BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF019D10

Length=565
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011089543.1|  PREDICTED: root phototropism protein 2-like        293   6e-93   Sesamum indicum [beniseed]
emb|CDP04035.1|  unnamed protein product                                290   1e-91   Coffea canephora [robusta coffee]
gb|KHG08105.1|  Root phototropism 2 -like protein                       285   2e-90   Gossypium arboreum [tree cotton]
gb|KJB26284.1|  hypothetical protein B456_004G235100                    286   6e-90   Gossypium raimondii
ref|XP_004243653.1|  PREDICTED: root phototropism protein 2             285   1e-89   Solanum lycopersicum
ref|XP_006353728.1|  PREDICTED: root phototropism protein 2-like        285   2e-89   Solanum tuberosum [potatoes]
ref|XP_009611218.1|  PREDICTED: root phototropism protein 2             285   2e-89   Nicotiana tomentosiformis
gb|EYU36889.1|  hypothetical protein MIMGU_mgv1a003487mg                282   2e-88   Erythranthe guttata [common monkey flower]
ref|XP_009777101.1|  PREDICTED: root phototropism protein 2             281   3e-88   Nicotiana sylvestris
ref|XP_008358916.1|  PREDICTED: root phototropism protein 2-like        264   1e-86   
emb|CBI15801.3|  unnamed protein product                                265   2e-86   Vitis vinifera
ref|XP_010023564.1|  PREDICTED: root phototropism protein 2             276   3e-86   Eucalyptus grandis [rose gum]
ref|XP_002264896.1|  PREDICTED: root phototropism protein 2 isofo...    276   4e-86   Vitis vinifera
ref|XP_007017103.1|  Phototropic-responsive NPH3 family protein         275   6e-86   
gb|KDP45678.1|  hypothetical protein JCGZ_17285                         274   2e-85   Jatropha curcas
ref|XP_008366216.1|  PREDICTED: root phototropism protein 2-like        271   4e-84   
gb|KDO54917.1|  hypothetical protein CISIN_1g007944mg                   271   4e-84   Citrus sinensis [apfelsine]
ref|XP_006432046.1|  hypothetical protein CICLE_v10000673mg             271   4e-84   Citrus clementina [clementine]
gb|ADL36608.1|  BZIP domain class transcription factor                  271   5e-84   Malus domestica [apple tree]
ref|XP_008349518.1|  PREDICTED: LOW QUALITY PROTEIN: root phototr...    271   5e-84   
ref|XP_010094443.1|  Root phototropism protein 2                        270   5e-84   Morus notabilis
ref|XP_007206420.1|  hypothetical protein PRUPE_ppa003347mg             270   1e-83   Prunus persica
ref|NP_001280845.1|  root phototropism protein 2-like                   270   1e-83   Malus domestica [apple tree]
ref|XP_008239637.1|  PREDICTED: root phototropism protein 2 isofo...    269   2e-83   Prunus mume [ume]
ref|XP_009374407.1|  PREDICTED: root phototropism protein 2-like        269   2e-83   Pyrus x bretschneideri [bai li]
ref|XP_008239576.1|  PREDICTED: root phototropism protein 2 isofo...    269   2e-83   Prunus mume [ume]
ref|XP_004294714.1|  PREDICTED: root phototropism protein 2             267   1e-82   Fragaria vesca subsp. vesca
ref|XP_009355145.1|  PREDICTED: root phototropism protein 2-like        265   5e-82   Pyrus x bretschneideri [bai li]
ref|NP_001280895.1|  root phototropism protein 2-like                   264   2e-81   Malus domestica [apple tree]
ref|XP_002325631.1|  ROOT PHOTOTROPISM 2 family protein                 262   8e-81   Populus trichocarpa [western balsam poplar]
ref|XP_011011776.1|  PREDICTED: root phototropism protein 2-like        261   2e-80   Populus euphratica
gb|AAB63085.1|  unknown protein                                         248   5e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008451888.1|  PREDICTED: root phototropism protein 2 isofo...    260   6e-80   Cucumis melo [Oriental melon]
ref|XP_010244564.1|  PREDICTED: root phototropism protein 2             259   7e-80   Nelumbo nucifera [Indian lotus]
ref|XP_006591739.1|  PREDICTED: root phototropism protein 2-like        258   9e-80   Glycine max [soybeans]
ref|XP_002319980.1|  ROOT PHOTOTROPISM 2 family protein                 259   9e-80   
ref|XP_004147730.1|  PREDICTED: root phototropism protein 2-like        258   3e-79   Cucumis sativus [cucumbers]
ref|XP_004500391.1|  PREDICTED: root phototropism protein 2-like        258   3e-79   Cicer arietinum [garbanzo]
ref|XP_011015900.1|  PREDICTED: root phototropism protein 2-like        258   5e-79   Populus euphratica
ref|XP_008451887.1|  PREDICTED: root phototropism protein 2 isofo...    259   5e-79   
gb|AFK45576.1|  unknown                                                 254   6e-79   Medicago truncatula
ref|XP_003600550.1|  Root phototropism protein                          255   2e-78   Medicago truncatula
ref|XP_006410156.1|  hypothetical protein EUTSA_v10016728mg             250   4e-78   
gb|KJB26282.1|  hypothetical protein B456_004G235100                    254   4e-78   Gossypium raimondii
gb|KGN53487.1|  hypothetical protein Csa_4G056750                       254   5e-78   
ref|XP_011041764.1|  PREDICTED: root phototropism protein 2-like        254   6e-78   Populus euphratica
ref|XP_006293884.1|  hypothetical protein CARUB_v10022870mg             253   3e-77   Capsella rubella
gb|AAF33112.1|AF181683_1  RPT2                                          253   3e-77   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02185.1|  hypothetical protein                                   253   3e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414259.1|  PREDICTED: root phototropism protein 2-like        253   3e-77   Camelina sativa [gold-of-pleasure]
ref|NP_850147.1|  Root phototropism protein 2                           253   4e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010677799.1|  PREDICTED: root phototropism protein 2             252   7e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003553189.1|  PREDICTED: root phototropism protein 2-like        251   1e-76   Glycine max [soybeans]
gb|KFK22949.1|  root phototropism protein 2                             252   1e-76   Arabis alpina [alpine rockcress]
emb|CDY10743.1|  BnaA05g11930D                                          251   1e-76   Brassica napus [oilseed rape]
dbj|BAJ33924.1|  unnamed protein product                                251   1e-76   Eutrema halophilum
ref|XP_009144295.1|  PREDICTED: root phototropism protein 2             251   1e-76   Brassica rapa
ref|XP_011080638.1|  PREDICTED: root phototropism protein 2             251   2e-76   Sesamum indicum [beniseed]
ref|XP_002881117.1|  hypothetical protein ARALYDRAFT_481966             251   2e-76   
dbj|BAF01791.1|  hypothetical protein                                   250   5e-76   Arabidopsis thaliana [mouse-ear cress]
emb|CDY02075.1|  BnaC04g14260D                                          250   5e-76   
ref|XP_010469846.1|  PREDICTED: root phototropism protein 2 isofo...    250   6e-76   
ref|XP_010510344.1|  PREDICTED: root phototropism protein 2-like        249   8e-76   Camelina sativa [gold-of-pleasure]
ref|XP_007146905.1|  hypothetical protein PHAVU_006G080400g             248   1e-75   Phaseolus vulgaris [French bean]
ref|XP_010557176.1|  PREDICTED: root phototropism protein 2             246   8e-75   Tarenaya hassleriana [spider flower]
emb|CDY23992.1|  BnaC03g16990D                                          244   4e-74   Brassica napus [oilseed rape]
ref|XP_010044625.1|  PREDICTED: root phototropism protein 2-like        244   9e-74   Eucalyptus grandis [rose gum]
ref|XP_003544940.2|  PREDICTED: root phototropism protein 2-like        244   1e-73   Glycine max [soybeans]
gb|KCW86718.1|  hypothetical protein EUGRSUZ_B03325                     243   1e-73   Eucalyptus grandis [rose gum]
ref|XP_007142019.1|  hypothetical protein PHAVU_008G245700g             239   8e-72   Phaseolus vulgaris [French bean]
ref|XP_003519296.1|  PREDICTED: root phototropism protein 2             238   1e-71   
ref|XP_003616056.1|  Root phototropism protein                          238   2e-71   Medicago truncatula
ref|XP_006842585.1|  hypothetical protein AMTR_s00077p00161250          237   4e-71   Amborella trichopoda
emb|CDX84827.1|  BnaA03g14030D                                          235   2e-70   
ref|XP_009132742.1|  PREDICTED: root phototropism protein 2-like        234   3e-70   Brassica rapa
gb|ABI34691.1|  bZIP transcription factor bZIP84                        223   3e-70   Glycine max [soybeans]
ref|XP_004490729.1|  PREDICTED: root phototropism protein 2-like        233   8e-70   Cicer arietinum [garbanzo]
gb|KHN18647.1|  Root phototropism protein 2                             224   8e-69   Glycine soja [wild soybean]
gb|EPS73802.1|  hypothetical protein M569_00954                         228   6e-68   Genlisea aurea
ref|XP_010522018.1|  PREDICTED: root phototropism protein 2-like        224   2e-66   Tarenaya hassleriana [spider flower]
gb|KJB26283.1|  hypothetical protein B456_004G235100                    212   6e-62   Gossypium raimondii
ref|XP_006432045.1|  hypothetical protein CICLE_v10000673mg             206   1e-59   
gb|KDO54918.1|  hypothetical protein CISIN_1g007944mg                   206   1e-59   Citrus sinensis [apfelsine]
ref|XP_008803009.1|  PREDICTED: root phototropism protein 2             205   4e-59   Phoenix dactylifera
ref|XP_010650806.1|  PREDICTED: root phototropism protein 2 isofo...    202   2e-58   
ref|XP_009384759.1|  PREDICTED: root phototropism protein 2-like ...    197   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009402205.1|  PREDICTED: root phototropism protein 2 isofo...    195   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010922790.1|  PREDICTED: root phototropism protein 2             194   6e-55   Elaeis guineensis
ref|NP_001031446.1|  Root phototropism protein 2                        191   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002978505.1|  hypothetical protein SELMODRAFT_443843             188   1e-52   Selaginella moellendorffii
ref|XP_002970426.1|  hypothetical protein SELMODRAFT_231529             188   1e-52   
gb|AES70802.2|  root phototropism-like protein                          186   4e-52   Medicago truncatula
gb|KGN61975.1|  hypothetical protein Csa_2G277660                       178   2e-51   
ref|XP_007156731.1|  hypothetical protein PHAVU_002G012500g             184   4e-51   Phaseolus vulgaris [French bean]
gb|KHG27515.1|  hypothetical protein F383_13864                         181   6e-51   Gossypium arboreum [tree cotton]
gb|EYU44474.1|  hypothetical protein MIMGU_mgv1a027075mg                183   8e-51   Erythranthe guttata [common monkey flower]
gb|KJB48680.1|  hypothetical protein B456_008G080700                    179   3e-50   Gossypium raimondii
ref|XP_003538794.2|  PREDICTED: BTB/POZ domain-containing protein...    181   4e-50   Glycine max [soybeans]
ref|XP_002963864.1|  hypothetical protein SELMODRAFT_141980             181   6e-50   Selaginella moellendorffii
emb|CBI33715.3|  unnamed protein product                                180   6e-50   Vitis vinifera
ref|XP_002988267.1|  hypothetical protein SELMODRAFT_447227             181   7e-50   Selaginella moellendorffii
ref|XP_004511862.1|  PREDICTED: BTB/POZ domain-containing protein...    181   7e-50   Cicer arietinum [garbanzo]
ref|XP_004511860.1|  PREDICTED: BTB/POZ domain-containing protein...    181   8e-50   Cicer arietinum [garbanzo]
ref|XP_002284242.2|  PREDICTED: BTB/POZ domain-containing protein...    181   9e-50   Vitis vinifera
ref|XP_002983725.1|  hypothetical protein SELMODRAFT_228979             180   9e-50   Selaginella moellendorffii
ref|XP_002989054.1|  hypothetical protein SELMODRAFT_272040             180   1e-49   Selaginella moellendorffii
emb|CAN71562.1|  hypothetical protein VITISV_007563                     180   1e-49   Vitis vinifera
ref|XP_011006799.1|  PREDICTED: BTB/POZ domain-containing protein...    180   1e-49   Populus euphratica
ref|XP_007047478.1|  Phototropic-responsive NPH3 family protein         180   2e-49   
ref|XP_006380639.1|  hypothetical protein POPTR_0007s10060g             179   2e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011012051.1|  PREDICTED: BTB/POZ domain-containing protein...    179   2e-49   Populus euphratica
ref|XP_006339816.1|  PREDICTED: BTB/POZ domain-containing protein...    179   2e-49   Solanum tuberosum [potatoes]
gb|KJB48677.1|  hypothetical protein B456_008G080700                    179   3e-49   Gossypium raimondii
