  162

Query  444  VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNL
Sbjct  163  VAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNL  207



>ref|XP_006386156.1| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
 gb|ERP63953.1| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
Length=189

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 100/124 (81%), Gaps = 5/124 (4%)
 Frame = +3

Query  177  ILRFSASPRGNGNEPDLRSNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGME  341
            +LRF  S + +  + DL+S+S+DSS+VP+      S+DAAMGLVLSAA+VRGWTTGSGME
Sbjct  30   LLRFHVSSKKDKKDSDLQSSSHDSSIVPLFNNPSFSKDAAMGLVLSAASVRGWTTGSGME  89

Query  342  GPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTV  521
            GPSV A S      E+VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTV
Sbjct  90   GPSVTAVSEDGFNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTV  149

Query  522  FVQC  533
            FVQC
Sbjct  150  FVQC  153



>ref|NP_001149644.1| LOC100283270 [Zea mays]
 gb|ACG36220.1| DNL zinc finger family protein [Zea mays]
 gb|AFW69540.1| DNL zinc finger family protein [Zea mays]
Length=133

 Score =   162 bits (409),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +3

Query  282  MGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCK  461
            MGLV+SAA   GWTTGSGMEGP   A      G  +VST PWSLFTKSPRRRM VAFTC 
Sbjct  1    MGLVVSAATGSGWTTGSGMEGPPT-ASKAGGAGRPEVSTLPWSLFTKSPRRRMRVAFTCN  59

Query  462  VCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNL
Sbjct  60   VCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNL  98



>ref|XP_002977585.1| hypothetical protein SELMODRAFT_58719, partial [Selaginella moellendorffii]
 gb|EFJ21589.1| hypothetical protein SELMODRAFT_58719, partial [Selaginella moellendorffii]
Length=105

 Score =   148 bits (374),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 80/106 (75%), Gaps = 4/106 (4%)
 Frame = +3

Query  261  ILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRM  440
            +LSQ+ AMGLVL AA+ +GWTT SG+EGP+  +  N     E      W L +KSPRRRM
Sbjct  1    LLSQEMAMGLVLQAASGKGWTTDSGLEGPAFTSKENSSLSEEN----QWPLLSKSPRRRM  56

Query  441  LVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
             VAFTC VCG RT RAINPHAYTDGTVFVQC GCN++HKLVDNLNL
Sbjct  57   RVAFTCNVCGARTMRAINPHAYTDGTVFVQCKGCNVFHKLVDNLNL  102



>gb|EMS65438.1| hypothetical protein TRIUR3_05242 [Triticum urartu]
Length=543

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 83/113 (73%), Gaps = 17/113 (15%)
 Frame = +3

Query  282  MGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCK  461
            MGLV+SAA   GWTTGSGMEGP +  G+       +VST PWSLFTKSPRRRM VAFTC 
Sbjct  1    MGLVMSAATGSGWTTGSGMEGPPMAGGA---ANRPEVSTLPWSLFTKSPRRRMRVAFTCN  57

Query  462  VCGQRTTRAINPHAYTDGTVFVQ--------------CCGCNIYHKLVDNLNL  578
            VCGQRTTRAINPHAYTDGTVFVQ              CCGCNI+HKLVDNLNL
Sbjct  58   VCGQRTTRAINPHAYTDGTVFVQNLPFHISVALNLKKCCGCNIFHKLVDNLNL  110



>ref|XP_001760208.1| predicted protein [Physcomitrella patens]
 gb|EDQ74964.1| predicted protein [Physcomitrella patens]
Length=283

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 78/105 (74%), Gaps = 8/105 (8%)
 Frame = +3

Query  267  SQDAAMGLVLSAA-NVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRML  443
            + D AMG++L+AA +  GWTTGSG+EGPS P         E  +  P  +F+KSPRRRM 
Sbjct  159  NHDEAMGIILNAAGSTAGWTTGSGLEGPSYPM-------EEAANEMPGPIFSKSPRRRMR  211

Query  444  VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            VAFTC VCG R+ RAINPHAYTDGTVFVQC GC+++HKLVDNL L
Sbjct  212  VAFTCNVCGHRSIRAINPHAYTDGTVFVQCEGCDVFHKLVDNLKL  256



>gb|EMT02176.1| hypothetical protein F775_14553 [Aegilops tauschii]
Length=564

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  387  QVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVD  566
            +VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLVD
Sbjct  10   EVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLVD  69

Query  567  NLNL  578
            NLNL
Sbjct  70   NLNL  73



>gb|EYU17552.1| hypothetical protein MIMGU_mgv1a023730mg [Erythranthe guttata]
Length=154

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 78/157 (50%), Gaps = 54/157 (34%)
 Frame = +3

Query  81   MEALASSTTTAILSPSLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVP  260
            ME L ++T   +   SLPI  P KS   S +R++RFS SP+                   
Sbjct  1    METLTTTTGAVV---SLPIVFPAKSKDASFRRLIRFSTSPKSE-----------------  40

Query  261  ILSQDAAMGLVLSAANVRGWTTGSGMEG-PSVPAGSNPETGMEQVSTFPWSLFTKSPRRR  437
             L QD AMGLVLSAANVRGWTTGSG+ G P+ PA +  +                     
Sbjct  41   -LLQDDAMGLVLSAANVRGWTTGSGIYGRPTCPAPAGSDM--------------------  79

Query  438  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQC--CGC  542
                      G+RTTRA+NPHAYTDGTVFVQ   C C
Sbjct  80   ----------GRRTTRAVNPHAYTDGTVFVQVRICHC  106



>emb|CAO02549.1| putative zinc finger (DNL type) family protein [Vigna unguiculata]
Length=113

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 60/80 (75%), Gaps = 5/80 (6%)
 Frame = -1

Query  496  GLMARVVRCPQTLQVKATSIRRRGDFVKRDQGKVDTC--SIPVSGFEPAGTDGPSIPDPV  323
            GL+ARVVR PQ +QVKATSI   GDFVKRD GKV+    S+P+     AGT+GPSIP+PV
Sbjct  2    GLIARVVRWPQMVQVKATSILLLGDFVKRDHGKVEMFPDSLPLPT---AGTEGPSIPEPV  58

Query  322  VHPRTFAALRTNPIAASWER  263
            VHP   AAL T+PIAAS +R
Sbjct  59   VHPLPTAALSTSPIAASLDR  78



>ref|XP_010470860.1| PREDICTED: uncharacterized protein LOC104750716 [Camelina sativa]
Length=174

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 89/164 (54%), Gaps = 17/164 (10%)
 Frame = +3

Query  99   STTTAILSPSL-PIFSPLKSNRLSSKRI-LRFSASPRGNGNEPDLRSNSNDSSLVPILSQ  272
            + TTA LSP L PI+SP+  N   +K I +RFSAS      +P L      + +   L +
Sbjct  2    ANTTARLSPVLAPIYSPVSGN---TKPISVRFSAS----FYKPSLPLFKQQNPISTTLHR  54

Query  273  DAAMGLVLSAANVRGWTT---GSGMEGPSV-PAGSNPETGMEQVSTFPWSLFTKSPRRRM  440
             A +  V++A   R  +    GS  +   + P   + ++   QV+    S+ TK PRR +
Sbjct  55   AARVIEVVAAPKQRNRSFSVFGSLTDDSKLNPEEESEDSAEGQVA----SVDTKLPRRSL  110

Query  441  LVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
             V FTC  CG+RT R IN HAY  G VFVQC GC  +HKLVDNL
Sbjct  111  QVEFTCDSCGERTKRLINRHAYERGLVFVQCAGCLQHHKLVDNL  154



>tpg|DAA58876.1| TPA: etched1 isoform 1 [Zea mays]
 tpg|DAA58877.1| TPA: etched1 isoform 2 [Zea mays]
Length=86

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL L
Sbjct  10   KLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGL  62



>ref|XP_010511888.1| PREDICTED: uncharacterized protein LOC104787925 isoform X2 [Camelina 
sativa]
Length=174

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 80/160 (50%), Gaps = 9/160 (6%)
 Frame = +3

Query  99   STTTAILSPSL-PIFSPLKSNRLSSKRI-LRFSASPRGNGNEPDLRSNSNDSSLVPILSQ  272
            + TTA  SP L PI+SP+  N   +K I +RFSAS      +P L      + +   L +
Sbjct  2    ANTTARWSPVLAPIYSPVSGN---TKPISVRFSAS----FYKPSLPLFKQQNPISTTLHR  54

Query  273  DAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAF  452
             A +  V++A   R  +                E   + V     S+ TK PRR + + F
Sbjct  55   AARVTEVVAAPKQRNRSFSIFASLTDDSKLKPEEESNDSVEGQVASVDTKLPRRSLQLEF  114

Query  453  TCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            TC  CG+RT R IN HAY  G VFVQC GC  YHKLVDNL
Sbjct  115  TCNSCGERTKRLINRHAYERGLVFVQCAGCLQYHKLVDNL  154



>ref|XP_006301666.1| hypothetical protein CARUB_v10022115mg [Capsella rubella]
 gb|EOA34564.1| hypothetical protein CARUB_v10022115mg [Capsella rubella]
Length=184

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 82/169 (49%), Gaps = 17/169 (10%)
 Frame = +3

Query  99   STTTAILSPSL-PIFSPLKSNRLSSKRI-LRFSAS------PRGNGNEP--DLRSNSNDS  248
            + T A  SP L PI+SP+ SN   SK I  RFSAS      P  N   P   L   ++  
Sbjct  2    TNTAAGWSPVLAPIYSPVNSN---SKPISFRFSASFYKPPLPLFNQQNPVSALHRKAHPF  58

Query  249  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPET-GMEQVSTFPWSLFTKS  425
               P       + +V      R ++  + +   S     NPE    + V     S+  K 
Sbjct  59   KASPRSGAARVIEVVAPKQRNRSFSVFASLTDDS---KLNPEEESNDSVEGQVASVDIKL  115

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            PRRR+ V FTC  CG+RT R IN HAY  G VFVQC GC  +HKLVDNL
Sbjct  116  PRRRLQVEFTCNSCGERTKRLINRHAYERGLVFVQCAGCLQHHKLVDNL  164



>ref|XP_004969096.1| PREDICTED: DNL-type zinc finger protein-like [Setaria italica]
Length=162

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL+L
Sbjct  86   KLPRRSLLVQFTCNKCGERTQRLINRLAYERGTVFLQCAGCQVYHKFVDNLDL  138



>ref|NP_001043517.2| Os01g0605200 [Oryza sativa Japonica Group]
 dbj|BAD52669.1| putative zinc ribbon 1 [Oryza sativa Japonica Group]
 gb|EAZ12620.1| hypothetical protein OsJ_02531 [Oryza sativa Japonica Group]
 dbj|BAF05431.2| Os01g0605200 [Oryza sativa Japonica Group]
Length=154

