BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF019E03

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009359892.1|  PREDICTED: uncharacterized protein LOC103950...  60.1    1e-07   
ref|XP_008390187.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  60.1    2e-07   
ref|XP_009359891.1|  PREDICTED: uncharacterized protein LOC103950...  60.1    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_010100044.1|  hypothetical protein L484_013156                 59.3    2e-07   
ref|XP_009378816.1|  PREDICTED: uncharacterized protein LOC103967265  59.3    3e-07   
ref|XP_007222390.1|  hypothetical protein PRUPE_ppa004878mg           57.0    1e-06   
ref|XP_008222369.1|  PREDICTED: uncharacterized protein LOC103322249  56.6    2e-06   Prunus mume [ume]
ref|XP_008369644.1|  PREDICTED: uncharacterized protein LOC103433181  54.3    1e-05   
ref|XP_006286776.1|  hypothetical protein CARUB_v10003326mg           51.6    8e-05   Capsella rubella
ref|XP_004157632.1|  PREDICTED: uncharacterized LOC101205430          49.7    4e-04   
ref|XP_010453387.1|  PREDICTED: uncharacterized protein LOC104735325  49.7    4e-04   Camelina sativa [gold-of-pleasure]
gb|KGN46417.1|  hypothetical protein Csa_6G091900                     49.3    6e-04   Cucumis sativus [cucumbers]
ref|XP_002267942.2|  PREDICTED: uncharacterized protein LOC100260846  49.3    6e-04   
ref|XP_004140652.1|  PREDICTED: uncharacterized protein LOC101205430  48.9    6e-04   
emb|CAN81746.1|  hypothetical protein VITISV_038195                   48.9    6e-04   Vitis vinifera
ref|XP_004310133.1|  PREDICTED: coiled-coil domain-containing pro...  48.9    7e-04   Fragaria vesca subsp. vesca



>ref|XP_009359892.1| PREDICTED: uncharacterized protein LOC103950414 isoform X2 [Pyrus 
x bretschneideri]
Length=479

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 79/107 (74%), Gaps = 7/107 (7%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSESG--VLNppaaassaprpHHGRsssvsgmssIKRTQNvaaka  287
            M+ RRTDSPVYAR W+SES   V    + A S  R HH RSSS SG+S+IKRTQN AAKA
Sbjct  1    MDRRRTDSPVYARQWTSESATTVGGATSPAMSPVRGHHARSSSASGISNIKRTQNFAAKA  60

Query  288  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGP  425
            AAQRLAQVMASQ A      +D+++DDLGFR+ APPPL LSR A+ P
Sbjct  61   AAQRLAQVMASQTAD----GDDDEDDDLGFRYSAPPPLSLSRNANSP  103



>ref|XP_008390187.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103452479 
[Malus domestica]
Length=563

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 79/107 (74%), Gaps = 7/107 (7%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSESG--VLNppaaassaprpHHGRsssvsgmssIKRTQNvaaka  287
            M+ RRTDSPVYAR W+SES   V    + A S  R HH RSSS SG+S+IKRTQN AAKA
Sbjct  1    MDRRRTDSPVYARQWTSESATTVGGATSPAMSPVRGHHARSSSASGVSNIKRTQNFAAKA  60

Query  288  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGP  425
            AAQRLAQVMASQ A      +D+++DDLGFR+ APPPL LSR A+ P
Sbjct  61   AAQRLAQVMASQTADD----DDDEDDDLGFRYSAPPPLSLSRNANSP  103



>ref|XP_009359891.1| PREDICTED: uncharacterized protein LOC103950414 isoform X1 [Pyrus 
x bretschneideri]
Length=563

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 80/107 (75%), Gaps = 7/107 (7%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSESG--VLNppaaassaprpHHGRsssvsgmssIKRTQNvaaka  287
            M+ RRTDSPVYAR W+SES   V    + A S  R HH RSSS SG+S+IKRTQN AAKA
Sbjct  1    MDRRRTDSPVYARQWTSESATTVGGATSPAMSPVRGHHARSSSASGISNIKRTQNFAAKA  60

Query  288  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGP  425
            AAQRLAQVMASQ A G    +D+++DDLGFR+ APPPL LSR A+ P
Sbjct  61   AAQRLAQVMASQTADG----DDDEDDDLGFRYSAPPPLSLSRNANSP  103



>ref|XP_010100044.1| hypothetical protein L484_013156 [Morus notabilis]
 gb|EXB81215.1| hypothetical protein L484_013156 [Morus notabilis]
Length=464

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 79/104 (76%), Gaps = 6/104 (6%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSESGVL---NppaaassaprpHHGRsssvsgmssIKRTQNvaak  284
            ME RRTDSPVYAR W+SESG     +  + A S  R  H RSSS SG+S+IKRTQN AAK
Sbjct  1    MERRRTDSPVYARQWTSESGTTIPASQSSPAMSPARNRHARSSSSSGISNIKRTQNFAAK  60

Query  285  aaaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRT  413
            AAAQRLAQVMASQ AA   EDEDED+ DLGFR+ APPPL LSRT
Sbjct  61   AAAQRLAQVMASQTAAD--EDEDEDDGDLGFRYSAPPPLSLSRT  102