ref|XP_010086959.1|  BTB/POZ domain-containing protein                  179   3e-49   
ref|XP_004149698.1|  PREDICTED: BTB/POZ domain-containing protein...    178   6e-49   
gb|KDO78973.1|  hypothetical protein CISIN_1g006971mg                   176   6e-49   Citrus sinensis [apfelsine]
ref|XP_009628088.1|  PREDICTED: BTB/POZ domain-containing protein...    178   7e-49   Nicotiana tomentosiformis
ref|XP_008457767.1|  PREDICTED: BTB/POZ domain-containing protein...    178   8e-49   Cucumis melo [Oriental melon]
ref|XP_008457766.1|  PREDICTED: BTB/POZ domain-containing protein...    178   9e-49   
ref|XP_006466487.1|  PREDICTED: BTB/POZ domain-containing protein...    177   1e-48   Citrus sinensis [apfelsine]
ref|XP_009782405.1|  PREDICTED: BTB/POZ domain-containing protein...    177   1e-48   Nicotiana sylvestris
ref|XP_004166154.1|  PREDICTED: BTB/POZ domain-containing protein...    178   2e-48   
ref|XP_010559030.1|  PREDICTED: BTB/POZ domain-containing protein...    176   2e-48   Tarenaya hassleriana [spider flower]
ref|XP_010028107.1|  PREDICTED: BTB/POZ domain-containing protein...    177   2e-48   Eucalyptus grandis [rose gum]
ref|XP_010028106.1|  PREDICTED: BTB/POZ domain-containing protein...    177   2e-48   Eucalyptus grandis [rose gum]
ref|XP_004231910.1|  PREDICTED: BTB/POZ domain-containing protein...    176   2e-48   Solanum lycopersicum
gb|KDO78972.1|  hypothetical protein CISIN_1g006971mg                   176   4e-48   Citrus sinensis [apfelsine]
emb|CDP02580.1|  unnamed protein product                                176   4e-48   Coffea canephora [robusta coffee]
ref|XP_006426057.1|  hypothetical protein CICLE_v10025164mg             176   5e-48   Citrus clementina [clementine]
ref|XP_002533158.1|  Root phototropism protein, putative                176   6e-48   Ricinus communis
ref|XP_003597110.1|  Root phototropism protein                          175   7e-48   
ref|XP_006841959.1|  hypothetical protein AMTR_s00144p00020600          175   7e-48   Amborella trichopoda
gb|KJB43881.1|  hypothetical protein B456_007G221600                    172   7e-48   Gossypium raimondii
gb|KHN36285.1|  BTB/POZ domain-containing protein                       175   8e-48   Glycine soja [wild soybean]
ref|XP_003517336.1|  PREDICTED: BTB/POZ domain-containing protein...    175   8e-48   Glycine max [soybeans]
ref|XP_011099322.1|  PREDICTED: BTB/POZ domain-containing protein...    175   1e-47   Sesamum indicum [beniseed]
ref|XP_010277089.1|  PREDICTED: BTB/POZ domain-containing protein...    174   1e-47   
gb|KDP32052.1|  hypothetical protein JCGZ_12513                         174   2e-47   Jatropha curcas
ref|XP_002533880.1|  Root phototropism protein, putative                173   3e-47   
ref|XP_010272171.1|  PREDICTED: BTB/POZ domain-containing protein...    173   3e-47   Nelumbo nucifera [Indian lotus]
ref|XP_006590635.1|  PREDICTED: BTB/POZ domain-containing protein...    173   4e-47   Glycine max [soybeans]
gb|KJB43880.1|  hypothetical protein B456_007G221600                    172   7e-47   Gossypium raimondii
ref|XP_010559028.1|  PREDICTED: BTB/POZ domain-containing protein...    172   9e-47   Tarenaya hassleriana [spider flower]
ref|XP_008238282.1|  PREDICTED: BTB/POZ domain-containing protein...    172   1e-46   
ref|XP_010679598.1|  PREDICTED: BTB/POZ domain-containing protein...    171   2e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003608469.1|  BTB/POZ domain-containing protein                  169   2e-46   
ref|XP_010679597.1|  PREDICTED: BTB/POZ domain-containing protein...    171   2e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010905282.1|  PREDICTED: BTB/POZ domain-containing protein...    171   2e-46   Elaeis guineensis
ref|XP_004288469.1|  PREDICTED: BTB/POZ domain-containing protein...    170   5e-46   Fragaria vesca subsp. vesca
ref|XP_007208165.1|  hypothetical protein PRUPE_ppa002888mg             170   5e-46   Prunus persica
gb|KEH28209.1|  root phototropism-like protein                          169   5e-46   Medicago truncatula
gb|AES90666.2|  phototropic-responsive NPH3 family protein              169   1e-45   Medicago truncatula
gb|KHN12984.1|  BTB/POZ domain-containing protein                       169   2e-45   Glycine soja [wild soybean]
ref|XP_009342777.1|  PREDICTED: BTB/POZ domain-containing protein...    168   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_008354715.1|  PREDICTED: BTB/POZ domain-containing protein...    167   4e-45   
ref|XP_004233453.1|  PREDICTED: BTB/POZ domain-containing protein...    167   5e-45   
gb|EPS72379.1|  hypothetical protein M569_02379                         166   8e-45   Genlisea aurea
ref|XP_002866705.1|  signal transducer                                  166   1e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_009611132.1|  PREDICTED: BTB/POZ domain-containing protein...    166   1e-44   Nicotiana tomentosiformis
ref|XP_008352542.1|  PREDICTED: BTB/POZ domain-containing protein...    164   2e-44   
ref|XP_010939121.1|  PREDICTED: BTB/POZ domain-containing protein...    166   2e-44   Elaeis guineensis
ref|XP_002521098.1|  protein binding protein, putative                  165   3e-44   Ricinus communis
ref|XP_008372448.1|  PREDICTED: BTB/POZ domain-containing protein...    163   3e-44   
ref|XP_004509079.1|  PREDICTED: BTB/POZ domain-containing protein...    164   4e-44   Cicer arietinum [garbanzo]
ref|XP_009766799.1|  PREDICTED: BTB/POZ domain-containing protein...    164   5e-44   Nicotiana sylvestris
ref|XP_004511859.1|  PREDICTED: BTB/POZ domain-containing protein...    165   5e-44   
ref|XP_006364419.1|  PREDICTED: BTB/POZ domain-containing protein...    164   5e-44   Solanum tuberosum [potatoes]
ref|XP_009599429.1|  PREDICTED: BTB/POZ domain-containing protein...    164   5e-44   Nicotiana tomentosiformis
ref|XP_009630230.1|  PREDICTED: BTB/POZ domain-containing protein...    162   6e-44   
ref|XP_004511857.1|  PREDICTED: BTB/POZ domain-containing protein...    164   6e-44   
ref|XP_006380638.1|  hypothetical protein POPTR_0007s10060g             164   7e-44   
ref|XP_011089690.1|  PREDICTED: BTB/POZ domain-containing protein...    161   1e-43   Sesamum indicum [beniseed]
ref|XP_001770455.1|  predicted protein                                  163   1e-43   
ref|XP_008382632.1|  PREDICTED: BTB/POZ domain-containing protein...    162   2e-43   
ref|XP_009792130.1|  PREDICTED: BTB/POZ domain-containing protein...    162   3e-43   Nicotiana sylvestris
ref|XP_009334929.1|  PREDICTED: BTB/POZ domain-containing protein...    162   4e-43   Pyrus x bretschneideri [bai li]
ref|XP_009630229.1|  PREDICTED: BTB/POZ domain-containing protein...    162   4e-43   Nicotiana tomentosiformis
ref|XP_007201187.1|  hypothetical protein PRUPE_ppa002993mg             162   5e-43   Prunus persica
ref|XP_011089103.1|  PREDICTED: BTB/POZ domain-containing protein...    162   5e-43   Sesamum indicum [beniseed]
ref|XP_010028108.1|  PREDICTED: BTB/POZ domain-containing protein...    162   5e-43   Eucalyptus grandis [rose gum]
ref|XP_004247086.1|  PREDICTED: BTB/POZ domain-containing protein...    161   5e-43   Solanum lycopersicum
ref|XP_011089689.1|  PREDICTED: BTB/POZ domain-containing protein...    161   5e-43   Sesamum indicum [beniseed]
ref|XP_001763717.1|  predicted protein                                  161   5e-43   
ref|XP_003600551.1|  Root phototropism protein                          160   5e-43   
ref|XP_011089687.1|  PREDICTED: BTB/POZ domain-containing protein...    161   6e-43   Sesamum indicum [beniseed]
ref|XP_006356774.1|  PREDICTED: BTB/POZ domain-containing protein...    161   6e-43   Solanum tuberosum [potatoes]
ref|XP_011089686.1|  PREDICTED: BTB/POZ domain-containing protein...    161   6e-43   Sesamum indicum [beniseed]
ref|XP_004240632.1|  PREDICTED: BTB/POZ domain-containing protein...    161   6e-43   Solanum lycopersicum
ref|XP_008235484.1|  PREDICTED: BTB/POZ domain-containing protein...    161   7e-43   Prunus mume [ume]
gb|EYU40606.1|  hypothetical protein MIMGU_mgv1a003057mg                161   8e-43   Erythranthe guttata [common monkey flower]
gb|AAU05485.1|  At5g67385                                               160   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009780159.1|  PREDICTED: BTB/POZ domain-containing protein...    160   1e-42   Nicotiana sylvestris
ref|NP_680473.2|  phototropic-responsive NPH3-like protein              160   1e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28391.1|  hypothetical protein AALP_AA8G509000                    160   1e-42   Arabis alpina [alpine rockcress]
ref|XP_006393938.1|  hypothetical protein EUTSA_v10003858mg             160   2e-42   Eutrema salsugineum [saltwater cress]
dbj|BAJ34215.1|  unnamed protein product                                160   2e-42   Eutrema halophilum
ref|XP_006280202.1|  hypothetical protein CARUB_v10026107mg             160   2e-42   Capsella rubella
gb|KDP26391.1|  hypothetical protein JCGZ_17549                         159   3e-42   Jatropha curcas
gb|KHN13450.1|  BTB/POZ domain-containing protein                       159   3e-42   Glycine soja [wild soybean]
ref|XP_007155848.1|  hypothetical protein PHAVU_003G236800g             159   3e-42   Phaseolus vulgaris [French bean]
ref|XP_008787157.1|  PREDICTED: BTB/POZ domain-containing protein...    159   3e-42   Phoenix dactylifera
ref|XP_006844655.1|  hypothetical protein AMTR_s00016p00237490          159   3e-42   Amborella trichopoda
ref|XP_010484507.1|  PREDICTED: BTB/POZ domain-containing protein...    159   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010109730.1|  BTB/POZ domain-containing protein                  159   4e-42   Morus notabilis
gb|KJB26098.1|  hypothetical protein B456_004G225600                    159   4e-42   Gossypium raimondii
ref|XP_011024680.1|  PREDICTED: BTB/POZ domain-containing protein...    159   4e-42   Populus euphratica
ref|XP_010524688.1|  PREDICTED: BTB/POZ domain-containing protein...    159   4e-42   Tarenaya hassleriana [spider flower]
ref|XP_002301784.2|  hypothetical protein POPTR_0002s24380g             159   5e-42   Populus trichocarpa [western balsam poplar]
ref|XP_007049780.1|  Phototropic-responsive NPH3 family protein         158   8e-42   
ref|XP_003551322.2|  PREDICTED: BTB/POZ domain-containing protein...    158   9e-42   Glycine max [soybeans]
ref|XP_010464139.1|  PREDICTED: BTB/POZ domain-containing protein...    158   9e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006443605.1|  hypothetical protein CICLE_v10019330mg             158   9e-42   Citrus clementina [clementine]
gb|KHG21232.1|  hypothetical protein F383_08117                         158   1e-41   Gossypium arboreum [tree cotton]
ref|XP_010277091.1|  PREDICTED: BTB/POZ domain-containing protein...    157   1e-41   
emb|CDY43566.1|  BnaC02g16630D                                          152   2e-41   Brassica napus [oilseed rape]
ref|XP_011459733.1|  PREDICTED: BTB/POZ domain-containing protein...    157   2e-41   Fragaria vesca subsp. vesca
ref|XP_003520918.1|  PREDICTED: BTB/POZ domain-containing protein...    157   2e-41   Glycine max [soybeans]
ref|XP_007050812.1|  Phototropic-responsive NPH3 family protein i...    157   2e-41   Theobroma cacao [chocolate]
gb|EYU39234.1|  hypothetical protein MIMGU_mgv1a003527mg                157   2e-41   Erythranthe guttata [common monkey flower]
gb|KHG00255.1|  hypothetical protein F383_19997                         157   2e-41   Gossypium arboreum [tree cotton]
gb|KJB42465.1|  hypothetical protein B456_007G154300                    157   2e-41   Gossypium raimondii
ref|XP_002961348.1|  hypothetical protein SELMODRAFT_74933              156   3e-41   
ref|XP_010036820.1|  PREDICTED: BTB/POZ domain-containing protein...    156   4e-41   Eucalyptus grandis [rose gum]
gb|EYU46717.1|  hypothetical protein MIMGU_mgv1a003257mg                156   4e-41   Erythranthe guttata [common monkey flower]
ref|XP_009379310.1|  PREDICTED: BTB/POZ domain-containing protein...    156   4e-41   Pyrus x bretschneideri [bai li]
ref|XP_010685004.1|  PREDICTED: BTB/POZ domain-containing protein...    156   4e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008465052.1|  PREDICTED: BTB/POZ domain-containing protein...    156   5e-41   Cucumis melo [Oriental melon]
ref|XP_006600924.1|  PREDICTED: BTB/POZ domain-containing protein...    155   6e-41   Glycine max [soybeans]