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 46/74 (62%), Gaps = 9/74 (12%)
 Frame = +3

Query  357  AGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCC  536
            AGS P       STF  +L    PRR +LV FTC  CG+RT R IN  AY  GT+F+QC 
Sbjct  72   AGSAPAE-----STFDLNL----PRRSLLVQFTCNACGERTKRLINRVAYERGTIFLQCA  122

Query  537  GCNIYHKLVDNLNL  578
            GC +YHK VDNL L
Sbjct  123  GCQVYHKFVDNLGL  136



>gb|ABK26747.1| unknown [Picea sitchensis]
Length=156

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR ++V+F C  CG RT R +N HAY  GTVFVQC GC  YHKLVDNL L
Sbjct  86   PRRSLMVSFNCDACGTRTKRIVNRHAYERGTVFVQCAGCEAYHKLVDNLGL  136



>ref|NP_001150527.1| zinc ribbon 1 [Zea mays]
 gb|ACG39419.1| zinc ribbon 1 [Zea mays]
Length=161

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL L
Sbjct  85   KLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGL  137



>ref|XP_002458121.1| hypothetical protein SORBIDRAFT_03g027210 [Sorghum bicolor]
 gb|EES03241.1| hypothetical protein SORBIDRAFT_03g027210 [Sorghum bicolor]
Length=163

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL L
Sbjct  87   KLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGL  139



>tpg|DAA58878.1| TPA: etched1 [Zea mays]
Length=166

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL L
Sbjct  90   KLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGL  142



>gb|EEC71043.1| hypothetical protein OsI_02763 [Oryza sativa Indica Group]
Length=154

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = +3

Query  393  STFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            STF  +L    PRR +LV FTC  CG+RT R IN  AY  GT+F+QC GC +YHK VDNL
Sbjct  79   STFDLNL----PRRSLLVQFTCNACGERTKRLINRVAYERGTIFLQCAGCQVYHKFVDNL  134

Query  573  NL  578
             L
Sbjct  135  GL  136



>ref|NP_001105722.1| etched1 [Zea mays]
 emb|CAD45038.1| ETCHED1 protein [Zea mays]
 emb|CAD45039.1| ETCHED1 protein [Zea mays]
Length=163

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL L
Sbjct  87   KLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGL  139



>ref|XP_008446529.1| PREDICTED: uncharacterized protein C24H6.02c isoform X2 [Cucumis 
melo]
Length=170

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 66/127 (52%), Gaps = 4/127 (3%)
 Frame = +3

Query  198  PRGNGNEPDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPET  377
            P  N  +P L S +N S+ V I S++     V      +  T  S ++G +   G + E+
Sbjct  28   PSINSFKPILSSKANPSNGVFIRSRNFCTAPVTRGRRYKVLTVSSLVDGYT---GDDDES  84

Query  378  GMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHK  557
                  T   ++  K PRR ++V FTC  C +RT R IN  AY  G VFVQC GC  YHK
Sbjct  85   SQRNSDT-GAAIDIKLPRRSLMVTFTCNQCSERTKRLINRLAYERGLVFVQCAGCQKYHK  143

Query  558  LVDNLNL  578
            LVDNL L
Sbjct  144  LVDNLGL  150



>gb|KFK41298.1| hypothetical protein AALP_AA2G112200 [Arabis alpina]
Length=167

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = +3

Query  321  TTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPH  500
            T GSG+     P   + ++   QV+    S+  K PRR +LV F+C  CG+RT R IN H
Sbjct  72   TDGSGLN----PEEESKDSSEGQVA----SVDIKLPRRSLLVEFSCNSCGERTKRLINRH  123

Query  501  AYTDGTVFVQCCGCNIYHKLVDNLNL  578
            AY  G VFVQC GC  +HKLVDNL L
Sbjct  124  AYERGLVFVQCGGCLQHHKLVDNLGL  149



>ref|NP_001105159.1| zinc ribbon 1 [Zea mays]
 emb|CAD45040.1| zinc ribbon 1 [Zea mays]
 gb|ACN34374.1| unknown [Zea mays]
 gb|AFW69400.1| Zinc ribbon 1 [Zea mays]
Length=162

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC  CG+RT R IN  AY  GT+F+QC GC +YHK VDNL L
Sbjct  86   KLPRRSLLVQFTCNACGERTKRLINRVAYERGTIFLQCAGCQVYHKFVDNLGL  138



>ref|XP_010470865.1| PREDICTED: uncharacterized protein LOC104750723 [Camelina sativa]
Length=176

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 82/162 (51%), Gaps = 11/162 (7%)
 Frame = +3

Query  99   STTTAILSPSL-PIFSPLKSNRLSSKRI-LRFSASPRGNGNEPDLRSNSNDSSLVPILSQ  272
            + TTA  SP   PI+SP+  N   +K I +RFSAS      +P L      + +   + +
Sbjct  2    ANTTARWSPVFAPIYSPVSGN---TKPISVRFSAS----FYKPSLPLFKQQNPISTTVHR  54

Query  273  DAAMGLVLSAANVRGWTTGSGMEGP-SVPAGSNPETGMEQ-VSTFPWSLFTKSPRRRMLV  446
              A  ++   A  +       + G  S  A  NPE   +  V     S+ TK PRR + V
Sbjct  55   SRATRVIEVVAAPKQRNRSVSVFGSLSDDAKLNPEEESDDSVEGQVASVDTKLPRRSLQV  114

Query  447  AFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
             FTC  CG+RT R IN HAY  G VFVQC GC  +HKLVDNL
Sbjct  115  EFTCDSCGERTKRLINRHAYERGLVFVQCAGCLQHHKLVDNL  156



>ref|XP_002438978.1| hypothetical protein SORBIDRAFT_10g029320 [Sorghum bicolor]
 gb|EER90345.1| hypothetical protein SORBIDRAFT_10g029320 [Sorghum bicolor]
Length=164

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  390  VSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDN  569
            +S+   ++  K PRR +LV FTC  CG+RT R IN  AY  G++F+QC GC +YHK VDN
Sbjct  78   LSSTEATIDIKLPRRSLLVQFTCNACGERTKRLINRVAYERGSIFLQCAGCQVYHKFVDN  137

Query  570  LNL  578
            L L
Sbjct  138  LGL  140



>ref|XP_002888678.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64937.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=171

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            S+  K PRR +LV F+C  CG+RT R IN HAY +G VFVQC GC  +HKLVDNL L
Sbjct  97   SIDIKLPRRSLLVEFSCDSCGERTKRLINRHAYENGLVFVQCAGCLQHHKLVDNLGL  153



>ref|XP_009392908.1| PREDICTED: uncharacterized protein LOC103978730 [Musa acuminata 
subsp. malaccensis]
Length=159

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC +CG+RT R IN  AY  GT+F+QC GC +YHK VDNL L
Sbjct  85   KLPRRNLLVEFTCDLCGERTKRLINRVAYEKGTIFLQCAGCQVYHKFVDNLGL  137



>ref|XP_010511887.1| PREDICTED: uncharacterized protein LOC104787925 isoform X1 [Camelina 
sativa]
Length=176

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 80/162 (49%), Gaps = 11/162 (7%)
 Frame = +3

Query  99   STTTAILSPSL-PIFSPLKSNRLSSKRI-LRFSASPRGNGNEPDL--RSNSNDSSLVPIL  266
            + TTA  SP L PI+SP+  N   +K I +RFSAS      +P L      N  S     
Sbjct  2    ANTTARWSPVLAPIYSPVSGN---TKPISVRFSAS----FYKPSLPLFKQQNPISTTLHR  54

Query  267  SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLV  446
            S+ A +  V++A   R  +                E   + V     S+ TK PRR + +
Sbjct  55   SRAARVTEVVAAPKQRNRSFSIFASLTDDSKLKPEEESNDSVEGQVASVDTKLPRRSLQL  114

Query  447  AFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
             FTC  CG+RT R IN HAY  G VFVQC GC  YHKLVDNL
Sbjct  115  EFTCNSCGERTKRLINRHAYERGLVFVQCAGCLQYHKLVDNL  156



>gb|AFW81000.1| putative tify domain/CCT motif transcription factor family protein 
[Zea mays]
Length=253

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  363  SNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQ  530
             +P   M  V T PWSL TKSPR  M VAF C VCGQ TTRAINPHAYT+ TVFVQ
Sbjct  152  KSPRWHMRVVLTLPWSLLTKSPRWHMRVAFACSVCGQCTTRAINPHAYTNETVFVQ  207



>ref|XP_010066771.1| PREDICTED: uncharacterized protein LOC104453845 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64808.1| hypothetical protein EUGRSUZ_G02379 [Eucalyptus grandis]
Length=166

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 61/122 (50%), Gaps = 13/122 (11%)
 Frame = +3

Query  213  NEPDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQV  392
            +EP L S+    SL  +  +   +GL L   ++ G +       PS              
Sbjct  44   DEPALASSRLRVSLPTVGPRKRGLGLPLVLCSLEGQSETDQASPPSD-------------  90

Query  393  STFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            ST    L  + PRRR+LV FTC  CG+RT R +N  AY  G +FVQC GC  +HKLVDNL
Sbjct  91   STARLHLNLEHPRRRLLVQFTCNECGERTQRLVNKLAYERGLIFVQCAGCLRHHKLVDNL  150

Query  573  NL  578
             L
Sbjct  151  GL  152



>ref|XP_001777870.1| predicted protein [Physcomitrella patens]
 gb|EDQ57298.1| predicted protein [Physcomitrella patens]
Length=189

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR  L+ FTC VC  RT R INP A+  GTV+VQC GC  YH+LVDNLNL
Sbjct  120  PRRSALLEFTCNVCKARTQRMINPEAFRRGTVYVQCGGCQAYHQLVDNLNL  170



>ref|XP_006644344.1| PREDICTED: uncharacterized protein C24H6.02c-like [Oryza brachyantha]
Length=151

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL L
Sbjct  83   PRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCGGCQVYHKFVDNLGL  133



>ref|XP_008777543.1| PREDICTED: uncharacterized protein LOC103697463 isoform X2 [Phoenix 
dactylifera]
Length=179

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  105  PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  155



>ref|NP_177040.2| Zim17-type zinc finger protein [Arabidopsis thaliana]
 gb|AAD49972.1|AC008075_5 F24J5.3 [Arabidopsis thaliana]
 gb|AAG52044.1|AC011914_14 putative transcription factor; 86360-87167 [Arabidopsis thaliana]
 dbj|BAH30365.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34833.1| Zim17-type zinc finger protein [Arabidopsis thaliana]
Length=170