>ref|XP_009378816.1| PREDICTED: uncharacterized protein LOC103967265 [Pyrus x bretschneideri]
Length=562

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 79/107 (74%), Gaps = 7/107 (7%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSES--GVLNppaaassaprpHHGRsssvsgmssIKRTQNvaaka  287
            M+ RRTDSPVYAR W+SES   V    + A S  R HH RSSS SG+S+IKRTQN AAKA
Sbjct  1    MDRRRTDSPVYARQWTSESTATVGGATSPAMSPVRGHHARSSSTSGVSNIKRTQNFAAKA  60

Query  288  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGP  425
            AAQRLAQVMASQ A      +D+++DDLGFR+ APPPL LSR A+ P
Sbjct  61   AAQRLAQVMASQTADD----DDDEDDDLGFRYSAPPPLSLSRNANSP  103



>ref|XP_007222390.1| hypothetical protein PRUPE_ppa004878mg [Prunus persica]
 gb|EMJ23589.1| hypothetical protein PRUPE_ppa004878mg [Prunus persica]
Length=487

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 76/107 (71%), Gaps = 7/107 (7%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSESGVL--NppaaassaprpHHGRsssvsgmssIKRTQNvaaka  287
            M+ RRTDSPVYAR W+SES        + A S  R HH RSSS SG+S+IKRTQN AAKA
Sbjct  1    MDRRRTDSPVYARQWTSESSTTLGGATSPAMSPVRGHHARSSSASGISNIKRTQNFAAKA  60

Query  288  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGP  425
            AAQRLAQVMASQ A      +D++ DDLGFR+ APPPL LSR  + P
Sbjct  61   AAQRLAQVMASQTADD----DDDEEDDLGFRYSAPPPLSLSRNVNSP  103



>ref|XP_008222369.1| PREDICTED: uncharacterized protein LOC103322249 [Prunus mume]
Length=563

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 77/107 (72%), Gaps = 7/107 (7%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSESG--VLNppaaassaprpHHGRsssvsgmssIKRTQNvaaka  287
            M+ RRTDSPVYAR W+SES   +    + A S  R HH RSSS SG+S+IKRTQN AAKA
Sbjct  1    MDRRRTDSPVYARQWTSESSSTLGGATSPAMSPVRGHHARSSSASGISNIKRTQNFAAKA  60

Query  288  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGP  425
            AAQRLAQVMASQ A      +D++ DDLGFR+ APPPL LSR  + P
Sbjct  61   AAQRLAQVMASQTADD----DDDEEDDLGFRYSAPPPLSLSRNVNSP  103



>ref|XP_008369644.1| PREDICTED: uncharacterized protein LOC103433181 [Malus domestica]
Length=563

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 77/104 (74%), Gaps = 7/104 (7%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSES--GVLNppaaassaprpHHGRsssvsgmssIKRTQNvaaka  287
            M+ RRTDSPVYAR W+SES   V    + A S  R HH RSSS SG+S+IKRTQN AAKA
Sbjct  1    MDRRRTDSPVYARQWTSESTTTVGGATSPAMSPVRGHHARSSSASGISNIKRTQNFAAKA  60

Query  288  aaqrlaqvmaSQAAAGndededednddLGFRFA-PPPLPLSRTA  416
            AAQRLAQVMASQ A      +D+++DDLGFR++ PPPL +SR A
Sbjct  61   AAQRLAQVMASQTAD----GDDDEDDDLGFRYSVPPPLSVSRNA  100



>ref|XP_006286776.1| hypothetical protein CARUB_v10003326mg [Capsella rubella]
 gb|EOA19674.1| hypothetical protein CARUB_v10003326mg [Capsella rubella]
Length=542

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNvaakaaa  293
            ME  RT+SP Y R WS ESG  N   A SS  R HH RSSSV+ MS++KR QNVAAKAAA
Sbjct  1    MERARTESPSYFRQWSGESGATNAAVAPSSPARHHHARSSSVTTMSNVKRAQNVAAKAAA  60

Query  294  qrlaqvmaSQA--AAGndededednddLGFRF-APPPLPLSRTASG  422
            QRLA+VMASQ      +D+D++   DDLGFR+ APPPL  +R AS 
Sbjct  61   QRLAKVMASQTNNDDDDDDDDEVGGDDLGFRYGAPPPLSFTRNASS  106



>ref|XP_004157632.1| PREDICTED: uncharacterized LOC101205430, partial [Cucumis sativus]
Length=415

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 76/102 (75%), Gaps = 7/102 (7%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSESGVLNp--paaassaprpHHGRsssvsgmssIKRTQNvaaka  287
            M+ +RT+SP+Y R WSSESG       + A S  R HH RSSSVSG+S+IKRTQN AAKA
Sbjct  1    MDVKRTESPIYGRQWSSESGTTGGGPASPAMSPARGHHSRSSSVSGISNIKRTQNFAAKA  60