ref|XP_006395119.1|  hypothetical protein EUTSA_v10003813mg             155   7e-41   
ref|XP_004506596.1|  PREDICTED: BTB/POZ domain-containing protein...    155   7e-41   Cicer arietinum [garbanzo]
dbj|BAC41926.1|  non-phototropic hypocotyl-like protein                 151   8e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007133999.1|  hypothetical protein PHAVU_010G010500g             155   8e-41   Phaseolus vulgaris [French bean]
emb|CBI37309.3|  unnamed protein product                                155   8e-41   Vitis vinifera
ref|XP_009411062.1|  PREDICTED: BTB/POZ domain-containing protein...    155   9e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002265786.1|  PREDICTED: BTB/POZ domain-containing protein...    155   9e-41   Vitis vinifera
ref|XP_003604967.1|  BTB/POZ domain-containing protein                  155   1e-40   Medicago truncatula
gb|KHG21965.1|  hypothetical protein F383_08186                         155   1e-40   Gossypium arboreum [tree cotton]
emb|CDX85365.1|  BnaC07g26760D                                          155   1e-40   
ref|XP_009151678.1|  PREDICTED: BTB/POZ domain-containing protein...    155   1e-40   Brassica rapa
emb|CDX86278.1|  BnaA06g29950D                                          155   1e-40   
dbj|BAJ33928.1|  unnamed protein product                                155   1e-40   Eutrema halophilum
ref|XP_010264099.1|  PREDICTED: BTB/POZ domain-containing protein...    154   1e-40   
emb|CDY68489.1|  BnaCnng59210D                                          153   2e-40   Brassica napus [oilseed rape]
emb|CDY37857.1|  BnaAnng05180D                                          154   2e-40   Brassica napus [oilseed rape]
ref|XP_009103425.1|  PREDICTED: BTB/POZ domain-containing protein...    154   2e-40   Brassica rapa
ref|XP_009130549.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    154   2e-40   Brassica rapa
ref|XP_010264098.1|  PREDICTED: BTB/POZ domain-containing protein...    154   3e-40   Nelumbo nucifera [Indian lotus]
ref|XP_006579934.1|  PREDICTED: BTB/POZ domain-containing protein...    154   3e-40   Glycine max [soybeans]
ref|XP_007050813.1|  Phototropic-responsive NPH3 family protein i...    154   3e-40   Theobroma cacao [chocolate]
gb|KGN58361.1|  hypothetical protein Csa_3G627720                       154   3e-40   Cucumis sativus [cucumbers]
ref|XP_006845260.1|  hypothetical protein AMTR_s00005p00262560          154   4e-40   
emb|CDY57436.1|  BnaAnng14510D                                          153   4e-40   Brassica napus [oilseed rape]
ref|XP_009406358.1|  PREDICTED: BTB/POZ domain-containing protein...    153   4e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009371616.1|  PREDICTED: BTB/POZ domain-containing protein...    153   4e-40   Pyrus x bretschneideri [bai li]
ref|XP_010245988.1|  PREDICTED: BTB/POZ domain-containing protein...    153   5e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010241864.1|  PREDICTED: BTB/POZ domain-containing protein...    153   6e-40   Nelumbo nucifera [Indian lotus]
ref|XP_002863924.1|  phototropic-responsive NPH3 family protein         153   6e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_010482146.1|  PREDICTED: BTB/POZ domain-containing protein...    152   8e-40   Camelina sativa [gold-of-pleasure]
ref|XP_001769248.1|  predicted protein                                  152   8e-40   
ref|XP_010439675.1|  PREDICTED: BTB/POZ domain-containing protein...    152   9e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010652500.1|  PREDICTED: BTB/POZ domain-containing protein...    152   1e-39   Vitis vinifera
emb|CDY12841.1|  BnaC07g15920D                                          152   1e-39   Brassica napus [oilseed rape]
gb|KFK31290.1|  hypothetical protein AALP_AA6G093300                    152   1e-39   Arabis alpina [alpine rockcress]
ref|NP_199691.1|  phototropic-responsive NPH3 protein                   152   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011079726.1|  PREDICTED: BTB/POZ domain-containing protein...    152   1e-39   Sesamum indicum [beniseed]
ref|XP_004247452.1|  PREDICTED: BTB/POZ domain-containing protein...    152   2e-39   Solanum lycopersicum
gb|KHG21966.1|  hypothetical protein F383_08186                         152   2e-39   Gossypium arboreum [tree cotton]
ref|XP_006281736.1|  hypothetical protein CARUB_v10027892mg             152   2e-39   Capsella rubella
gb|KJB23203.1|  hypothetical protein B456_004G086600                    152   2e-39   Gossypium raimondii
gb|KJB41979.1|  hypothetical protein B456_007G130600                    152   2e-39   Gossypium raimondii
ref|XP_006359421.1|  PREDICTED: BTB/POZ domain-containing protein...    151   2e-39   Solanum tuberosum [potatoes]
ref|XP_010112756.1|  BTB/POZ domain-containing protein                  151   3e-39   Morus notabilis
ref|XP_004136051.1|  PREDICTED: BTB/POZ domain-containing protein...    151   3e-39   Cucumis sativus [cucumbers]
ref|XP_006404081.1|  hypothetical protein EUTSA_v10010248mg             150   4e-39   Eutrema salsugineum [saltwater cress]
ref|XP_004170411.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    151   4e-39   
ref|XP_008451623.1|  PREDICTED: BTB/POZ domain-containing protein...    151   4e-39   Cucumis melo [Oriental melon]
ref|XP_009414870.1|  PREDICTED: BTB/POZ domain-containing protein...    150   5e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006651150.1|  PREDICTED: BTB/POZ domain-containing protein...    149   5e-39   
ref|XP_011082488.1|  PREDICTED: BTB/POZ domain-containing protein...    150   5e-39   Sesamum indicum [beniseed]
ref|XP_001764279.1|  predicted protein                                  150   5e-39   
dbj|BAK07863.1|  predicted protein                                      150   7e-39   
ref|XP_002465671.1|  hypothetical protein SORBIDRAFT_01g043470          150   8e-39   
gb|KJB47066.1|  hypothetical protein B456_008G009400                    149   8e-39   
ref|XP_010241873.1|  PREDICTED: BTB/POZ domain-containing protein...    149   9e-39   
ref|XP_009595976.1|  PREDICTED: BTB/POZ domain-containing protein...    149   1e-38   
ref|XP_006583767.1|  PREDICTED: root phototropism protein 3-like ...    149   1e-38   
ref|XP_003558544.1|  PREDICTED: BTB/POZ domain-containing protein...    149   1e-38   
ref|XP_006359422.1|  PREDICTED: BTB/POZ domain-containing protein...    149   1e-38   
ref|XP_010326604.1|  PREDICTED: BTB/POZ domain-containing protein...    149   1e-38   
gb|KHG22134.1|  hypothetical protein F383_09600                         149   1e-38   
ref|XP_011082489.1|  PREDICTED: BTB/POZ domain-containing protein...    149   2e-38   
gb|KHN09117.1|  Root phototropism protein 3                             149   2e-38   
ref|XP_011468065.1|  PREDICTED: BTB/POZ domain-containing protein...    149   2e-38   
ref|XP_007159131.1|  hypothetical protein PHAVU_002G211400g             149   2e-38   
ref|XP_002877714.1|  predicted protein                                  148   2e-38   
gb|KJB47067.1|  hypothetical protein B456_008G009400                    148   2e-38   
ref|XP_010652501.1|  PREDICTED: BTB/POZ domain-containing protein...    148   2e-38   
ref|XP_010317168.1|  PREDICTED: BTB/POZ domain-containing protein...    148   2e-38   
ref|XP_008776569.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    148   3e-38   
gb|KEH31205.1|  phototropic-responsive NPH3 family protein              148   3e-38   
gb|KJB41980.1|  hypothetical protein B456_007G130600                    148   3e-38   
ref|XP_003528390.2|  PREDICTED: root phototropism protein 3-like ...    149   3e-38   
gb|KHG27924.1|  hypothetical protein F383_10949                         148   3e-38   
ref|XP_008451624.1|  PREDICTED: BTB/POZ domain-containing protein...    148   4e-38   
ref|XP_002320358.1|  hypothetical protein POPTR_0014s12800g             148   4e-38   
ref|XP_003608415.1|  Root phototropism protein                          148   4e-38   
ref|XP_011033592.1|  PREDICTED: BTB/POZ domain-containing protein...    148   5e-38   
ref|XP_002267241.2|  PREDICTED: BTB/POZ domain-containing protein...    148   5e-38   
ref|XP_009757790.1|  PREDICTED: BTB/POZ domain-containing protein...    147   5e-38   
gb|KDO64171.1|  hypothetical protein CISIN_1g035818mg                   147   6e-38   
ref|XP_006481239.1|  PREDICTED: BTB/POZ domain-containing protein...    147   6e-38   
ref|XP_006429637.1|  hypothetical protein CICLE_v10011315mg             147   7e-38   
ref|XP_010909076.1|  PREDICTED: BTB/POZ domain-containing protein...    147   9e-38   
gb|EMT21744.1|  BTB/POZ domain-containing protein                       146   9e-38   
ref|XP_006584970.1|  PREDICTED: root phototropism protein 3-like        147   9e-38   
ref|XP_006479889.1|  PREDICTED: BTB/POZ domain-containing protein...    147   9e-38   
gb|KHN46271.1|  Root phototropism protein 3                             147   1e-37   
dbj|BAJ96209.1|  predicted protein                                      147   1e-37   
ref|XP_010921839.1|  PREDICTED: BTB/POZ domain-containing protein...    147   1e-37   
gb|KJB47065.1|  hypothetical protein B456_008G009400                    147   1e-37   
ref|XP_009384760.1|  PREDICTED: root phototropism protein 2-like ...    146   1e-37   
ref|XP_009419048.1|  PREDICTED: BTB/POZ domain-containing protein...    146   2e-37   
ref|XP_011092443.1|  PREDICTED: root phototropism protein 3             147   2e-37   
ref|XP_010426528.1|  PREDICTED: putative BTB/POZ domain-containin...    146   2e-37   
gb|KFK34271.1|  hypothetical protein AALP_AA5G123300                    145   2e-37   
ref|XP_009405608.1|  PREDICTED: BTB/POZ domain-containing protein...    146   2e-37   
gb|KDO42274.1|  hypothetical protein CISIN_1g005842mg                   145   2e-37   
ref|XP_004985270.1|  PREDICTED: BTB/POZ domain-containing protein...    146   2e-37   
emb|CDP03534.1|  unnamed protein product                                146   2e-37   
ref|XP_006841237.1|  hypothetical protein AMTR_s00135p00069650          146   3e-37   
ref|XP_008389180.1|  PREDICTED: BTB/POZ domain-containing protein...    145   3e-37   
ref|XP_006855474.1|  hypothetical protein AMTR_s00057p00189750          145   3e-37   
ref|XP_002522618.1|  hypothetical protein RCOM_0884570                  145   3e-37   
ref|XP_007199752.1|  hypothetical protein PRUPE_ppa002803mg             145   3e-37   
gb|KDP28100.1|  hypothetical protein JCGZ_13871                         145   4e-37   
ref|XP_004504830.1|  PREDICTED: root phototropism protein 3-like ...    145   4e-37   
ref|XP_004504832.1|  PREDICTED: root phototropism protein 3-like ...    145   4e-37   
ref|XP_009626458.1|  PREDICTED: BTB/POZ domain-containing protein...    145   4e-37   
ref|XP_009776597.1|  PREDICTED: BTB/POZ domain-containing protein...    145   4e-37   
ref|XP_010652066.1|  PREDICTED: BTB/POZ domain-containing protein...    145   4e-37   
emb|CDY32491.1|  BnaA09g51050D                                          139   5e-37   
ref|XP_004504829.1|  PREDICTED: root phototropism protein 3-like ...    145   5e-37   
gb|KDP40950.1|  hypothetical protein JCGZ_24949                         145   5e-37   
gb|KJB10961.1|  hypothetical protein B456_001G234000                    143   5e-37   
ref|XP_006420844.1|  hypothetical protein CICLE_v10004479mg             145   6e-37   
gb|KDO42273.1|  hypothetical protein CISIN_1g005842mg                   145   6e-37   
ref|XP_006341291.1|  PREDICTED: BTB/POZ domain-containing protein...    144   6e-37   
ref|XP_009402206.1|  PREDICTED: root phototropism protein 2 isofo...    144   6e-37   
ref|XP_006494598.1|  PREDICTED: root phototropism protein 3-like ...    145   6e-37   
ref|XP_009783326.1|  PREDICTED: BTB/POZ domain-containing protein...    144   8e-37   
ref|XP_011015142.1|  PREDICTED: BTB/POZ domain-containing protein...    144   8e-37   
ref|XP_010098595.1|  BTB/POZ domain-containing protein                  144   8e-37   
ref|XP_010684491.1|  PREDICTED: BTB/POZ domain-containing protein...    144   8e-37   
ref|XP_009378916.1|  PREDICTED: BTB/POZ domain-containing protein...    144   9e-37   
gb|KDP34960.1|  hypothetical protein JCGZ_09248                         144   1e-36   
ref|XP_010069979.1|  PREDICTED: BTB/POZ domain-containing protein...    144   1e-36   
ref|XP_008660160.1|  PREDICTED: BTB/POZ domain-containing protein...    144   1e-36   