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            S+  K PRR + V FTC  CG+RT R IN HAY  G VFVQC GC  +HKLVDNL L
Sbjct  96   SIDIKLPRRSLQVEFTCNSCGERTKRLINRHAYEKGLVFVQCAGCLKHHKLVDNLGL  152



>ref|XP_008777542.1| PREDICTED: uncharacterized protein LOC103697463 isoform X1 [Phoenix 
dactylifera]
Length=180

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  105  PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  155



>ref|XP_010925225.1| PREDICTED: uncharacterized protein LOC105047826 isoform X1 [Elaeis 
guineensis]
Length=171

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  94   PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  144



>ref|XP_010925241.1| PREDICTED: uncharacterized protein LOC105047826 isoform X3 [Elaeis 
guineensis]
Length=169

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  94   PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  144



>ref|XP_010925233.1| PREDICTED: uncharacterized protein LOC105047826 isoform X2 [Elaeis 
guineensis]
Length=170

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  94   PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  144



>ref|XP_010925248.1| PREDICTED: uncharacterized protein LOC105047826 isoform X4 [Elaeis 
guineensis]
Length=168

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  94   PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  144



>ref|XP_004135125.1| PREDICTED: uncharacterized protein LOC101206910 [Cucumis sativus]
 gb|KGN52030.1| hypothetical protein Csa_5G608180 [Cucumis sativus]
Length=173

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 53/96 (55%), Gaps = 12/96 (13%)
 Frame = +3

Query  291  VLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCG  470
            VL+ +++    TG   E    P+  N +TG         ++  K PRR ++V FTC  C 
Sbjct  70   VLTVSSLVDGYTGDDDE----PSQRNSDTGA--------AIDIKLPRRSLMVTFTCNQCS  117

Query  471  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +RT R IN  AY  G VFVQC GC  YHKLVDNL L
Sbjct  118  ERTKRLINRLAYERGLVFVQCAGCQKYHKLVDNLGL  153



>ref|XP_002314899.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF01070.2| zinc finger family protein [Populus trichocarpa]
Length=169

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 51/90 (57%), Gaps = 4/90 (4%)
 Frame = +3

Query  312  RGWTTGSGM-EGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRA  488
            RG    SG+ +G S    + PE     ++    ++  K PRR +LV FTC  CG+R+ R 
Sbjct  64   RGLFVVSGLVDGNS---ETYPEVESNDLNEESATIDIKLPRRSLLVQFTCNECGERSQRL  120

Query  489  INPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            IN  AY  G VFVQC GC  YHKL DNL L
Sbjct  121  INRLAYERGLVFVQCAGCERYHKLADNLGL  150



>ref|XP_010681378.1| PREDICTED: DNL-type zinc finger protein isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=150

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  417  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            T+ PRR +LV FTC  CG+RT R IN  AY  GTVFVQC GC  +HKLVDNL L
Sbjct  84   TQLPRRSLLVQFTCDACGERTKRLINRLAYERGTVFVQCAGCLQHHKLVDNLGL  137



>ref|XP_010262339.1| PREDICTED: uncharacterized protein LOC104600883 isoform X1 [Nelumbo 
nucifera]
Length=165

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +3

Query  372  ETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIY  551
            E  ++  S    ++  K PRR +LV FTC  CG+R+ R +N  AY  GTVFVQC GC  +
Sbjct  78   ENYIDDTSLREPTIDIKLPRRSLLVQFTCNACGERSQRLVNRLAYERGTVFVQCAGCLQH  137

Query  552  HKLVDNLNL  578
            HKLVDNL L
Sbjct  138  HKLVDNLGL  146



>ref|XP_005652036.1| zf-DNL-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27492.1| zf-DNL-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=208

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  417  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
             K+PRR   V FTC +CG+ TT+ +NPHA+ +GTVF +C GC + HKL+DNL L
Sbjct  109  NKNPRRTRKVQFTCNLCGETTTKRVNPHAWENGTVFAECSGCRVKHKLIDNLKL  162



>ref|XP_011008859.1| PREDICTED: mitochondrial protein import protein ZIM17 [Populus 
euphratica]
Length=171

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +3

Query  369  PETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNI  548
            PE     ++    ++  K PRR +LV FTC  CG+R+ R IN  AY  G VFVQC GC  
Sbjct  83   PEVESNDLNEESATIDIKLPRRSLLVQFTCNECGERSQRLINRLAYERGLVFVQCAGCER  142

Query  549  YHKLVDNLNL  578
            YHKL DNL L
Sbjct  143  YHKLADNLGL  152



>gb|EPS62111.1| hypothetical protein M569_12682, partial [Genlisea aurea]
Length=70

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV+FTC  CG R+ R IN  AY  G V+VQC GC+ YHKLVDNL L
Sbjct  7    KFPRRNLLVSFTCNACGARSQRLINRLAYERGLVYVQCSGCSRYHKLVDNLGL  59



>ref|XP_003518825.1| PREDICTED: DNL-type zinc finger protein-like [Glycine max]
 gb|KHN07723.1| DNL-type zinc finger protein [Glycine soja]
Length=161

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 47/82 (57%), Gaps = 3/82 (4%)
 Frame = +3

Query  333  GMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTD  512
            G+ G        PET   +  T   S+    PRR +LV FTC +CG+RT R +N  AY  
Sbjct  64   GLLGHDSGTAPQPETPNSEAGT---SIDLNLPRRSLLVQFTCNLCGERTERLVNRLAYER  120

Query  513  GTVFVQCCGCNIYHKLVDNLNL  578
            G VFVQC GC  +HKLVDNL L
Sbjct  121  GAVFVQCAGCLQHHKLVDNLGL  142



>ref|XP_002280593.1| PREDICTED: mitochondrial protein import protein ZIM17 [Vitis 
vinifera]
 emb|CBI27106.3| unnamed protein product [Vitis vinifera]
Length=173

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            S+  K PRR ++V FTC  CG+RT R IN  A+  GTVFVQC GC  +HKLVDNL L
Sbjct  98   SIDIKLPRRSLIVQFTCDACGERTERLINRLAFERGTVFVQCAGCLQHHKLVDNLGL  154



>gb|KJB50817.1| hypothetical protein B456_008G188300 [Gossypium raimondii]
Length=148

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  417  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            TK PRR +LV FTC  CG+RT R IN  AY  G V+VQC GC  YHKL DNL L
Sbjct  85   TKLPRRSLLVQFTCGECGERTERLINRLAYERGLVYVQCAGCLQYHKLADNLGL  138



>ref|XP_009356516.1| PREDICTED: uncharacterized protein LOC103947335 [Pyrus x bretschneideri]
 ref|XP_009356525.1| PREDICTED: uncharacterized protein LOC103947342 [Pyrus x bretschneideri]
Length=177

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKLVDNL L
Sbjct  108  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLVDNLGL  158



>ref|XP_008360068.1| PREDICTED: uncharacterized protein LOC103423766 [Malus domestica]
 ref|XP_008360187.1| PREDICTED: uncharacterized protein LOC103423888 [Malus domestica]
Length=177

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKLVDNL L
Sbjct  108  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLVDNLGL  158



>ref|XP_010425752.1| PREDICTED: uncharacterized protein LOC104710796 [Camelina sativa]
 ref|XP_010425753.1| PREDICTED: uncharacterized protein LOC104710796 [Camelina sativa]
 ref|XP_010425754.1| PREDICTED: uncharacterized protein LOC104710796 [Camelina sativa]
Length=177

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  417  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
             K PRR + V FTC +CG+RT R IN HA+  G VFVQC GC  YHKL DNL +
Sbjct  106  IKLPRRSLQVEFTCNLCGERTKRLINRHAHERGLVFVQCAGCLQYHKLFDNLGV  159



>ref|XP_011070860.1| PREDICTED: DNL-type zinc finger protein isoform X2 [Sesamum indicum]
Length=128

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  330  SGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYT  509
            S +   S       E  + + S    ++  K PRR +LV FTC  CG R+ R IN  AY 
Sbjct  27   SSLLEDSYEEYQETEQSVSKNSQQEAAIDLKLPRRSLLVTFTCGACGVRSQRLINRLAYE  86

Query  510  DGTVFVQCCGCNIYHKLVDNLNL  578
             G V+VQC GC+ YHKLVDNL L
Sbjct  87   RGLVYVQCSGCSKYHKLVDNLGL  109



>ref|XP_007153312.1| hypothetical protein PHAVU_003G024500g [Phaseolus vulgaris]
 gb|ESW25306.1| hypothetical protein PHAVU_003G024500g [Phaseolus vulgaris]
Length=155

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 52/101 (51%), Gaps = 9/101 (9%)
 Frame = +3

Query  276  AAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFT  455
            AA  L      V G   G   E    P   N E G    +T   +L    PRR +LV FT
Sbjct  45   AAPSLARRVFRVHGLI-GDDSETAPEPESPNSEAG----ATIDLNL----PRRSLLVQFT  95

Query  456  CKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            C VCG+RT R +N  AY  G VFVQC GC  +HKLVDNL L
Sbjct  96   CGVCGERTKRLVNRLAYERGAVFVQCAGCLRHHKLVDNLGL  136



>ref|XP_009614441.1| PREDICTED: uncharacterized protein C24H6.02c [Nicotiana tomentosiformis]
Length=173

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC  CG R+ R IN  AY  GTVF+QC GC+ YHK VDNL L
Sbjct  102  KLPRRSLLVTFTCNACGVRSQRFINRLAYERGTVFIQCSGCSQYHKFVDNLGL  154



>ref|XP_003569318.1| PREDICTED: uncharacterized protein C24H6.02c-like [Brachypodium 
distachyon]
 ref|XP_010231998.1| PREDICTED: uncharacterized protein C24H6.02c-like [Brachypodium 
distachyon]
 ref|XP_010231999.1| PREDICTED: uncharacterized protein C24H6.02c-like [Brachypodium 
distachyon]
Length=148

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC  C  RT R IN  AY  GTVF+QC GC +YHK VDNL L
Sbjct  78   KLPRRSLLVQFTCNKCDARTNRLINRVAYERGTVFLQCAGCQVYHKFVDNLGL  130



>ref|XP_009791194.1| PREDICTED: uncharacterized protein C24H6.02c [Nicotiana sylvestris]
Length=178

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC  CG R+ R IN  AY  GTVF+QC GC+ YHK VDNL L
Sbjct  107  KLPRRSLLVTFTCNACGVRSQRLINRLAYERGTVFIQCSGCSQYHKFVDNLGL  159



>gb|KEH29577.1| DNL zinc finger protein [Medicago truncatula]
Length=158

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR +LV FTC +CG+RT R +N  AY  G VFVQC GC  +HKLVDNL L
Sbjct  89   PRRSLLVQFTCDLCGERTERLVNRLAYERGAVFVQCAGCQRHHKLVDNLGL  139