Query  288  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSR  410
            AAQRLAQVMASQ A     D+D+D DDLGFR+ APPP+ LSR
Sbjct  61   AAQRLAQVMASQTAD----DDDDDQDDLGFRYSAPPPISLSR  98



>ref|XP_010453387.1| PREDICTED: uncharacterized protein LOC104735325 [Camelina sativa]
Length=526

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNvaakaaa  293
            ME  RT+SP Y R WS ESG  N   A SS  R HH RSSSV+ MS++KR QNVAAKAAA
Sbjct  1    MERARTESPSYFRQWSGESGTTNAAVAPSSPARHHHARSSSVTTMSNVKRAQNVAAKAAA  60

Query  294  qrlaqvmaSQA--AAGndededednddLGFRFA--PPPLPLSRTASG  422
            QRLA+VMASQ      +D+D++   DDLGFR+   PPPL  +R AS 
Sbjct  61   QRLAKVMASQTNNDDDDDDDDEVGGDDLGFRYGAPPPPLSFTRNASS  107



>gb|KGN46417.1| hypothetical protein Csa_6G091900 [Cucumis sativus]
Length=541

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 76/102 (75%), Gaps = 7/102 (7%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSESGVLNp--paaassaprpHHGRsssvsgmssIKRTQNvaaka  287
            M+ +RT+SP+Y R WSSESG       + A S  R HH RSSSVSG+S+IKRTQN AAKA
Sbjct  1    MDVKRTESPIYGRQWSSESGTTGGGPASPAMSPARGHHSRSSSVSGISNIKRTQNFAAKA  60

Query  288  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSR  410
            AAQRLAQVMASQ A     D+D+D DDLGFR+ APPP+ LSR
Sbjct  61   AAQRLAQVMASQTAD----DDDDDQDDLGFRYSAPPPISLSR  98



>ref|XP_002267942.2| PREDICTED: uncharacterized protein LOC100260846 [Vitis vinifera]
 emb|CBI35662.3| unnamed protein product [Vitis vinifera]
Length=553

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 75/107 (70%), Gaps = 5/107 (5%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNvaakaaa  293
            M+  R+DS V  R WSSESG     + A S    HH RS+S +G+S+IKRTQN AAKAAA
Sbjct  1    MDRTRSDSTVIGRQWSSESGATGTSSPAMSPSLYHHSRSASATGISNIKRTQNFAAKAAA  60

Query  294  qrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTA-SGPP  428
            QRLAQVMASQ A    +DED+++DDLGFR+ APPP   SRT  SG P
Sbjct  61   QRLAQVMASQTAD---DDEDDEDDDLGFRYSAPPPPAFSRTVNSGKP  104



>ref|XP_004140652.1| PREDICTED: uncharacterized protein LOC101205430 [Cucumis sativus]
Length=535

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 76/102 (75%), Gaps = 7/102 (7%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSESGVLNp--paaassaprpHHGRsssvsgmssIKRTQNvaaka  287
            M+ +RT+SP+Y R WSSESG       + A S  R HH RSSSVSG+S+IKRTQN AAKA
Sbjct  1    MDVKRTESPIYGRQWSSESGTTGGGPASPAMSPARGHHSRSSSVSGISNIKRTQNFAAKA  60

Query  288  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSR  410
            AAQRLAQVMASQ A     D+D+D DDLGFR+ APPP+ LSR
Sbjct  61   AAQRLAQVMASQTAD----DDDDDQDDLGFRYSAPPPISLSR  98



>emb|CAN81746.1| hypothetical protein VITISV_038195 [Vitis vinifera]
Length=516

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 75/107 (70%), Gaps = 5/107 (5%)
 Frame = +3

Query  114  MEARRTDSPVYARHWSSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNvaakaaa  293
            M+  R+DS V  R WSSESG     + A S    HH RS+S +G+S+IKRTQN AAKAAA
Sbjct  1    MDRTRSDSTVIGRQWSSESGATGTSSPAMSPSLYHHSRSASATGISNIKRTQNFAAKAAA  60

Query  294  qrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTA-SGPP  428
            QRLAQVMASQ A    +DED+++DDLGFR+ APPP   SRT  SG P
Sbjct  61   QRLAQVMASQTAD---DDEDDEDDDLGFRYSAPPPPAFSRTVNSGKP  104



>ref|XP_004310133.1| PREDICTED: coiled-coil domain-containing protein SCD2 [Fragaria 
vesca subsp. vesca]
Length=554

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 75/102 (74%), Gaps = 6/102 (6%)
 Frame = +3

Query  123  RRTDSPVYARHWSSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNvaakaaaqrl  302
            RRTDSPVY R W+++S      + A S  R HH RSSS SG+S+IKRTQN AAKAAAQRL
Sbjct  5    RRTDSPVYTRQWTTDSPT--ATSPAMSPVRGHHARSSSASGISNIKRTQNFAAKAAAQRL  62

Query  303  aqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGP  425
            AQVMASQ      +D+DED+DDLGFR+ APPP  LSR A+ P
Sbjct  63   AQVMASQ---NTGDDDDEDDDDLGFRYSAPPPFSLSRNANSP  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600