ref|XP_006389692.1|  hypothetical protein POPTR_0020s00510g             144   1e-36   
gb|KJB10962.1|  hypothetical protein B456_001G234000                    144   1e-36   
ref|XP_010503666.1|  PREDICTED: putative BTB/POZ domain-containin...    143   1e-36   
ref|XP_006479890.1|  PREDICTED: BTB/POZ domain-containing protein...    144   1e-36   
ref|XP_009631478.1|  PREDICTED: root phototropism protein 3-like        144   1e-36   
ref|XP_009766095.1|  PREDICTED: root phototropism protein 3-like ...    143   1e-36   
emb|CAN60915.1|  hypothetical protein VITISV_002200                     144   1e-36   
ref|XP_002269380.1|  PREDICTED: root phototropism protein 3             144   2e-36   
ref|XP_011033590.1|  PREDICTED: BTB/POZ domain-containing protein...    143   2e-36   
ref|XP_006404279.1|  hypothetical protein EUTSA_v10010186mg             143   2e-36   
ref|XP_009803877.1|  PREDICTED: root phototropism protein 3-like        144   2e-36   
gb|KCW63332.1|  hypothetical protein EUGRSUZ_G00960                     144   2e-36   
ref|XP_006363693.1|  PREDICTED: BTB/POZ domain-containing protein...    143   2e-36   
ref|XP_006595180.1|  PREDICTED: root phototropism protein 3-like ...    142   2e-36   
ref|XP_010065706.1|  PREDICTED: root phototropism protein 3             143   2e-36   
ref|XP_003577427.1|  PREDICTED: BTB/POZ domain-containing protein...    143   3e-36   
ref|XP_009776604.1|  PREDICTED: BTB/POZ domain-containing protein...    142   3e-36   
ref|XP_006595174.1|  PREDICTED: root phototropism protein 3-like ...    142   3e-36   
ref|XP_007033472.1|  Phototropic-responsive NPH3 family protein i...    142   3e-36   
ref|XP_006351743.1|  PREDICTED: root phototropism protein 3-like        143   3e-36   
ref|XP_002988207.1|  hypothetical protein SELMODRAFT_183709             143   3e-36   
ref|XP_002963496.1|  hypothetical protein SELMODRAFT_166345             143   3e-36   
ref|XP_009626459.1|  PREDICTED: BTB/POZ domain-containing protein...    142   3e-36   
ref|XP_009419001.1|  PREDICTED: BTB/POZ domain-containing protein...    142   3e-36   
ref|NP_182307.1|  phototropic-responsive NPH3 family protein SETH6      143   3e-36   
ref|XP_011014242.1|  PREDICTED: root phototropism protein 3-like ...    142   3e-36   
ref|XP_009620326.1|  PREDICTED: BTB/POZ domain-containing protein...    142   3e-36   
ref|XP_007033473.1|  Phototropic-responsive NPH3 family protein i...    142   3e-36   
ref|XP_004230550.1|  PREDICTED: root phototropism protein 3-like        143   4e-36   
emb|CDX83030.1|  BnaA01g20300D                                          142   4e-36   
ref|XP_004984397.1|  PREDICTED: BTB/POZ domain-containing protein...    143   4e-36   
ref|XP_010684492.1|  PREDICTED: BTB/POZ domain-containing protein...    142   4e-36   
gb|KHN31896.1|  Root phototropism protein 3                             142   4e-36   
ref|XP_010241172.1|  PREDICTED: BTB/POZ domain-containing protein...    142   4e-36   
ref|XP_003593245.1|  Root phototropism protein                          143   4e-36   
ref|XP_009766094.1|  PREDICTED: root phototropism protein 3-like ...    142   5e-36   
ref|NP_001049321.2|  Os03g0206700                                       141   5e-36   
ref|XP_011468062.1|  PREDICTED: BTB/POZ domain-containing protein...    142   5e-36   
ref|XP_009775884.1|  PREDICTED: BTB/POZ domain-containing protein...    142   5e-36   
ref|XP_011014241.1|  PREDICTED: root phototropism protein 3-like ...    142   5e-36   
ref|XP_008386633.1|  PREDICTED: BTB/POZ domain-containing protein...    142   5e-36   
gb|EMT33625.1|  BTB/POZ domain-containing protein                       142   5e-36   
ref|XP_006846819.1|  hypothetical protein AMTR_s00148p00085230          142   5e-36   
ref|XP_009605138.1|  PREDICTED: BTB/POZ domain-containing protein...    142   6e-36   
ref|XP_004249834.1|  PREDICTED: BTB/POZ domain-containing protein...    142   6e-36   
ref|XP_003545709.1|  PREDICTED: root phototropism protein 3-like        142   6e-36   
ref|XP_004248794.1|  PREDICTED: root phototropism protein 3-like        142   6e-36   
tpg|DAA43883.1|  TPA: putative phototropic-responsive NPH3 family...    141   6e-36   
ref|XP_006444252.1|  hypothetical protein CICLE_v10019309mg             142   6e-36   
ref|XP_006594679.1|  PREDICTED: root phototropism protein 3-like        142   7e-36   
emb|CAN74119.1|  hypothetical protein VITISV_002050                     144   7e-36   
gb|KHN33549.1|  Root phototropism protein 3                             142   7e-36   
ref|XP_007200957.1|  hypothetical protein PRUPE_ppa002411mg             142   7e-36   
ref|XP_004485981.1|  PREDICTED: BTB/POZ domain-containing protein...    141   7e-36   
ref|XP_010909562.1|  PREDICTED: BTB/POZ domain-containing protein...    142   7e-36   
ref|XP_011012727.1|  PREDICTED: root phototropism protein 3-like        142   7e-36   
ref|XP_009605134.1|  PREDICTED: BTB/POZ domain-containing protein...    141   8e-36   
ref|XP_011023032.1|  PREDICTED: root phototropism protein 3-like        142   8e-36   
ref|XP_002310495.1|  hypothetical protein POPTR_0007s03550g             142   8e-36   
ref|XP_010094827.1|  Root phototropism protein 3                        142   8e-36   
ref|XP_010038174.1|  PREDICTED: BTB/POZ domain-containing protein...    141   8e-36   
gb|KJB79559.1|  hypothetical protein B456_013G057300                    140   9e-36   
gb|KHN19000.1|  Root phototropism protein 3                             142   9e-36   
ref|XP_009608450.1|  PREDICTED: root phototropism protein 3 isofo...    140   9e-36   
ref|XP_002323955.2|  hypothetical protein POPTR_0017s07540g             142   1e-35   
ref|XP_004247004.1|  PREDICTED: BTB/POZ domain-containing protein...    141   1e-35   
emb|CDY30615.1|  BnaAnng03900D                                          140   1e-35   
emb|CAN72130.1|  hypothetical protein VITISV_002335                     141   1e-35   
ref|XP_002520669.1|  protein binding protein, putative                  141   1e-35   
emb|CDY57361.1|  BnaC08g48680D                                          140   1e-35   
gb|AAN77296.1|  Hypothetical protein                                    141   1e-35   
gb|EEC74727.1|  hypothetical protein OsI_10455                          141   1e-35   
ref|XP_004309683.1|  PREDICTED: BTB/POZ domain-containing protein...    141   1e-35   
ref|XP_006468280.1|  PREDICTED: BTB/POZ domain-containing protein...    141   1e-35   
ref|XP_009151299.1|  PREDICTED: BTB/POZ domain-containing protein...    141   1e-35   
gb|KJB32107.1|  hypothetical protein B456_005G224200                    140   1e-35   
gb|KJB32105.1|  hypothetical protein B456_005G224200                    140   1e-35   
ref|XP_004485603.1|  PREDICTED: root phototropism protein 3-like        141   1e-35   
emb|CDY52208.1|  BnaC01g42530D                                          141   1e-35   
ref|XP_010941534.1|  PREDICTED: BTB/POZ domain-containing protein...    140   2e-35   
ref|XP_010545039.1|  PREDICTED: BTB/POZ domain-containing protein...    141   2e-35   
dbj|BAE99857.1|  non-phototropic hypocotyl 3                            140   2e-35   
gb|KJB79558.1|  hypothetical protein B456_013G057300                    141   2e-35   
ref|NP_001119489.1|  root phototropism protein 3                        140   2e-35   
ref|XP_008237216.1|  PREDICTED: root phototropism protein 3             141   2e-35   
gb|KHG29755.1|  Root phototropism 3 -like protein                       141   2e-35   
gb|ACL52494.1|  unknown                                                 140   2e-35   
ref|XP_008225559.1|  PREDICTED: BTB/POZ domain-containing protein...    140   2e-35   
ref|XP_011015143.1|  PREDICTED: BTB/POZ domain-containing protein...    140   2e-35   
emb|CDY37449.1|  BnaC08g45870D                                          139   3e-35   
ref|XP_010905431.1|  PREDICTED: BTB/POZ domain-containing protein...    140   3e-35   
ref|XP_009150509.1|  PREDICTED: root phototropism protein 3 isofo...    140   3e-35   
ref|XP_009368293.1|  PREDICTED: root phototropism protein 3-like        140   3e-35   
ref|XP_008358392.1|  PREDICTED: root phototropism protein 3-like        140   3e-35   
ref|XP_009608443.1|  PREDICTED: root phototropism protein 3 isofo...    140   3e-35   
gb|EPS73600.1|  hypothetical protein M569_01153                         140   3e-35   
ref|XP_011087936.1|  PREDICTED: root phototropism protein 3-like        140   3e-35   
ref|XP_007042874.1|  Phototropic-responsive NPH3 family protein i...    140   3e-35   
ref|XP_006604703.1|  PREDICTED: BTB/POZ domain-containing protein...    140   3e-35   
ref|XP_007163074.1|  hypothetical protein PHAVU_001G203800g             140   3e-35   
gb|KJB32104.1|  hypothetical protein B456_005G224200                    140   3e-35   
ref|XP_003561994.1|  PREDICTED: BTB/POZ domain-containing protein...    140   3e-35   
gb|KHN43539.1|  BTB/POZ domain-containing protein                       140   3e-35   
ref|XP_004294000.1|  PREDICTED: BTB/POZ domain-containing protein...    140   4e-35   
ref|XP_002323684.2|  hypothetical protein POPTR_0016s14670g             139   4e-35   
ref|XP_010412682.1|  PREDICTED: putative BTB/POZ domain-containin...    139   4e-35   
ref|XP_010461680.1|  PREDICTED: root phototropism protein 3 isofo...    140   4e-35   
emb|CDX89922.1|  BnaA10g01600D                                          140   4e-35   
ref|XP_006280132.1|  hypothetical protein CARUB_v10026027mg             140   4e-35   
ref|NP_001152299.1|  transposon protein Mutator sub-class               139   4e-35   
ref|XP_002880327.1|  phototropic-responsive NPH3 family protein         139   4e-35   
ref|XP_006359786.1|  PREDICTED: root phototropism protein 3-like        140   4e-35   
ref|XP_009119585.1|  PREDICTED: BTB/POZ domain-containing protein...    139   4e-35   
gb|EYU42051.1|  hypothetical protein MIMGU_mgv1a003173mg                139   4e-35   
ref|XP_007148380.1|  hypothetical protein PHAVU_006G203600g             140   4e-35   
ref|XP_006650337.1|  PREDICTED: BTB/POZ domain-containing protein...    139   4e-35   
ref|XP_011095171.1|  PREDICTED: BTB/POZ domain-containing protein...    139   5e-35   
emb|CBI38224.3|  unnamed protein product                                139   5e-35   
emb|CDX84515.1|  BnaC03g49850D                                          140   5e-35   
gb|ADV56692.1|  NPH3 family protein                                     140   5e-35   
gb|KFK28125.1|  hypothetical protein AALP_AA8G475700                    140   5e-35   
gb|KCW49991.1|  hypothetical protein EUGRSUZ_K03448                     139   5e-35   
ref|XP_004301628.1|  PREDICTED: root phototropism protein 3             140   5e-35   
ref|XP_006448940.1|  hypothetical protein CICLE_v10014591mg             139   6e-35   
ref|NP_001177059.1|  Os12g0613250                                       138   6e-35   
ref|XP_003518959.1|  PREDICTED: BTB/POZ domain-containing protein...    139   6e-35   
ref|XP_011001651.1|  PREDICTED: BTB/POZ domain-containing protein...    139   6e-35   
ref|XP_010038175.1|  PREDICTED: BTB/POZ domain-containing protein...    139   6e-35   
ref|XP_009150508.1|  PREDICTED: root phototropism protein 3 isofo...    140   6e-35   
ref|XP_009410500.1|  PREDICTED: BTB/POZ domain-containing protein...    139   6e-35   
ref|XP_002889431.1|  phototropic-responsive NPH3 family protein         139   7e-35   
ref|XP_010461672.1|  PREDICTED: root phototropism protein 3 isofo...    140   7e-35   
ref|XP_002863056.1|  phototropic-responsive NPH3 family protein         139   7e-35   
emb|CDY18140.1|  BnaC05g01630D                                          139   7e-35   
ref|NP_568989.1|  root phototropism protein 3                           140   7e-35   
gb|AAF05914.1|AF180390_1  non-phototropic hypocotyl 3                   140   7e-35   
dbj|BAB09864.1|  non-phototropic hypocotyl 3                            140   7e-35   
ref|XP_009115683.1|  PREDICTED: BTB/POZ domain-containing protein...    138   8e-35   
ref|XP_009366303.1|  PREDICTED: root phototropism protein 3             139   8e-35   
ref|XP_009115684.1|  PREDICTED: BTB/POZ domain-containing protein...    138   8e-35   
ref|XP_009362255.1|  PREDICTED: BTB/POZ domain-containing protein...    139   8e-35   
gb|EYU39117.1|  hypothetical protein MIMGU_mgv1a002358mg                139   8e-35   
gb|ACA64834.1|  SKIP interacting protein 17                             139   8e-35   