>ref|XP_006391103.1| hypothetical protein EUTSA_v10019239mg [Eutrema salsugineum]
 gb|ESQ28389.1| hypothetical protein EUTSA_v10019239mg [Eutrema salsugineum]
Length=166

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +3

Query  357  AGSNPET-GMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQC  533
            +G NPE    +       S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC
Sbjct  74   SGLNPEEESKDSAEGQVASIDIKLPRRSLLVEFSCNSCGERTKRLINRLAYERGLVFVQC  133

Query  534  CGCNIYHKLVDNLNL  578
             GC  +HKLVDNL L
Sbjct  134  AGCLRHHKLVDNLGL  148



>ref|XP_006348591.1| PREDICTED: uncharacterized protein C24H6.02c-like [Solanum tuberosum]
Length=177

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +L  FTC  CG R+ R IN  AY  GTVF+QC GC+ YHKLVDNL L
Sbjct  106  KLPRRSLLATFTCNACGARSQRLINRLAYERGTVFIQCSGCSQYHKLVDNLGL  158



>ref|XP_004238981.1| PREDICTED: uncharacterized protein C24H6.02c [Solanum lycopersicum]
Length=177

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +L  FTC  CG R+ R IN  AY  GTVF+QC GC+ YHKLVDNL L
Sbjct  106  KLPRRSLLATFTCNACGARSQRLINRLAYERGTVFIQCSGCSQYHKLVDNLGL  158



>ref|XP_008246043.1| PREDICTED: mitochondrial protein import protein ZIM17-like [Prunus 
mume]
Length=182

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = +3

Query  366  NPETGMEQVSTFP---WSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCC  536
            N ET  E     P    ++  K PRR +LV FTC +CG+RT R +N  AY  G ++VQC 
Sbjct  90   NFETDGELEQNIPNTDATIDIKIPRRSLLVKFTCDLCGERTDRLVNRLAYERGLIYVQCA  149

Query  537  GCNIYHKLVDNLNL  578
            GC  +HKLVDNL L
Sbjct  150  GCLKHHKLVDNLGL  163



>ref|XP_008339721.1| PREDICTED: uncharacterized protein LOC103402741 [Malus domestica]
Length=176

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKL DNL L
Sbjct  107  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLADNLGL  157



>ref|XP_009355956.1| PREDICTED: uncharacterized protein LOC103946868 [Pyrus x bretschneideri]
Length=176

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKL DNL L
Sbjct  107  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLADNLGL  157



>ref|XP_010523289.1| PREDICTED: DNL-type zinc finger protein [Tarenaya hassleriana]
Length=170

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 47/79 (59%), Gaps = 9/79 (11%)
 Frame = +3

Query  357  AGSNPETGME-----QVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTV  521
            +G NPE   E     Q+++    L    PRR +LV FTC  CG+RT R +N  AY  G V
Sbjct  78   SGPNPEEESEDPKEGQIASTDIKL----PRRSLLVQFTCNSCGERTNRLVNRLAYERGLV  133

Query  522  FVQCCGCNIYHKLVDNLNL  578
            FVQC GC  +HKLVDNL L
Sbjct  134  FVQCGGCLRHHKLVDNLGL  152



>emb|CDM83104.1| unnamed protein product [Triticum aestivum]
Length=153

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC  C  RT R IN  AY  GTVF+QC GC +YHK VDNL L
Sbjct  83   KLPRRSLLVQFTCNKCDARTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGL  135



>ref|XP_008361865.1| PREDICTED: uncharacterized protein LOC103425553 [Malus domestica]
Length=199

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKL DNL L
Sbjct  130  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLADNLGL  180



>gb|KHG19418.1| DNL-type zinc finger [Gossypium arboreum]
Length=149

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC  CG+RT R IN  AY  G V+VQC GC  YHKL DNL L
Sbjct  87   KLPRRSLLVQFTCGECGERTERLINRLAYERGLVYVQCAGCLQYHKLADNLGL  139



>ref|NP_001239683.1| uncharacterized protein LOC100786955 [Glycine max]
 gb|ACU19834.1| unknown [Glycine max]
 gb|KHM98964.1| DNL-type zinc finger protein [Glycine soja]
Length=159

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR +LV FTC +CG+RT R +N  AY  G VFVQC GC  +HKLVDNL L
Sbjct  90   PRRSLLVQFTCNLCGERTKRLVNRLAYERGAVFVQCAGCLRHHKLVDNLGL  140



>ref|XP_004505313.1| PREDICTED: mitochondrial protein import protein ZIM17-like isoform 
X1 [Cicer arietinum]
 ref|XP_004505314.1| PREDICTED: mitochondrial protein import protein ZIM17-like isoform 
X2 [Cicer arietinum]
 ref|XP_004505315.1| PREDICTED: mitochondrial protein import protein ZIM17-like isoform 
X3 [Cicer arietinum]
Length=157

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR +LV FTC +CG+RT + +N  AY  GT+F+QC GC  +HKLVDNL L
Sbjct  86   PRRSLLVQFTCDLCGERTKKLVNRLAYERGTIFIQCAGCKRHHKLVDNLGL  136



>ref|XP_010096705.1| DNL-type zinc finger protein [Morus notabilis]
 gb|EXB65557.1| DNL-type zinc finger protein [Morus notabilis]
Length=173

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  +HKLVDNL L
Sbjct  102  KLPRRSLLVQFTCDLCGERTQRLVNRLAYERGLIYVQCAGCLQHHKLVDNLGL  154



>ref|XP_011070859.1| PREDICTED: uncharacterized protein LOC105156436 isoform X1 [Sesamum 
indicum]
Length=188

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  372  ETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIY  551
            E  + + S    ++  K PRR +LV FTC  CG R+ R IN  AY  G V+VQC GC+ Y
Sbjct  101  EQSVSKNSQQEAAIDLKLPRRSLLVTFTCGACGVRSQRLINRLAYERGLVYVQCSGCSKY  160

Query  552  HKLVDNLNL  578
            HKLVDNL L
Sbjct  161  HKLVDNLGL  169



>ref|XP_010227814.1| PREDICTED: DNL-type zinc finger protein-like [Brachypodium distachyon]
Length=148

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC  C  RT R IN  A+  GTVF+QC GC +YHK VDNL L
Sbjct  78   KLPRRSLLVQFTCNKCDARTKRLINRVAHERGTVFLQCAGCQVYHKFVDNLGL  130



>ref|XP_006858707.1| hypothetical protein AMTR_s00066p00105400 [Amborella trichopoda]
 gb|ERN20174.1| hypothetical protein AMTR_s00066p00105400 [Amborella trichopoda]
Length=186

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR ++V FTC  CG R+ R IN  AY  GTVF+QC GC  YHK VDNL L
Sbjct  119  PRRSLMVQFTCDACGVRSQRIINRVAYERGTVFLQCSGCEQYHKFVDNLGL  169



>gb|EMT29434.1| hypothetical protein F775_05239 [Aegilops tauschii]
Length=149

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +3

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            S   K PRR +LV FTC  C  RT R IN   Y  GTVF+QC GC +YHK VDNL L
Sbjct  75   SFDIKLPRRSLLVQFTCNKCDARTKRLINRVGYERGTVFLQCAGCQVYHKFVDNLGL  131



>ref|XP_006437770.1| hypothetical protein CICLE_v10032948mg [Citrus clementina]
 ref|XP_006484383.1| PREDICTED: mitochondrial protein import protein ZIM17-like [Citrus 
sinensis]
 gb|ESR51010.1| hypothetical protein CICLE_v10032948mg [Citrus clementina]
 gb|KDO70144.1| hypothetical protein CISIN_1g031397mg [Citrus sinensis]
Length=160

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +3

Query  363  SNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGC  542
            SN E  +   S    ++  K PRR +LV FTC  CG+RT R IN  AY  G V+VQC GC
Sbjct  71   SNSEAELSD-SNKDATIDIKLPRRSLLVQFTCDGCGERTQRLINRLAYERGLVYVQCAGC  129

Query  543  NIYHKLVDNLNL  578
              +HKLVDNL L
Sbjct  130  LRHHKLVDNLGL  141



>dbj|BAJ89579.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=158

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC  C  RT R IN  AY  GTVF+QC GC +YHK VDNL L
Sbjct  88   KLPRRSLLVQFTCNKCDARTERLINRVAYERGTVFLQCAGCQVYHKFVDNLGL  140



>emb|CDP00540.1| unnamed protein product [Coffea canephora]
Length=174

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K PRR +LV FTC +CG R+ + +N  AY  GTVFVQC GC  +HKLVDNL L
Sbjct  103  KLPRRSLLVKFTCNLCGSRSEKLVNRLAYERGTVFVQCSGCRQHHKLVDNLGL  155



>ref|XP_007046358.1| Zim17-type zinc finger protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY02190.1| Zim17-type zinc finger protein, putative isoform 1 [Theobroma 
cacao]
Length=143

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +3

Query  366  NPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCN  545
            +P   M+  S    ++  K PRR +LV FTC  CG+RT R IN  AY  G V+VQC GC 
Sbjct  64   DPHENMKN-SNSDATIDIKLPRRSLLVQFTCGECGERTERLINRLAYERGLVYVQCAGCL  122

Query  546  IYHKLVDNLNL  578
             YHKL DNL L
Sbjct  123  QYHKLADNLGL  133



>ref|XP_007223547.1| hypothetical protein PRUPE_ppa012145mg [Prunus persica]
 gb|EMJ24746.1| hypothetical protein PRUPE_ppa012145mg [Prunus persica]
Length=182

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  +HKLVDNL L
Sbjct  113  PRRSLLVKFTCDLCGERTDRLVNRLAYERGLIYVQCAGCLKHHKLVDNLGL  163



>emb|CDX95993.1| BnaA07g27380D [Brassica napus]
Length=165

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 79/163 (48%), Gaps = 21/163 (13%)
 Frame = +3

Query  99   STTTAILSP-SLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVPILSQD  275
            + T A LSP S PI+SP+  NR   K I         N ++P L S   ++ +  +  + 
Sbjct  2    ANTVAGLSPVSAPIYSPITFNR---KPI---------NFHKPHLLSYKQNNPVSALQHRS  49

Query  276  AAMGLVLSAANVRGWTTGSGMEGPSVPAGS--NPETGMEQVSTFPWSLFTKSPRRRMLVA  449
              + +V   A  R     S   G      S  NPE    QV++    L    PRR + V 
Sbjct  50   RTVRVVEEGARKRRKRLFSVF-GSLTDDDSELNPEEEG-QVASVDIKL----PRRSLQVE  103