>ref|XP_011089543.1| PREDICTED: root phototropism protein 2-like [Sesamum indicum]
Length=563

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 156/167 (93%), Positives = 165/167 (99%), Gaps = 0/167 (0%)
 Frame = +2

Query  65   ATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  244
            A RLSLAMERTGQWVFSQEIPTDVIVEVGEA+FSLHKFMLVAKSN+IRKLI+DSKEADLT
Sbjct  2    ANRLSLAMERTGQWVFSQEIPTDVIVEVGEANFSLHKFMLVAKSNHIRKLILDSKEADLT  61

Query  245  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  424
            RI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED
Sbjct  62   RIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  121

Query  425  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            FLSQVAL+SLSGALVVLKSCE+LLP+AEDLKIVQRCVE+ASAKACVE
Sbjct  122  FLSQVALTSLSGALVVLKSCEDLLPMAEDLKIVQRCVEIASAKACVE  168



>emb|CDP04035.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASPL + ++RLSLAMERTGQWVFSQEIPTDV+VEVG+A+FSLHKFMLVAKSN IRKLI+
Sbjct  1    MASPLVNNSSRLSLAMERTGQWVFSQEIPTDVLVEVGKATFSLHKFMLVAKSNCIRKLIL  60

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKEADLTRI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  61   ESKEADLTRIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  120

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDFLSQVAL SLSGA+VVLKSCE+LLPLAEDL+IVQRCV++ S+KACVE
Sbjct  121  NLAGRTEDFLSQVALPSLSGAVVVLKSCEDLLPLAEDLRIVQRCVDVVSSKACVE  175



>gb|KHG08105.1| Root phototropism 2 -like protein [Gossypium arboreum]
Length=507

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 169/175 (97%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+PL+S  +RLS AMERTGQWVFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLIM
Sbjct  1    MATPLRSN-SRLSTAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            ++ EADLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   ETNEADLTRINLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDFLSQVALSSLSGA+VVLKSCE+LLP+AE+LKIVQRC+++ASA+AC E
Sbjct  120  NLAGRTEDFLSQVALSSLSGAVVVLKSCEDLLPMAEELKIVQRCIDVASARACNE  174



>gb|KJB26284.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=574

 Score =   286 bits (731),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 169/175 (97%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+PL+S  +RLS AMERTGQWVFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLIM
Sbjct  1    MATPLRSN-SRLSTAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            ++ EADLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   ETNEADLTRINLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDFLSQVALSSLSGA+VVLKSCE+LLP+AE+LKIVQRC+++ASA+AC E
Sbjct  120  NLAGRTEDFLSQVALSSLSGAVVVLKSCEDLLPMAEELKIVQRCIDVASARACNE  174



>ref|XP_004243653.1| PREDICTED: root phototropism protein 2 [Solanum lycopersicum]
Length=576

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 166/175 (95%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+PLK+   RLSLAMERTGQWVFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLKNT-NRLSLAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            D+KE+D++RINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   DTKESDVSRINLSDIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLA RTEDFL+QVAL+SLSGALVVLKSCE LLPLA DL I+QRCV++A AKACVE
Sbjct  120  NLASRTEDFLAQVALTSLSGALVVLKSCENLLPLAHDLNIIQRCVDIAGAKACVE  174



>ref|XP_006353728.1| PREDICTED: root phototropism protein 2-like [Solanum tuberosum]
Length=576

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 166/175 (95%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+PLK+   RLSLAMERTGQWVFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLKNT-NRLSLAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            D+KE+D++RINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   DTKESDVSRINLSDIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLA RTEDFL+QVAL+SLSGALVVLKSCE LLPLA DL I+QRCV++A AKACVE
Sbjct  120  NLASRTEDFLAQVALTSLSGALVVLKSCENLLPLAHDLNIIQRCVDIAGAKACVE  174



>ref|XP_009611218.1| PREDICTED: root phototropism protein 2 [Nicotiana tomentosiformis]
Length=575

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 168/175 (96%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P+K+   RLSLAMERTGQWVFSQEIPTDV+VEVGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MAAPIKNT-NRLSLAMERTGQWVFSQEIPTDVVVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE ++TRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAA+YLQMTDKYCDN
Sbjct  60   ESKETEVTRINLSEIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAADYLQMTDKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLA RTEDFL+QVAL+SLSGALVVLKSCE LLPLAE+LKIVQRCVE+ASAKACVE
Sbjct  120  NLASRTEDFLAQVALTSLSGALVVLKSCENLLPLAEELKIVQRCVEIASAKACVE  174



>gb|EYU36889.1| hypothetical protein MIMGU_mgv1a003487mg [Erythranthe guttata]
Length=582

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = +2

Query  65   ATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  244
            A R +LAMERTGQWVFSQE+PTDVIVEVGEASFSLHKFMLVAKSN IRKLI+DSKEADLT
Sbjct  2    ANRHNLAMERTGQWVFSQEVPTDVIVEVGEASFSLHKFMLVAKSNLIRKLILDSKEADLT  61

Query  245  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  424
            RINLSGIPGG EIFE++AKFCYGVNFEITVHNVAALRCAAEYLQMTD YCDNNLAGRTED
Sbjct  62   RINLSGIPGGAEIFEKSAKFCYGVNFEITVHNVAALRCAAEYLQMTDVYCDNNLAGRTED  121

Query  425  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            FLSQVAL+SLSGALVVLKSCE+LLP+AEDL+IVQ+CVE+ASAKACVE
Sbjct  122  FLSQVALTSLSGALVVLKSCEDLLPMAEDLRIVQKCVEIASAKACVE  168



>ref|XP_009777101.1| PREDICTED: root phototropism protein 2 [Nicotiana sylvestris]
Length=574

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 166/175 (95%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA P+K+   RLSLAMERTGQWVFSQEIPTDV+VEVGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MAVPIKNT-NRLSLAMERTGQWVFSQEIPTDVVVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE ++TRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAA+YLQMTDKYCDN
Sbjct  60   ESKETEVTRINLSEIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAADYLQMTDKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLA RTEDFL+QVAL+SLSGALVVLKSCE LLPLAE+L IVQRCVE+ASAKACVE
Sbjct  120  NLASRTEDFLAQVALTSLSGALVVLKSCENLLPLAEELNIVQRCVEIASAKACVE  174



>ref|XP_008358916.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=175

 Score =   264 bits (675),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTEKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAK  553
            NL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP+AEDLKIVQ+CV++A++K
Sbjct  120  NLTGRTEDFLSQVALMSLSGAIVVLKSCEDLLPMAEDLKIVQKCVDVAASK  170



>emb|CBI15801.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  265
            MERTGQWVFSQEIPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SKEADLT I+LS I
Sbjct  1    MERTGQWVFSQEIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKEADLTNIDLSDI  60

Query  266  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqval  445
            PGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD NL+GRTEDFL QVAL
Sbjct  61   PGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDGNLSGRTEDFLKQVAL  120

Query  446  sslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +SLSGA+VVLKSCE+LLP AE+LKIVQRCV++AS KAC E
Sbjct  121  TSLSGAVVVLKSCEDLLPKAEELKIVQRCVDVASTKACNE  160



>ref|XP_010023564.1| PREDICTED: root phototropism protein 2 [Eucalyptus grandis]
 gb|KCW59867.1| hypothetical protein EUGRSUZ_H02604 [Eucalyptus grandis]
Length=570

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 165/175 (94%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P++ A  RLS+AMERTGQWVFSQEIPTDV+V VGEA+FSLHKFML+AKSNYIRKLI+
Sbjct  1    MATPVR-ANERLSIAMERTGQWVFSQEIPTDVVVRVGEANFSLHKFMLLAKSNYIRKLII  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            ++KEADL RI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD+YCDN
Sbjct  60   ETKEADLARIDLSNIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDQYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRT+DFL+QVALSSLSGA+VVLKSCE+LLP+AEDLKIVQRCV+L S  AC E
Sbjct  120  NLAGRTDDFLTQVALSSLSGAIVVLKSCEDLLPMAEDLKIVQRCVDLVSFNACNE  174



>ref|XP_002264896.1| PREDICTED: root phototropism protein 2 isoform X1 [Vitis vinifera]
Length=572

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 162/175 (93%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+ LK    R SLAMERTGQWVFSQEIPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM
Sbjct  1    MAASLK-GNNRRSLAMERTGQWVFSQEIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKEADLT I+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD 
Sbjct  60   ESKEADLTNIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDG  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL+GRTEDFL QVAL+SLSGA+VVLKSCE+LLP AE+LKIVQRCV++AS KAC E
Sbjct  120  NLSGRTEDFLKQVALTSLSGAVVVLKSCEDLLPKAEELKIVQRCVDVASTKACNE  174



>ref|XP_007017103.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOY34722.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=576

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 165/173 (95%), Gaps = 1/173 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P+ S  +R+S AMERTGQWVFSQEIPTDV+VE GEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPVMSN-SRMSSAMERTGQWVFSQEIPTDVVVEAGEANFNLHKFMLVAKSNYIRKLIL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            ++KEADLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD YCD+
Sbjct  60   ETKEADLTRINLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDNYCDS  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            NLAGRTEDFLSQVAL SLSGA+VVLKSCE+LLP+AE+LKIVQRC+++ASA+AC
Sbjct  120  NLAGRTEDFLSQVALHSLSGAVVVLKSCEDLLPMAEELKIVQRCIDIASARAC  172



>gb|KDP45678.1| hypothetical protein JCGZ_17285 [Jatropha curcas]
Length=575

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 163/175 (93%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+PL++  +RLS+AMERTGQWVFSQEIPTDV+V VGEA+FSLHKFMLV+KSN IRKLIM
Sbjct  1    MATPLRNN-SRLSIAMERTGQWVFSQEIPTDVVVVVGEANFSLHKFMLVSKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE DLTRI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD YCDN
Sbjct  60   ESKEPDLTRIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDLYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRT+DFLSQVALSSLSGA+VVLKSCEELLPL EDLKIVQRCV++ S K C E
Sbjct  120  NLAGRTDDFLSQVALSSLSGAIVVLKSCEELLPLTEDLKIVQRCVDVISVKGCNE  174



>ref|XP_008366216.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=577

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 165/175 (94%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTEKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP+AEDLKIVQ+CV++A++KA +E
Sbjct  120  NLTGRTEDFLSQVALMSLSGAIVVLKSCEDLLPMAEDLKIVQKCVDVAASKASIE  174



>gb|KDO54917.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=584

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 161/175 (92%), Gaps = 3/175 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+PL     R S A ERTGQWVFSQEIPTD++V VGEA+F LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLNK---RFSSAKERTGQWVFSQEIPTDIVVAVGEANFPLHKFMLVAKSNYIRKLII  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKEADLTRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAAE+LQMTDKYC+N
Sbjct  58   ESKEADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEFLQMTDKYCEN  117

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDFLSQVALSSLSGA+VVLKSCE LLPLAEDL IVQRC+++A+AKAC E
Sbjct  118  NLAGRTEDFLSQVALSSLSGAVVVLKSCEALLPLAEDLLIVQRCIDVATAKACYE  172



>ref|XP_006432046.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432048.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006464960.1| PREDICTED: root phototropism protein 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR45286.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45288.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=584

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 161/175 (92%), Gaps = 3/175 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+PL     R S A ERTGQWVFSQEIPTD++V VGEA+F LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLNK---RFSSAKERTGQWVFSQEIPTDIVVAVGEANFPLHKFMLVAKSNYIRKLII  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKEADLTRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAAE+LQMTDKYC+N
Sbjct  58   ESKEADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEFLQMTDKYCEN  117

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDFLSQVALSSLSGA+VVLKSCE LLPLAEDL IVQRC+++A+AKAC E
Sbjct  118  NLAGRTEDFLSQVALSSLSGAVVVLKSCEALLPLAEDLLIVQRCIDVATAKACYE  172



>gb|ADL36608.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 165/175 (94%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTEKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP+AEDLKIVQ+CV++A++KA +E
Sbjct  120  NLTGRTEDFLSQVALMSLSGAIVVLKSCEDLLPMAEDLKIVQKCVDVAASKASIE  174



>ref|XP_008349518.1| PREDICTED: LOW QUALITY PROTEIN: root phototropism protein 2-like 
[Malus domestica]
Length=577

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 165/175 (94%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTEKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP+AEDLKIVQ+CV++A++KA +E
Sbjct  120  NLTGRTEDFLSQVALMSLSGAIVVLKSCEDLLPMAEDLKIVQKCVDVAASKASIE  174



>ref|XP_010094443.1| Root phototropism protein 2 [Morus notabilis]
 gb|EXB56024.1| Root phototropism protein 2 [Morus notabilis]
Length=574

 Score =   270 bits (691),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 164/175 (94%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+ +K   +RLSLAMERTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLI+
Sbjct  1    MAASVK-GNSRLSLAMERTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIV  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S E DLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAE+LQM +KYC N
Sbjct  60   ESNEPDLTRINLSNIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEFLQMIEKYCPN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDFL+QVAL+SLSGA+VVLKSCE+LLP+AE+LKIVQRCV++A +KAC E
Sbjct  120  NLAGRTEDFLTQVALTSLSGAIVVLKSCEDLLPMAEELKIVQRCVDVAISKACNE  174



>ref|XP_007206420.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
 gb|EMJ07619.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
Length=583

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 164/175 (94%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS +K   +RLS+AMERTGQW+FSQEIP+DV+VEVGEA+FSLHKFMLVAKSN+IRKL++
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFMLVAKSNHIRKLVL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S E DLTRINLS IPGGPE FE+AAKFCYGVNFEITV NVAALRCAAEYL+MTDKYCDN
Sbjct  60   ESTEPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVQNVAALRCAAEYLEMTDKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL GRTEDFL+QVALSSLSGA+VVLKSCEELLP++EDLKIVQRCV++A++KA +E
Sbjct  120  NLTGRTEDFLTQVALSSLSGAIVVLKSCEELLPISEDLKIVQRCVDVATSKASIE  174



>ref|NP_001280845.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36603.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 162/175 (93%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS L S   RLSLAMERTGQW+ SQ+IP+DV+VEVGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASSL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRINLS IPGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MTDKYC+N
Sbjct  60   ESKQPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTDKYCEN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL GRTEDFL+QVAL+SLSGA+VVLK+CE+LLP+AEDLKIVQRCV++A++K  +E
Sbjct  120  NLTGRTEDFLAQVALTSLSGAIVVLKTCEDLLPMAEDLKIVQRCVDVATSKVSIE  174



>ref|XP_008239637.1| PREDICTED: root phototropism protein 2 isoform X2 [Prunus mume]
Length=584