Query  450  FTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            F+C  CG+RT R IN  AY  G VFVQC GC  +HKLVDNL L
Sbjct  104  FSCNSCGERTKRLINRLAYERGLVFVQCGGCLKHHKLVDNLGL  146



>ref|XP_004297161.1| PREDICTED: uncharacterized protein LOC101312048 [Fragaria vesca 
subsp. vesca]
Length=166

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            PRR +LV FTC +C +RT++ +N  AY  G ++VQC GC  YHKLVDNL L
Sbjct  97   PRRSLLVKFTCDLCNERTSKLVNRLAYEKGLIYVQCAGCLKYHKLVDNLGL  147



>ref|XP_009127663.1| PREDICTED: uncharacterized protein LOC103852518 isoform X1 [Brassica 
rapa]
Length=160

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC GC  +H+LVDNL L
Sbjct  85   SVDIKLPRRSLLVEFSCNSCGERTKRLINQLAYERGLVFVQCGGCLQHHQLVDNLGL  141



>ref|XP_009127664.1| PREDICTED: uncharacterized protein LOC103852518 isoform X2 [Brassica 
rapa]
Length=158

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC GC  +H+LVDNL L
Sbjct  83   SVDIKLPRRSLLVEFSCNSCGERTKRLINQLAYERGLVFVQCGGCLQHHQLVDNLGL  139



>emb|CDY54500.1| BnaA02g35640D [Brassica napus]
Length=164

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC GC  +H+LVDNL L
Sbjct  89   SVDIKLPRRSLLVEFSCNSCGERTKRLINRLAYERGLVFVQCGGCLQHHQLVDNLGL  145



>emb|CDX81538.1| BnaC02g18420D [Brassica napus]
Length=164

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC GC  +H+LVDNL L
Sbjct  89   SVDIKLPRRSLLVEFSCNSCGERTKRLINRLAYERGLVFVQCGGCLQHHQLVDNLGL  145



>ref|XP_009105422.1| PREDICTED: mitochondrial protein import protein ZIM17-like [Brassica 
rapa]
Length=165

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 79/165 (48%), Gaps = 25/165 (15%)
 Frame = +3

Query  99   STTTAILSP-SLPIFSPLKSNRLSSKRILRFSASPRGNGNEPDLRSNSNDSSLVPILSQD  275
            + T A LSP S PI+SP+  NR   K I         N ++P L S   ++ +  +  + 
Sbjct  2    ANTVAGLSPVSAPIYSPITFNR---KPI---------NFHKPHLLSYKQNNPVSALQHRS  49

Query  276  AAMGLVLSAANVRGW----TTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRML  443
              + +V   A  R        GS  +  S     NPE    QV++    L    PRR + 
Sbjct  50   RTVRVVEEGARKRRKRLFSVFGSLTDDDS---ELNPEEEG-QVASVDIKL----PRRSLQ  101

Query  444  VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            V F+C  CG RT R IN  AY  G VFVQC GC  +HKLVDNL L
Sbjct  102  VEFSCNSCGVRTKRLINRLAYERGLVFVQCGGCLKHHKLVDNLGL  146



>emb|CDY38613.1| BnaC06g30360D [Brassica napus]
Length=164

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  408  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            S+  K PRR + V F+C  CG+RT R IN  AY  G VFVQC GC  +HKLVDNL L
Sbjct  89   SVDIKLPRRSLQVEFSCNSCGERTKRLINRLAYERGLVFVQCGGCLKHHKLVDNLGL  145



>ref|XP_003063279.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52415.1| predicted protein [Micromonas pusilla CCMP1545]
Length=209

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            P+RR  + FTC  C  R+T+ +NP AY  GT+FVQC  C ++HK+VDNL +
Sbjct  109  PKRRAQLTFTCDKCEARSTKMVNPDAYKRGTMFVQCPNCEVWHKIVDNLGM  159



>emb|CDY28109.1| BnaC06g02900D [Brassica napus]
 emb|CDY08090.1| BnaA06g16360D [Brassica napus]
Length=65

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +3

Query  420  KSPRRRML-VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            K PRRR L V F+C  CG+RT R IN  AY  G VFVQC GC  +HKLVDNL
Sbjct  11   KLPRRRSLQVEFSCNSCGERTKRLINRLAYERGIVFVQCGGCLKHHKLVDNL  62



>ref|XP_005847953.1| hypothetical protein CHLNCDRAFT_52093 [Chlorella variabilis]
 gb|EFN55851.1| hypothetical protein CHLNCDRAFT_52093 [Chlorella variabilis]
Length=288

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  417  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +K PRR   + FTC +CG+    A+NPHA+  G+VF +C GC   HKL DNLN+
Sbjct  202  SKHPRRTQQLRFTCNLCGEVNDAAVNPHAWKAGSVFARCQGCTAVHKLKDNLNI  255



>ref|XP_005844772.1| hypothetical protein CHLNCDRAFT_138626 [Chlorella variabilis]
 gb|EFN52670.1| hypothetical protein CHLNCDRAFT_138626 [Chlorella variabilis]
Length=152

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 52/100 (52%), Gaps = 12/100 (12%)
 Frame = +3

Query  288  LVLSAANVRGWTTGSGMEGPSVP---AGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTC  458
            L+LS+++  G +T SG  G S     AGS    G+        S+    PRR +LV FTC
Sbjct  50   LLLSSSDEPG-STSSGYSGDSEDGSLAGSADGDGV--------SIDLHLPRRSLLVKFTC  100

Query  459  KVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
             +C  R+ R +NP A+  G V  QC  C  +HKL D  NL
Sbjct  101  NLCSGRSERLVNPVAWNKGMVIAQCQHCQAWHKLADAANL  140



>dbj|BAJ23062.1| hypothetical protein [Pseudocentrotus depressus]
Length=196

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  435  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
            ++ +AFTCKVCG RT R+I+ HAY  G V V+C GC+  H + DNL+
Sbjct  102  KLHLAFTCKVCGMRTARSISKHAYEKGVVIVKCSGCDNNHLIADNLD  148



>gb|EXX72907.1| Zim17p [Rhizophagus irregularis DAOM 197198w]
Length=212

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  426  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            P  R+++AFTCKVC  R+T+ ++ HAY  G V +QC  CN +H + D+L
Sbjct  89   PNTRLMIAFTCKVCSLRSTKTMSKHAYNHGVVIIQCSSCNNHHLIADHL  137



>ref|XP_001421744.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00038.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=181

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            RRR+ + FTC  C  RT R INP     GT++VQC  C ++H++VDNL L
Sbjct  104  RRRVQMTFTCNKCEGRTMRMINPEVLERGTMWVQCGECEVWHQIVDNLGL  153



>ref|XP_011397348.1| Fructose-1-phosphate phosphatase YqaB [Auxenochlorella protothecoides]
 gb|KFM24460.1| Fructose-1-phosphate phosphatase YqaB [Auxenochlorella protothecoides]
Length=326

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  417  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            T   RR   V FTC +CG + T+ +NPHA+  G+VF +C GC   HKL DNL +
Sbjct  236  TNHARRTRKVRFTCNLCGTQNTKRVNPHAWHAGSVFARCAGCQGVHKLQDNLEV  289



>emb|CDY36477.1| BnaC03g48360D [Brassica napus]
Length=133

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +3

Query  408  SLFTKSPRRRML-VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            S+  K PRRR L V F+   CG RT R IN  AY  G VFVQC GC  +HKLVDNL
Sbjct  75   SVDIKLPRRRSLQVEFSYNSCGDRTKRLINRLAYECGLVFVQCGGCLKHHKLVDNL  130



>emb|CDX97891.1| BnaC04g40480D [Brassica napus]
Length=66

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = +3

Query  420  KSPRRRML-VAFTCKVCGQR-TTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            K PRRR L V F+C  CG+R T R IN  AY  G VFVQC GC  +HKLV+NL
Sbjct  11   KLPRRRSLQVEFSCNSCGERRTKRLINRLAYERGLVFVQCGGCLKHHKLVENL  63



>dbj|GAN02263.1| conserved hypothetical protein [Mucor ambiguus]
Length=199

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  423  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            S + +ML+ FTCKVC +R+   ++ H+YT G V +QC GC   H + DNL
Sbjct  76   SKQHQMLIGFTCKVCNERSHHTMSKHSYTKGVVLIQCPGCKNRHLIADNL  125



>ref|XP_003083615.1| ETCHED1 protein (ISS) [Ostreococcus tauri]
 emb|CAL58164.1| Mitochondrial import protein TIM15 [Ostreococcus tauri]
Length=184

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            RRR+ + FTC  C  RT R INP     GT++VQC  C ++H++VDNL L
Sbjct  107  RRRVQMTFTCNKCEGRTMRMINPDVLERGTMWVQCGECEVWHQIVDNLGL  156



>gb|KHJ41186.1| ribosomal protein S15 [Trichuris suis]
Length=290

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  402  PWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            P +L T +   +ML+A+TCKVCG R ++ I+   Y +G V VQC GC  YH + DNL
Sbjct  35   PQALGTIASSGKMLLAYTCKVCGSRQSKLISKVGYREGVVLVQCSGCANYHIIADNL  91



>emb|CEG63113.1| Putative Zf-DNL-domain-containing protein [Rhizopus microsporus]
Length=192

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            K+ +R+ML+ FTCKVC +R+   ++  AYT G V +QC GC   H + DNL
Sbjct  73   KATKRQMLIGFTCKVCEERSHHVMSKLAYTKGVVLIQCPGCKNRHLIADNL  123



>gb|EPB86614.1| hypothetical protein HMPREF1544_06590 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=176

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            + +ML+ FTCKVC +R+   ++ H+YT G V +QC GC   H + DNL
Sbjct  55   KHQMLIGFTCKVCNERSHHTMSKHSYTKGVVLIQCPGCKNRHLIADNL  102



>emb|CEI97298.1| Putative Zf-DNL-domain-containing protein [Rhizopus microsporus]
Length=192

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            K+ +R+ML+ FTCKVC +R+   ++  AYT G V +QC GC   H + DNL
Sbjct  73   KATKRQMLIGFTCKVCEERSHHVMSKLAYTKGVVLIQCPGCKNRHLIADNL  123



>emb|CCK72609.1| hypothetical protein KNAG_0K02460 [Kazachstania naganishii CBS 
8797]
Length=176

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +3

Query  330  SGMEGPSVPAGSN-PETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAY  506
            +G + P+V + SN P    ++ S  P S      + ++++AFTCK C  R++  I+  AY
Sbjct  39   NGPDKPAVTSRSNTPAAADKKGSVGPSSAKLAMDKPQLMIAFTCKKCDTRSSHTISKQAY  98