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 163/175 (93%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS +K   +RLS+AMERTGQW+FSQEIP+DV+VEVGEA+FSLHKFMLVAKSN+IRKL++
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFMLVAKSNHIRKLVL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S E DLTRINLS IPGGPE FE+AAKFCYGVNFEITV NVAALRCAAEYL+MTDKYCDN
Sbjct  60   ESTEPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVQNVAALRCAAEYLEMTDKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL GRTEDFL+QVALSSLSGA+VVLKSCEELLP+AEDLKIV RCV++A++KA +E
Sbjct  120  NLTGRTEDFLTQVALSSLSGAIVVLKSCEELLPIAEDLKIVHRCVDVATSKASIE  174



>ref|XP_009374407.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 164/175 (94%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKQPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTNKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL GRTEDFLSQVAL SLSGA+VVLKSCE+LLP+AEDLKIVQ+CV++A++K  +E
Sbjct  120  NLIGRTEDFLSQVALMSLSGAIVVLKSCEDLLPMAEDLKIVQKCVDVATSKVSIE  174



>ref|XP_008239576.1| PREDICTED: root phototropism protein 2 isoform X1 [Prunus mume]
Length=584

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 163/175 (93%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS +K   +RLS+AMERTGQW+FSQEIP+DV+VEVGEA+FSLHKFMLVAKSN+IRKL++
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFMLVAKSNHIRKLVL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S E DLTRINLS IPGGPE FE+AAKFCYGVNFEITV NVAALRCAAEYL+MTDKYCDN
Sbjct  60   ESTEPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVQNVAALRCAAEYLEMTDKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL GRTEDFL+QVALSSLSGA+VVLKSCEELLP+AEDLKIV RCV++A++KA +E
Sbjct  120  NLTGRTEDFLTQVALSSLSGAIVVLKSCEELLPIAEDLKIVHRCVDVATSKASIE  174



>ref|XP_004294714.1| PREDICTED: root phototropism protein 2 [Fragaria vesca subsp. 
vesca]
Length=581

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS  ++ + RLS+AMERTGQW+FSQ+IP DV+VEVGEA+FSLHKFMLVAKSN IR+LI+
Sbjct  1    MASLAQNNSRRLSIAMERTGQWIFSQDIPADVVVEVGEANFSLHKFMLVAKSNRIRQLIL  60

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S E DLTRINLS IPGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  61   ESDEPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  120

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL+GRTEDFL+QVALSSLSGA+VVLKSCE L P+AEDLKIVQRCVE+ ++K  +E
Sbjct  121  NLSGRTEDFLTQVALSSLSGAIVVLKSCEGLTPMAEDLKIVQRCVEVVTSKVTIE  175



>ref|XP_009355145.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 160/175 (91%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASPL S   RLSLAMERTGQW+ SQ+IP+DV+VEVGEA+F LHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFPLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRI+LS IPGGPE FE+AAKFCYGVNFEITVHNVAALRCA EYL+MTDKYC+N
Sbjct  60   ESKQPDLTRIDLSDIPGGPETFEKAAKFCYGVNFEITVHNVAALRCATEYLEMTDKYCNN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL  RTEDFL+QVAL+SLSGA+VVLK+CE+LLP+AEDLKIVQRCV++A++K  +E
Sbjct  120  NLTSRTEDFLTQVALTSLSGAIVVLKTCEDLLPMAEDLKIVQRCVDVATSKVSIE  174



>ref|NP_001280895.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36607.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 161/175 (92%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS L S   RLSLAMERTGQW+ SQ+IP+DV+VEVGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASSL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRI+LS IPGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MTDKY +N
Sbjct  60   ESKQPDLTRIDLSDIPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTDKYYEN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL GRTEDFL+QVAL+SLSGA+VVLK+CE+LLP+AEDLKIVQRCV++A++K  +E
Sbjct  120  NLTGRTEDFLAQVALTSLSGAIVVLKTCEDLLPMAEDLKIVQRCVDVATSKVSIE  174



>ref|XP_002325631.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEF00013.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=575

 Score =   262 bits (670),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 159/175 (91%), Gaps = 3/175 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASP++S   RLSLAMERTG+WVFS++IPTDV+V V EASFSLHKFML+AKSNYIRKLI 
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKFMLLAKSNYIRKLIF  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE +L RI+LSGIPGGPEIF +AAKFCYGVNFEITV NVAALRCAAEYLQMTD YCDN
Sbjct  58   ESKEPELARIDLSGIPGGPEIFVKAAKFCYGVNFEITVQNVAALRCAAEYLQMTDTYCDN  117

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDF +QVALSSLSGA++VLKSCE+LLPLAED+KIVQRCV+  S KAC E
Sbjct  118  NLAGRTEDFFAQVALSSLSGAIIVLKSCEDLLPLAEDVKIVQRCVDAISLKACNE  172



>ref|XP_011011776.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=595

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 162/176 (92%), Gaps = 1/176 (1%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            +MA+P++S  +RLSL MERT +WVFSQ+IPTDV+V V EA+FSLHKFMLVAKSNYIRKLI
Sbjct  17   DMATPVRSN-SRLSLTMERTDRWVFSQDIPTDVVVVVCEATFSLHKFMLVAKSNYIRKLI  75

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
            ++SKE  LT+I+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD YCD
Sbjct  76   LESKEPALTKIDLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDVYCD  135

Query  398  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             NLAGRTEDFL+QVALSSLSGA+VVLKSCE+LLPLAEDLKIVQRCV++ S KAC E
Sbjct  136  YNLAGRTEDFLAQVALSSLSGAIVVLKSCEDLLPLAEDLKIVQRCVDVISLKACNE  191



>gb|AAB63085.1| unknown protein [Arabidopsis thaliana]
Length=185

 Score =   248 bits (633),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAK  553
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AK
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAK  173



>ref|XP_008451888.1| PREDICTED: root phototropism protein 2 isoform X2 [Cucumis melo]
Length=582

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            M+S +K    R+S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLIM
Sbjct  1    MSSSVK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S EADLTRI+L+ IPGG EIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   ESTEADLTRIDLTDIPGGAEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL GRTEDFLSQVALSSLSGA+VVLKS   LLP+AEDL IV RCV++ S+KAC E
Sbjct  120  NLVGRTEDFLSQVALSSLSGAIVVLKSSHHLLPMAEDLYIVHRCVDVISSKACNE  174



>ref|XP_010244564.1| PREDICTED: root phototropism protein 2 [Nelumbo nucifera]
Length=571

 Score =   259 bits (663),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 162/175 (93%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+ +K++ +R+SLAMERTGQWVFSQEIP+DV++E+GEA+F+LHKFMLVAKS YIR+ IM
Sbjct  1    MATTVKNS-SRVSLAMERTGQWVFSQEIPSDVVIEIGEANFALHKFMLVAKSGYIRRKIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE DLTRI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYL+MTDK  ++
Sbjct  60   ESKEPDLTRIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTDKCSES  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDFLS VAL++L GA+VVLKSCE LLP+A DLKIVQRC+++ASAKAC E
Sbjct  120  NLAGRTEDFLSHVALTTLPGAVVVLKSCELLLPMAADLKIVQRCIDVASAKACSE  174



>ref|XP_006591739.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=516

 Score =   258 bits (659),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 154/179 (86%), Gaps = 3/179 (2%)
 Frame = +2

Query  38   NMASPLKSAAT---RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIR  208
            N   P K  AT   RLSLAMERTGQWVFSQ+IPTDVIVEVGE +FSLHKFMLVAKSNYIR
Sbjct  27   NQNKPHKFMATPNNRLSLAMERTGQWVFSQDIPTDVIVEVGETTFSLHKFMLVAKSNYIR  86

Query  209  KLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDK  388
            KLI++S E++LTRI+LS IPGGP IFE+ AKFCYGVNFEITVHNVA LRCAAE+LQMTD+
Sbjct  87   KLILESDESELTRIDLSDIPGGPSIFEKTAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQ  146

Query  389  YCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            YC+NNLAGRTE+FL+QVA  +L+GA+ VLKSC  LLP A+D+ +V+RCVE  SAKAC E
Sbjct  147  YCENNLAGRTEEFLTQVAFFTLTGAVTVLKSCRHLLPYADDINVVKRCVEAVSAKACSE  205



>ref|XP_002319980.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEE95903.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=578

 Score =   259 bits (663),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 161/175 (92%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P++S  +RLSLAMERT QWVFSQ+IPTDV+V V EA+FSLHKFMLVAKSN IRKLI+
Sbjct  1    MATPVRSN-SRLSLAMERTDQWVFSQDIPTDVVVVVCEATFSLHKFMLVAKSNCIRKLIL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE  LT+I+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD YCD 
Sbjct  60   ESKEPALTKIDLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDVYCDY  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDFL+QVALSSLSGA+VVLKSCE+LLPLAEDLKIVQRCV++ S KAC E
Sbjct  120  NLAGRTEDFLAQVALSSLSGAIVVLKSCEDLLPLAEDLKIVQRCVDVISLKACNE  174



>ref|XP_004147730.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
 ref|XP_004164428.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
Length=582

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            M+S +K    R+S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLIM
Sbjct  1    MSSSMK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S EADLTRI+L+ IPGG EIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   ESTEADLTRIDLTDIPGGAEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL GRTEDFLSQVALSSLSGA+VVLKS   LLP+AEDL IV RCV++ S+KAC E
Sbjct  120  NLIGRTEDFLSQVALSSLSGAIVVLKSSHLLLPMAEDLYIVHRCVDVISSKACNE  174



>ref|XP_004500391.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=569

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 153/175 (87%), Gaps = 4/175 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P      RLSLAMERTGQW+FSQEIPTDVIVEVGEA FSLHKFMLVAKSNYIRKLIM
Sbjct  1    MATP----PNRLSLAMERTGQWIFSQEIPTDVIVEVGEACFSLHKFMLVAKSNYIRKLIM  56

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +++E +LTRI+LS IPGG  IFE+AAKFCYGVNFEITVHNVA LRCAAE+LQMTD+YCDN
Sbjct  57   EAEETELTRIDLSDIPGGSGIFEKAAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCDN  116

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRT++FLS+VA  +L+G++ VLKSC  LLP AEDL IV+RCVE  SAKAC E
Sbjct  117  NLAGRTDEFLSKVAFFTLTGSVTVLKSCSYLLPYAEDLNIVKRCVEAVSAKACSE  171



>ref|XP_011015900.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=579

 Score =   258 bits (658),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 3/175 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASP++S   RLSLAMERTG+WVFS++IPTDV+V V EASFSLHK ML+AKSNYIRKLI 
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKSMLMAKSNYIRKLIF  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE +L RINLSGIPGGPEIF +AAKFCYG NFEITVHNVAALRCAAEYLQMTD YCDN
Sbjct  58   ESKEPELDRINLSGIPGGPEIFVKAAKFCYGFNFEITVHNVAALRCAAEYLQMTDLYCDN  117

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDF +QVALSSLSGA+ VLKSCE+LLPLAED+ IVQRC++  S KAC E
Sbjct  118  NLAGRTEDFFAQVALSSLSGAIFVLKSCEDLLPLAEDVNIVQRCIDAISLKACNE  172



>ref|XP_008451887.1| PREDICTED: root phototropism protein 2 isoform X1 [Cucumis melo]
Length=666

 Score =   259 bits (663),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 157/176 (89%), Gaps = 1/176 (1%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            +M+S +K    R+S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLI
Sbjct  84   SMSSSVK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLI  142

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
            M+S EADLTRI+L+ IPGG EIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD
Sbjct  143  MESTEADLTRIDLTDIPGGAEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  202