Query  507  TDGTVFVQCCGCNIYHKLVDNLNL  578
            T GTV +QC GC   H + D+L +
Sbjct  99   TGGTVLIQCPGCQNRHLIADHLKI  122



>emb|CEG80750.1| hypothetical protein RMATCC62417_15046 [Rhizopus microsporus]
Length=181

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            K+ +R+ML+ FTCKVC +R+   ++  AYT G V +QC GC   H + DNL
Sbjct  73   KATKRQMLIGFTCKVCEERSHHVMSKLAYTKGVVLIQCPGCKNRHLIADNL  123



>emb|CEI95525.1| Putative Piso0_002320 protein [Rhizopus microsporus]
Length=192

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            K+ +R+ML+ FTCKVC +R+   ++  AYT G V +QC GC   H + DNL
Sbjct  73   KATKRQMLIGFTCKVCEERSHHVMSKLAYTKGVVLIQCPGCKNRHLIADNL  123



>ref|XP_003725494.1| PREDICTED: DNL-type zinc finger protein-like [Strongylocentrotus 
purpuratus]
Length=196

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  435  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
            ++ +AFTCKVCG RT R+I+  AY  G V V+C GC   H + DNL+
Sbjct  102  KLHLAFTCKVCGMRTARSISKQAYEKGVVIVKCGGCENNHLIADNLD  148



>emb|CDW52158.1| Coq4 and Ribosomal S13 N and Ribosomal S15 and zf-DNL domain 
containing protein [Trichuris trichiura]
Length=488

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 8/62 (13%)
 Frame = +3

Query  414  FTKSPRR--------RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDN  569
            F  SP+R        +ML+A+TCKVCG R ++ I+   Y  G V VQC GC  YH + DN
Sbjct  31   FCSSPQRVGTIASSGKMLLAYTCKVCGSRQSKLISKVGYHQGVVLVQCSGCANYHIIADN  90

Query  570  LN  575
            L 
Sbjct  91   LG  92



>gb|AFW71389.1| hypothetical protein ZEAMMB73_297185 [Zea mays]
Length=438

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  435  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQ  530
             M VAF C VCGQRTTRAINPHAYT+ TVFVQ
Sbjct  149  HMRVAFACSVCGQRTTRAINPHAYTNETVFVQ  180



>emb|CEP08401.1| hypothetical protein [Parasitella parasitica]
Length=192

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            + +ML+ FTCKVC +R+   ++ H+YT G V +QC GC   H + DNL
Sbjct  72   QHQMLIGFTCKVCNERSHHTMSKHSYTKGVVLIQCPGCKNRHLIADNL  119



>ref|XP_001691699.1| Hsp70 escorting protein 2 [Chlamydomonas reinhardtii]
 gb|ABS84949.1| HSP70 escort protein [Chlamydomonas reinhardtii]
 gb|EDP04807.1| Hsp70 escorting protein 2 [Chlamydomonas reinhardtii]
Length=205

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 0/62 (0%)
 Frame = +3

Query  384  EQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLV  563
            ++V   P S      RR  LV FTC  CG R+ R +NP A+  G VF QC  C+++H L 
Sbjct  99   KKVVRIPLSAMGDGARRSKLVLFTCNKCGGRSARLVNPVAWEKGVVFGQCSKCSVWHVLQ  158

Query  564  DN  569
             N
Sbjct  159  AN  160



>ref|XP_004346924.1| hypothetical protein CAOG_05239 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94619.1| hypothetical protein CAOG_005239 [Capsaspora owczarzaki ATCC 
30864]
Length=243

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  435  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
            R L+AFTCK C  R ++ I+ H+Y  G V ++C GC   H + DNLN
Sbjct  145  RFLIAFTCKPCSHRNSKTISKHSYQKGVVLIRCDGCKQIHLIADNLN  191



>ref|XP_008191756.1| PREDICTED: DNL-type zinc finger protein-like [Tribolium castaneum]
 gb|EFA01426.1| hypothetical protein TcasGA2_TC030565 [Tribolium castaneum]
Length=160

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  435  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
            ++++ FTCKVC  R T+ I+  AY  G V V+C GCN  H + DNLN
Sbjct  72   KLMLGFTCKVCSARNTKFISKVAYQKGVVIVKCSGCNNNHLIADNLN  118



>gb|ABK24010.1| unknown [Picea sitchensis]
Length=213

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 40/78 (51%), Gaps = 0/78 (0%)
 Frame = +3

Query  339  EGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGT  518
            EG S    S P    + V    +S    S R  + +A+TC+VC  R+ + +N  +Y  G 
Sbjct  95   EGVSAMEISKPNAKNDSVEFTAFSNLNASKRHNLAMAYTCRVCETRSVKTMNRESYEKGV  154

Query  519  VFVQCCGCNIYHKLVDNL  572
            V V+C GCN  H + D+L
Sbjct  155  VIVRCSGCNNLHLIADHL  172



>emb|CDH58781.1| hypothetical protein RO3G_11646 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=187

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  423  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
             P+++ML+ FTC+VC +R+   ++  AYT G V ++C GC   H + DNL
Sbjct  65   DPKQQMLIGFTCEVCKERSHHVMSKLAYTKGVVLIECPGCKNRHLIADNL  114



>emb|CDS07381.1| hypothetical protein LRAMOSA01330 [Absidia idahoensis var. thermophila]
Length=186

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  423  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
             P+++ML+ FTC+VC +R+   ++  AYT G V ++C GC   H + DNL
Sbjct  64   DPKQQMLIGFTCEVCKERSHHVMSKLAYTKGVVLIECPGCKNRHLIADNL  113



>ref|XP_001992524.1| GH24157 [Drosophila grimshawi]
 gb|EDV92231.1| GH24157 [Drosophila grimshawi]
Length=181

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +RRM + + CK+C  R T+ I+  AY  G V +QC GC + H + DNL L
Sbjct  102  QRRMEIVYMCKLCNTRNTKTISEEAYYSGVVILQCDGCAVQHLIKDNLGL  151



>emb|CEP62412.1| LALA0S05e05072g1_1 [Lachancea lanzarotensis]
Length=183

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K+ +  M++AFTCK C  R++  ++  AYT GTV +QC GC   H + D+L +
Sbjct  60   KTDKPAMMIAFTCKKCNTRSSHTMSKQAYTGGTVLIQCPGCKSRHLIADHLKI  112



>emb|CCC46977.1| conserved hypothetical protein [Trypanosoma vivax Y486]
Length=184

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 27/46 (59%), Gaps = 0/46 (0%)
 Frame = +3

Query  438  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
            M+ AFTC  C  RT +  + HAYT G V VQC  C + H L DNL 
Sbjct  105  MVAAFTCGRCDHRTVKKFSKHAYTKGIVIVQCPSCEVRHLLADNLG  150



>ref|NP_081104.1| DNL-type zinc finger protein isoform 1 [Mus musculus]
 sp|Q9D113.1|DNLZ_MOUSE RecName: Full=DNL-type zinc finger protein; AltName: Full=Hsp70-escort 
protein 1; Short=HEP1; AltName: Full=mtHsp70-escort 
protein; Flags: Precursor [Mus musculus]
 dbj|BAB23162.1| unnamed protein product [Mus musculus]
 dbj|BAE24931.1| unnamed protein product [Mus musculus]
 gb|AAI39335.1| DNA segment, Chr 2, Brigham & Women's Genetics 1335 expressed 
[Mus musculus]
 gb|AAI39334.1| D2Bwg1335e protein [Mus musculus]
Length=177

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 45/95 (47%), Gaps = 13/95 (14%)
 Frame = +3

Query  297  SAANVRGWTTG--SGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCG  470
            +A  +RGW  G  SG    S   GS     + +V    + L            +TCKVCG
Sbjct  35   TAERLRGWAWGWASGWRSSSSAPGSGRAAALGRVEADHYQLV-----------YTCKVCG  83

Query  471  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
             R+++ I+  AY  G V V C GC  +H + DNL+
Sbjct  84   TRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLS  118



>gb|EIE86935.1| hypothetical protein RO3G_11646 [Rhizopus delemar RA 99-880]
Length=188

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            +  +R+ML+ FTCKVC +R+   ++  AYT G V +QC  C   H + DNL
Sbjct  67   QESKRQMLIGFTCKVCEERSHHVMSRLAYTKGVVLIQCPSCKNRHLIADNL  117



>ref|XP_002495780.1| ZYRO0C02882p [Zygosaccharomyces rouxii]
 emb|CAR26847.1| ZYRO0C02882p [Zygosaccharomyces rouxii]
Length=152

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  438  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            M++AFTCK C  R++  ++  AYT GTV +QC  C + H + D+L +
Sbjct  55   MMIAFTCKKCNDRSSHTMSKQAYTKGTVLIQCPSCQVRHLIADHLKI  101



>gb|AGO11609.1| AaceriADL173Cp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=190

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  438  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            M++AFTCK C  R++  ++  AYT GTV +QC GC   H + D+L +
Sbjct  71   MMIAFTCKKCDTRSSHTMSKQAYTKGTVLIQCPGCKNRHLIADHLKI  117



>ref|XP_002059602.1| GJ14731 [Drosophila virilis]
 gb|EDW63024.1| GJ14731 [Drosophila virilis]
Length=181

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +RRM + + CK+C  R T+ I+  AY  G V +QC GC + H + DNL L
Sbjct  98   QRRMEIVYLCKLCNTRNTKTISEEAYYSGVVILQCDGCAVDHLIKDNLGL  147



>ref|XP_002010480.1| GI14660 [Drosophila mojavensis]
 gb|EDW07797.1| GI14660 [Drosophila mojavensis]
Length=187

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +RRM + + CK+C  R T+ I+  AY  G V +QC GC + H + DNL L
Sbjct  98   QRRMEIVYLCKLCNTRNTKTISEEAYNSGVVILQCDGCAVDHLIKDNLGL  147



>ref|XP_007637235.1| PREDICTED: LOW QUALITY PROTEIN: DNL-type zinc finger protein 
isoform X2 [Cricetulus griseus]
Length=156

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 43/93 (46%), Gaps = 13/93 (14%)
 Frame = +3

Query  297  SAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQR  476
            +A   RGW  G      S   GS P   + +V              R  + +TCKVCG R
Sbjct  35   TAERRRGWAWG--WRSSSTAQGSGPVAALGRVEAD-----------RYQLVYTCKVCGTR  81

Query  477  TTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
            ++++I+  AY  G V V C GC  +H + DNL 
Sbjct  82   SSKSISKLAYHHGVVIVTCPGCQNHHIIADNLG  114



>gb|ERE70542.1| DNL-type zinc finger protein [Cricetulus griseus]
Length=198

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 43/93 (46%), Gaps = 13/93 (14%)
 Frame = +3

Query  297  SAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQR  476
            +A   RGW  G      S   GS P   + +V              R  + +TCKVCG R
Sbjct  60   TAERRRGWAWG--WRSSSTAQGSGPVAALGRVEAD-----------RYQLVYTCKVCGTR  106

Query  477  TTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
            ++++I+  AY  G V V C GC  +H + DNL 
Sbjct  107  SSKSISKLAYHHGVVIVTCPGCQNHHIIADNLG  139



>ref|XP_002555014.1| KLTH0F19052p [Lachancea thermotolerans]
 emb|CAR24577.1| KLTH0F19052p [Lachancea thermotolerans CBS 6340]
Length=180

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  435  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            ++++AFTCK C  R++  ++  AYT GTV +QC GC   H + D+L +
Sbjct  64   QLMIAFTCKKCNNRSSHTMSKQAYTKGTVLIQCPGCKSRHLIADHLKI  111



>ref|XP_002493869.1| Heat shock protein with a zinc finger motif [Komagataella pastoris 
GS115]
 emb|CAY71690.1| Heat shock protein with a zinc finger motif [Komagataella pastoris 
GS115]
 emb|CCA40707.1| DNL-type zinc finger protein [Komagataella pastoris CBS 7435]
Length=169

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  435  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            ++++AFTCK C  R++   +  AYT+GTV +QC GC   H + D+L +
Sbjct  53   QLMIAFTCKKCDTRSSHTFSKQAYTNGTVLIQCPGCKNRHLIADHLKI  100



>gb|ETN66741.1| hypothetical protein AND_001480 [Anopheles darlingi]
Length=136

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +3

Query  432  RRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
            R+M + +TCKVC  R T  I+  AY  G + V C GC  +H + DNLN
Sbjct  57   RKMTLVYTCKVCQHRNTNTISKQAYEKGVIIVTCDGCRNHHLIADNLN  104



>ref|XP_008840170.1| PREDICTED: DNL-type zinc finger protein isoform X2 [Nannospalax 
galili]
Length=202

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 49/107 (46%), Gaps = 14/107 (13%)
 Frame = +3

Query  258  PILSQDAAMGLVLSAANVR-GWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRR  434
            P L Q    G+ L AA  R GW  G      S  +GS P   + +V    + L       
Sbjct  21   PRLGQLWGPGVRLRAAERRRGWAWG--WRSWSSASGSGPGAALGRVEAAHYRLV------  72

Query  435  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
                 +TCKVCG R+++ I+   Y  G V V C GC+ +H + DNL 
Sbjct  73   -----YTCKVCGTRSSKHISKLGYHQGVVIVTCPGCHNHHIIADNLG  114



>ref|NP_983923.1| ADL173Cp [Ashbya gossypii ATCC 10895]
 gb|AAS51747.1| ADL173Cp [Ashbya gossypii ATCC 10895]
 gb|AEY96044.1| FADL173Cp [Ashbya gossypii FDAG1]
Length=190

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  438  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            M++AFTCK C  R++  ++  AYT GTV +QC GC   H + D+L +
Sbjct  71   MMIAFTCKKCDTRSSHTMSKQAYTKGTVLIQCPGCKNRHLIADHLKI  117



>gb|EIF45938.1| zim17p [Brettanomyces bruxellensis AWRI1499]
Length=189

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  438  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +L+AFTCK CG R++  I+  AY  G+V VQC GC   H + D+LN+
Sbjct  74   LLLAFTCKKCGTRSSHIISKQAYLTGSVLVQCPGCKNRHLIADHLNI  120



>ref|XP_006687723.1| zf-DNL-domain-containing protein [Candida tenuis ATCC 10573]
 gb|EGV61553.1| zf-DNL-domain-containing protein [Candida tenuis ATCC 10573]
Length=178

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  435  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            ++++AFTCK C  R++   +  AYT GTV +QC GC   H + DNL +
Sbjct  64   QLMIAFTCKKCDTRSSHTFSKQAYTKGTVAIQCPGCKNRHLIADNLKI  111



>ref|XP_005760580.1| DNL zinc finger protein [Emiliania huxleyi CCMP1516]
 gb|EOD08151.1| DNL zinc finger protein [Emiliania huxleyi CCMP1516]
Length=273

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 64/146 (44%), Gaps = 13/146 (9%)
 Frame = +3

Query  144  PLKSNRLSSKRILRFSASPRGNGN--EPDLRSNSNDSSLVPILSQDAAMGLVLSAANVRG  317
            P+  +     RILR S    G+G   E   RS ++   ++    ++  + L  S+A V  
Sbjct  49   PVDDDEAPDGRILRVSRVADGSGRAIEDTGRSVASVQFMITRAMREELVALGFSSAQV--  106

Query  318  WTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINP  497
                  ME     A     T  +Q    P     K  + R  + FTC  CG R + +I+ 
Sbjct  107  ----DAMEPSRAGAILAKRTPSKQAQRKP-----KRKQSRFELQFTCNQCGCRNSHSISH  157

Query  498  HAYTDGTVFVQCCGCNIYHKLVDNLN  575
            HAYT GTV V C GC   H + D+LN
Sbjct  158  HAYTRGTVIVTCPGCQSSHLIADHLN  183



>ref|XP_002024413.1| GL15020 [Drosophila persimilis]
 gb|EDW29829.1| GL15020 [Drosophila persimilis]
Length=187

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +RRM + + CK+C  R T+ I+  AY  G V +QC GC + H + DNL L
Sbjct  99   QRRMELVYRCKLCNTRNTKTISEEAYYSGVVILQCDGCAVDHLIKDNLGL  148



>ref|XP_009862369.1| PREDICTED: DNL-type zinc finger protein-like [Ciona intestinalis]
Length=182

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 54/118 (46%), Gaps = 10/118 (8%)
 Frame = +3

Query  222  DLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTF  401
             +RSN N SS   + S  +    +    ++R ++T      P V   ++ E   E     
Sbjct  35   QVRSNVNRSSHFQLFSSSSKFNYIEHKKSLRSFSTSIP---PPVNQWNDSEPSNENT---  88

Query  402  PWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
                  K   +R  +AFTC VC  RT + I+  AY  G V V+C GC+  H + DNLN
Sbjct  89   ----IGKINSKRYNLAFTCTVCQTRTGKQISKRAYHHGVVIVRCPGCSNNHIIADNLN  142



>tpg|DAA51711.1| TPA: hypothetical protein ZEAMMB73_994626 [Zea mays]
Length=427

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 42/73 (58%), Gaps = 5/73 (7%)
 Frame = +3

Query  327  GSGMEGPSVPAGSNPET--GMEQVSTF--PWSLFTKSPR-RRMLVAFTCKVCGQRTTRAI  491
            G G+   SV  G   E   G  Q+ +F   ++LF        M VAF   VCGQRTTRAI
Sbjct  153  GGGLRAGSVAQGVPREGAGGDLQIKSFLSAYTLFHLGFMVGYMRVAFAYNVCGQRTTRAI  212

Query  492  NPHAYTDGTVFVQ  530
            NPHAYT+ TVFVQ
Sbjct  213  NPHAYTNETVFVQ  225



>ref|XP_001354904.1| GA20897 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL31960.1| GA20897 [Drosophila pseudoobscura pseudoobscura]
Length=187

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +RRM + + CK+C  R T+ I+  AY  G V +QC GC + H + DNL L
Sbjct  99   QRRMELVYRCKLCNTRNTKTISEEAYYSGVVILQCDGCAVDHLIKDNLGL  148



>ref|XP_002614239.1| hypothetical protein CLUG_05725 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ41597.1| hypothetical protein CLUG_05725 [Clavispora lusitaniae ATCC 42720]
Length=172

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  435  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            ++++AFTCK C  R++   +  AYT G+V +QC GC   H + DNL +
Sbjct  58   QLMIAFTCKKCETRSSHVFSKQAYTKGSVLIQCPGCKGRHLIADNLKI  105



>ref|XP_005083712.1| PREDICTED: DNL-type zinc finger protein [Mesocricetus auratus]
Length=173

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 42/93 (45%), Gaps = 13/93 (14%)
 Frame = +3

Query  297  SAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQR  476
            +A   RGW  G      S   GS P   + +V    + L            +TCKVCG R
Sbjct  35   TAERRRGWAWG--WRSSSSAQGSGPGAALGRVEADRYQLV-----------YTCKVCGTR  81

Query  477  TTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
            +++ I+  AY  G V V C GC  +H + DNL 
Sbjct  82   SSKRISKLAYHQGVVIVTCPGCQNHHIIADNLG  114



>gb|KGK37232.1| hypothetical protein JL09_g3628 [Pichia kudriavzevii]
Length=205

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  438  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            ++ AFTCK C  R++  ++  AY  GTV VQC GC + H + D+L +
Sbjct  92   LMFAFTCKKCDTRSSHVVSKQAYQHGTVLVQCPGCKVRHLMADHLKI  138



>ref|XP_315385.4| AGAP005377-PA [Anopheles gambiae str. PEST]
 gb|EAA11296.4| AGAP005377-PA [Anopheles gambiae str. PEST]
Length=143

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +3

Query  432  RRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
            R+M + +TCKVC  R    I+  AY  G V V C GC+ +H + DNLN
Sbjct  68   RKMNLIYTCKVCNHRNMHMISKQAYEKGVVIVTCDGCSNHHLIADNLN  115



>gb|KFH66652.1| hypothetical protein MVEG_07177 [Mortierella verticillata NRRL 
6337]
Length=247

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  423  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
             P+ RML+ FTC VC  R+ + ++ HAY  G V +QC  C   H + D+L
Sbjct  130  EPKARMLIGFTCTVCQHRSHKTMSKHAYNHGVVIMQCDHCKNRHLIADHL  179



>gb|EGW12770.1| DNL-type zinc finger protein [Cricetulus griseus]
Length=163

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 41/88 (47%), Gaps = 13/88 (15%)
 Frame = +3

Query  312  RGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAI  491
            RGW  G      S   GS P   + +V              R  + +TCKVCG R++++I
Sbjct  30   RGWAWG--WRSSSTAQGSGPVAALGRVEA-----------DRYQLVYTCKVCGTRSSKSI  76

Query  492  NPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
            +  AY  G V V C GC  +H + DNL 
Sbjct  77   SKLAYHHGVVIVTCPGCQNHHIIADNLG  104



>ref|XP_006863874.1| PREDICTED: DNL-type zinc finger protein [Chrysochloris asiatica]
Length=178

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 47/106 (44%), Gaps = 12/106 (11%)
 Frame = +3

Query  258  PILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRR  437
            P L Q  A G +  AA  R W         S   G  P T + +V +  + L        
Sbjct  21   PGLRQLWARGALPEAAGKR-WAWDWNWRRLSSEPGQGPGTALGRVESKHYQLV-------  72

Query  438  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
                +TCKVCG R+++ I+  AY  G V V C GC  +H + DNL 
Sbjct  73   ----YTCKVCGTRSSKRISKLAYHQGVVIVTCQGCRNHHIIADNLG  114



>ref|XP_010736167.1| PREDICTED: DNL-type zinc finger protein, partial [Larimichthys 
crocea]
Length=174

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +3

Query  444  VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
            + +TCKVC  R+T  I+  AY  G V V C GCN +H + DNLN
Sbjct  87   LVYTCKVCSTRSTEKISKQAYHKGVVIVTCRGCNNHHIIADNLN  130



>gb|EEH05800.1| DNL zinc finger domain-containing protein [Histoplasma capsulatum 
G186AR]
Length=219

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            ++  R   + FTCK CG R++  I+ H Y  GTV + C GC   H + D+LN+
Sbjct  81   RAEERAFQITFTCKPCGHRSSHRISQHGYYKGTVLISCPGCRNRHVISDHLNI  133



>ref|XP_006674935.1| hypothetical protein BATDEDRAFT_7290, partial [Batrachochytrium 
dendrobatidis JAM81]
 ref|XP_006674936.1| hypothetical protein BATDEDRAFT_7293, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF83461.1| hypothetical protein BATDEDRAFT_7290, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF84303.1| hypothetical protein BATDEDRAFT_7293, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=71

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  435  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            RM++ FTCKVC  R+ ++++  AYT G V ++C GC   H + D+L
Sbjct  1    RMIIGFTCKVCKHRSYKSMSKKAYTTGVVMIKCDGCKNTHLIADHL  46



>gb|EEQ92563.1| DNL zinc finger domain-containing protein [Blastomyces dermatitidis 
ER-3]
 gb|EGE86745.1| DNL zinc finger domain-containing protein [Blastomyces dermatitidis 
ATCC 18188]
 gb|EQL30397.1| hypothetical protein BDFG_07086 [Blastomyces dermatitidis ATCC 
26199]
 gb|EQL30398.1| hypothetical protein, variant 1 [Blastomyces dermatitidis ATCC 
26199]
 gb|EQL30399.1| hypothetical protein, variant 2 [Blastomyces dermatitidis ATCC 
26199]
 gb|EQL30400.1| hypothetical protein, variant 3 [Blastomyces dermatitidis ATCC 
26199]
Length=228

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            ++  R   + FTCK CG R++  I+ H Y  GTV + C GC   H + D+LN+
Sbjct  90   RAEERAFQITFTCKPCGHRSSHRISQHGYYKGTVLISCPGCKNRHVISDHLNI  142



>ref|XP_003644612.1| hypothetical protein Ecym_2037 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET37795.1| Hypothetical protein Ecym_2037 [Eremothecium cymbalariae DBVPG#7215]
Length=193

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = +3

Query  378  GMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHK  557
            G E+   F      K  +  +++AFTCK C  R++ +++  AYT GTV +QC GC   H 
Sbjct  52   GAEKRGDFKHVGSIKIDKPLLMIAFTCKKCNTRSSHSMSKQAYTKGTVLIQCPGCTNRHL  111

Query  558  LVDNLNL  578
            + D+L +
Sbjct  112  IADHLKI  118



>emb|CBK20169.2| Zim17 [Blastocystis hominis]
Length=136

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +3

Query  438  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            M++ FTCKVC  R+ R ++  AY  G V ++C GCN  H + D+L
Sbjct  53   MIIVFTCKVCNTRSARKMSKEAYNHGVVLIRCPGCNNLHLIADHL  97



>ref|XP_004198925.1| Piso0_002320 [Millerozyma farinosa CBS 7064]
 emb|CCE82588.1| Piso0_002320 [Millerozyma farinosa CBS 7064]
Length=187

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  435  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +M++AFTC VC  R++   +  AY  G+V +QC GC   H + DNL +
Sbjct  67   QMMIAFTCTVCDTRSSHVFSKQAYQTGSVLIQCPGCKNRHLIADNLKI  114



>ref|XP_002626197.1| DNL zinc finger domain-containing protein [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ76986.1| DNL zinc finger domain-containing protein [Blastomyces dermatitidis 
SLH14081]
Length=228

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            ++  R   + FTCK CG R++  I+ H Y  GTV + C GC   H + D+LN+
Sbjct  90   RAEERAFQITFTCKPCGHRSSHRISQHGYYKGTVLISCPGCKNRHVISDHLNI  142



>ref|XP_009308557.1| zf-DNL-domain-containing protein [Trypanosoma grayi]
 gb|KEG13194.1| zf-DNL-domain-containing protein [Trypanosoma grayi]
Length=197

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 26/45 (58%), Gaps = 0/45 (0%)
 Frame = +3

Query  438  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            M+ AFTC  C  R  +  + HAYT G V VQC  C + H L DNL
Sbjct  110  MVAAFTCGRCEHRMVKKFSKHAYTKGIVIVQCSSCEVKHLLADNL  154



>ref|XP_004199776.1| Piso0_002320 [Millerozyma farinosa CBS 7064]
 emb|CCE81657.1| Piso0_002320 [Millerozyma farinosa CBS 7064]
Length=187

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  435  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +M++AFTC VC  R++   +  AY  G+V +QC GC   H + DNL +
Sbjct  67   QMMIAFTCTVCDTRSSHVFSKQAYQTGSVLIQCPGCKNRHLIADNLKI  114



>ref|XP_002107042.1| GD17233 [Drosophila simulans]
 gb|EDX18015.1| GD17233 [Drosophila simulans]
Length=191

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +RRM + + CK+C  R T+ I+  AY  G V +QC GC + H + DNL L
Sbjct  99   QRRMELVYRCKLCNTRNTKTISEEAYYSGVVILQCDGCAVDHLIKDNLGL  148



>emb|CDH12975.1| related to Mitochondrial protein import protein ZIM17 [Zygosaccharomyces 
bailii ISA1307]
Length=163

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  438  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +++AFTCK C  R++  ++  AYT+GTV +QC  C+  H + D+L +
Sbjct  57   LMIAFTCKKCNHRSSHTMSKQAYTNGTVLIQCPTCHARHLIADHLKI  103



>ref|XP_008482374.1| PREDICTED: DNL-type zinc finger protein-like [Diaphorina citri]
Length=198

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  572
            + ++ +A+TCKVCG R +  I+ H+Y  G V V+C GC+  H + DNL
Sbjct  107  KHKLKLAYTCKVCGTRNSHLISKHSYEKGVVIVKCEGCSNNHLIADNL  154



>ref|XP_002100710.1| GE17213 [Drosophila yakuba]
 gb|EDX01818.1| GE17213 [Drosophila yakuba]
Length=191

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +RRM + + CK+C  R T+ I+  AY  G V +QC GC + H + DNL L
Sbjct  99   QRRMELVYRCKLCNTRNTKTISEEAYYSGVVILQCDGCAVDHLIKDNLGL  148



>emb|CDK25150.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=222

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  438  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +++AFTCK C  R++  ++  AYT GTV +QC GC+  H + D+L +
Sbjct  108  LMIAFTCKKCDTRSSHVMSKQAYTSGTVLIQCPGCSNRHLIADHLKI  154



>ref|XP_003688733.1| hypothetical protein TPHA_0P01410 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE66299.1| hypothetical protein TPHA_0P01410 [Tetrapisispora phaffii CBS 
4417]
Length=182

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  420  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            K  ++++++AFTC  C  R++  I+  AYT GTV VQC GC   H + D+L +
Sbjct  64   KVEQQKLMLAFTCNKCNTRSSHTISKQAYTSGTVMVQCPGCKNRHLIADHLKI  116



>ref|NP_573064.1| CG8206, isoform A [Drosophila melanogaster]
 ref|NP_001285294.1| CG8206, isoform B [Drosophila melanogaster]
 gb|AAF48501.1| CG8206, isoform A [Drosophila melanogaster]
 gb|AAM52604.1| GH04557p [Drosophila melanogaster]
 gb|ACL84528.1| CG8206-PA, partial [synthetic construct]
 gb|ACL89467.1| CG8206-PA [synthetic construct]
 gb|AHN59764.1| CG8206, isoform B [Drosophila melanogaster]
Length=191

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +RRM + + CK+C  R T+ I+  AY  G V +QC GC + H + DNL L
Sbjct  99   QRRMELVYRCKLCNTRNTKTISEEAYYSGVVILQCDGCAVDHLIKDNLGL  148



>ref|XP_003510907.1| PREDICTED: DNL-type zinc finger protein isoform X1 [Cricetulus 
griseus]
Length=188

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 41/89 (46%), Gaps = 13/89 (15%)
 Frame = +3

Query  312  RGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAI  491
            RGW  G      S   GS P   + +V              R  + +TCKVCG R++++I
Sbjct  55   RGWAWG--WRSSSTAQGSGPVAALGRVEA-----------DRYQLVYTCKVCGTRSSKSI  101

Query  492  NPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +  AY  G V V C GC  +H + DNL  
Sbjct  102  SKLAYHHGVVIVTCPGCQNHHIIADNLGW  130



>ref|XP_001978045.1| GG17905 [Drosophila erecta]
 gb|EDV46972.1| GG17905 [Drosophila erecta]
Length=191

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  429  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  578
            +RRM + + CK+C  R T+ I+  AY  G V +QC GC + H + DNL L
Sbjct  99   QRRMELVYRCKLCNTRNTKTISEEAYYSGVVILQCDGCAVDHLIKDNLGL  148



>ref|XP_010681379.1| PREDICTED: uncharacterized protein LOC104896335 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=130

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  417  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQ  530
            T+ PRR +LV FTC  CG+RT R IN  AY  GTVFVQ
Sbjct  84   TQLPRRSLLVQFTCDACGERTKRLINRLAYERGTVFVQ  121



>ref|XP_008840169.1| PREDICTED: DNL-type zinc finger protein isoform X1 [Nannospalax 
galili]
Length=270

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 49/107 (46%), Gaps = 14/107 (13%)
 Frame = +3

Query  258  PILSQDAAMGLVLSAANVR-GWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRR  434
            P L Q    G+ L AA  R GW  G      S  +GS P   + +V    + L       
Sbjct  21   PRLGQLWGPGVRLRAAERRRGWAWG--WRSWSSASGSGPGAALGRVEAAHYRLV------  72

Query  435  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  575
                 +TCKVCG R+++ I+   Y  G V V C GC+ +H + DNL 
Sbjct  73   -----YTCKVCGTRSSKHISKLGYHQGVVIVTCPGCHNHHIIADNLG  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220