Query  398  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NNL GRTEDFLSQVALSSLSGA+VVLKS   LLP+AEDL IV RCV++ S+KAC E
Sbjct  203  NNLVGRTEDFLSQVALSSLSGAIVVLKSSHHLLPMAEDLYIVHRCVDVISSKACNE  258



>gb|AFK45576.1| unknown [Medicago truncatula]
Length=468

 Score =   254 bits (650),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            RLSLAMERTGQWVFSQE+PTDVIVEVGEA F LHKFMLVAKSNYIRKLIM+S E  LTRI
Sbjct  7    RLSLAMERTGQWVFSQEVPTDVIVEVGEARFCLHKFMLVAKSNYIRKLIMESDETHLTRI  66

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
            +LS IPGG  IFE+AAKFCYGVNFEITVHNVA LRCAAE+LQMTD+YCDNNLAGRT++FL
Sbjct  67   DLSDIPGGSGIFEKAAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCDNNLAGRTDEFL  126

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            S+VA  +L+G++ VLKSC  LLP A+DL IV+RCVE ASAKAC E
Sbjct  127  SKVAFFTLTGSVAVLKSCHHLLPYADDLNIVKRCVEAASAKACSE  171



>ref|XP_003600550.1| Root phototropism protein [Medicago truncatula]
 gb|AES70801.1| root phototropism-like protein [Medicago truncatula]
Length=568

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            RLSLAMERTGQWVFSQE+PTDVIVEVGEA F LHKFMLVAKSNYIRKLIM+S E  LTRI
Sbjct  7    RLSLAMERTGQWVFSQEVPTDVIVEVGEARFCLHKFMLVAKSNYIRKLIMESDETHLTRI  66

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
            +LS IPGG  IFE+AAKFCYGVNFEITVHNVA LRCAAE+LQMTD+YCDNNLAGRT++FL
Sbjct  67   DLSDIPGGSGIFEKAAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCDNNLAGRTDEFL  126

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            S+VA  +L+G++ VLKSC  LLP A+DL IV+RCVE ASAKAC E
Sbjct  127  SKVAFFTLTGSVAVLKSCHHLLPYADDLNIVKRCVEAASAKACSE  171



>ref|XP_006410156.1| hypothetical protein EUTSA_v10016728mg [Eutrema salsugineum]
 gb|ESQ51609.1| hypothetical protein EUTSA_v10016728mg [Eutrema salsugineum]
Length=412

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNE  177



>gb|KJB26282.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=558

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  286
            VFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLIM++ EADLTRINLS IPGGPEIF
Sbjct  6    VFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIMETNEADLTRINLSEIPGGPEIF  65

Query  287  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgal  466
            E+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGA+
Sbjct  66   EKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGAV  125

Query  467  vvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            VVLKSCE+LLP+AE+LKIVQRC+++ASA+AC E
Sbjct  126  VVLKSCEDLLPMAEELKIVQRCIDVASARACNE  158



>gb|KGN53487.1| hypothetical protein Csa_4G056750 [Cucumis sativus]
Length=572

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLIM+S EADLTRI+
Sbjct  1    MSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLIMESTEADLTRID  60

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            L+ IPGG EIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL GRTEDFLS
Sbjct  61   LTDIPGGAEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLIGRTEDFLS  120

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKS   LLP+AEDL IV RCV++ S+KAC E
Sbjct  121  QVALSSLSGAIVVLKSSHLLLPMAEDLYIVHRCVDVISSKACNE  164



>ref|XP_011041764.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=574

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 3/175 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASP++S   RLSLAMERTG+WVFS++IPTDV+V V EASFSLHK ML+AKSNYIRKLI 
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKSMLMAKSNYIRKLIF  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE +L RINLSGIPGGPEIF +AAKFCYG NFEITVHNVAALRCAAEYLQMTD YCD 
Sbjct  58   ESKEPELDRINLSGIPGGPEIFVKAAKFCYGFNFEITVHNVAALRCAAEYLQMTDVYCDY  117

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDFL+QVALSSLSGA+ VLKSCE+LLPLAED+ IVQRC++  S KAC E
Sbjct  118  NLAGRTEDFLAQVALSSLSGAIFVLKSCEDLLPLAEDVNIVQRCIDAISLKACNE  172



>ref|XP_006293884.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
 gb|EOA26782.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
Length=593

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDVIVEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVIVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNE  177



>gb|AAF33112.1|AF181683_1 RPT2 [Arabidopsis thaliana]
Length=593

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNE  177



>dbj|BAF02185.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNE  177



>ref|XP_010414259.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=595

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SKE+D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKESDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS +PGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDMPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++ +AKAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVAAKACNE  177



>ref|NP_850147.1| Root phototropism protein 2 [Arabidopsis thaliana]
 sp|Q682S0.2|RPT2_ARATH RecName: Full=Root phototropism protein 2; AltName: Full=BTB/POZ 
domain-containing protein RPT2 [Arabidopsis thaliana]
 gb|AAK59568.1| unknown protein [Arabidopsis thaliana]
 gb|AAL07245.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31821.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94074.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD94572.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD95385.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01595.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01673.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02233.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08401.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=593

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNE  177



>ref|XP_010677799.1| PREDICTED: root phototropism protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   252 bits (644),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +2

Query  83   AMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSG  262
            A+ERTGQWVFSQEIPTD++++VGEA+FSLHKFMLVAKSNYIR+LI++SKE+DL R++L+ 
Sbjct  23   ALERTGQWVFSQEIPTDIVIQVGEAAFSLHKFMLVAKSNYIRRLILESKESDLGRLDLTD  82

Query  263  IPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqva  442
            IPGGPEIFE+AAKFCYGVNFEIT+HNVAALRCAAEYLQMTDK CDNNLA RTEDFL QVA
Sbjct  83   IPGGPEIFEKAAKFCYGVNFEITIHNVAALRCAAEYLQMTDKSCDNNLANRTEDFLCQVA  142

Query  443  lsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            L++LSGAL+VLK+CE+LLP+A DL IVQR V++ SAKAC E
Sbjct  143  LTNLSGALIVLKTCEDLLPMALDLNIVQRSVDVISAKACSE  183



>ref|XP_003553189.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=573

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 150/175 (86%), Gaps = 4/175 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P      RLSLAMERTGQWVFSQ+IPTDVIVEVGE  FSLHKFMLVAKSNYIRKLI+
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETIFSLHKFMLVAKSNYIRKLIL  56

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S E +LTRI LS IPGGP IFE+ AKFCYGVNFEITVHNVA LRCAAE+LQMTD+YC+N
Sbjct  57   ESNEGELTRIYLSDIPGGPSIFEKTAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCEN  116

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTE+FL+QVA  +L+GA+ VLKSC  LLP A+++ +V+RCVE  SAKAC E
Sbjct  117  NLAGRTEEFLTQVAFFTLTGAVTVLKSCRHLLPYADEINVVKRCVEAVSAKACSE  171



>gb|KFK22949.1| root phototropism protein 2 [Arabis alpina]
Length=596

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++ +AKAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVAAKACNE  177



>emb|CDY10743.1| BnaA05g11930D [Brassica napus]
Length=581

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC E
Sbjct  134  QVALSSLSGAVVVLKSCEILLPISRDLGIVRRCVDVVGAKACNE  177



>dbj|BAJ33924.1| unnamed protein product [Thellungiella halophila]
Length=597

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNE  177



>ref|XP_009144295.1| PREDICTED: root phototropism protein 2 [Brassica rapa]
Length=591

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC E
Sbjct  134  QVALSSLSGAVVVLKSCEILLPISRDLGIVRRCVDVVGAKACNE  177



>ref|XP_011080638.1| PREDICTED: root phototropism protein 2 [Sesamum indicum]
Length=570

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 152/175 (87%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            M +P+K  +  +SLAMER GQWVFSQE+PTDV+VEVGE SFSLHKFMLV KSN+IR+LI+
Sbjct  1    MPNPIKHNSN-ISLAMERAGQWVFSQELPTDVVVEVGEMSFSLHKFMLVGKSNHIRELIL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ D  RI+LSG+PGG E FE  A FCYG NFEITVHNVAALRCAAEYLQMTD YC N
Sbjct  60   ESKDVDCARIDLSGVPGGAETFETVANFCYGFNFEITVHNVAALRCAAEYLQMTDSYCKN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            + AGRTEDFLSQVAL+S+SGAL VLKSCEELLP+AEDLKIVQRCVE+ASA+ C E
Sbjct  120  SFAGRTEDFLSQVALTSMSGALAVLKSCEELLPMAEDLKIVQRCVEIASAEVCFE  174



>ref|XP_002881117.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57376.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
Length=593

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S ++ RTGQWVFSQ+IPTDVIVEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLARTGQWVFSQDIPTDVIVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL +V+RCV++  AKAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGLVRRCVDVVGAKACNE  177



>dbj|BAF01791.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01873.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01940.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPG PEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGDPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGAKACNE  177



>emb|CDY02075.1| BnaC04g14260D [Brassica napus]
Length=580

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK+ D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDIDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +S IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   ISDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++  AKAC E
Sbjct  134  QVALSSLSGAVVVLKSCEILLPISRDLGIVRRCVDVVGAKACNE  177



>ref|XP_010469846.1| PREDICTED: root phototropism protein 2 isoform X1 [Camelina sativa]
 ref|XP_010469847.1| PREDICTED: root phototropism protein 2 isoform X2 [Camelina sativa]
Length=595

 Score =   250 bits (638),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLI++SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIIESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS +PGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDMPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++ +AKAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVAAKACNE  177



>ref|XP_010510344.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=596

 Score =   249 bits (637),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS +PGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYC+NNLAGRT+DFLS
Sbjct  74   LSDMPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCNNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++ +AKAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVAAKACNE  177



>ref|XP_007146905.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
 gb|ESW18899.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
Length=573

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 151/175 (86%), Gaps = 4/175 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P      RLSLAMERTGQWVFSQ+IPTDVIVEVGE SFSLHKFMLVAKSNYIRKLI+
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETSFSLHKFMLVAKSNYIRKLIL  56

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            ++ E ++TRI+LS IPGGP IFE+ AKFCYGVNFEITV+NVA LRCAAE+LQMTD+YC+N
Sbjct  57   EANENEVTRIDLSDIPGGPAIFEKTAKFCYGVNFEITVNNVAVLRCAAEFLQMTDQYCEN  116

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NL GRTE+FL+QVA  +L+GA+ VLKSC  LLP A+D+ +V+RCVE  SAKAC E
Sbjct  117  NLTGRTEEFLTQVAFFTLTGAVTVLKSCRNLLPYADDINVVKRCVEAVSAKACSE  171



>ref|XP_010557176.1| PREDICTED: root phototropism protein 2 [Tarenaya hassleriana]
Length=575

 Score =   246 bits (629),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S AMERT QWVFSQ+IPTDV+VEV EA+FSLHKFMLVAKSNYIRKLIM+SK+ DLTRI+
Sbjct  12   MSSAMERTDQWVFSQDIPTDVVVEVCEANFSLHKFMLVAKSNYIRKLIMESKDTDLTRID  71

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCD+NLAGRT+DFLS
Sbjct  72   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDSNLAGRTQDFLS  131

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP+A+DL IV+RC ++ S+KAC E
Sbjct  132  QVALSSLSGAVVVLKSCELLLPMAQDLGIVKRCFDVISSKACNE  175



>emb|CDY23992.1| BnaC03g16990D [Brassica napus]
Length=565

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S  ++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSTLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGG E+FE+AAKFCYGV+FEITV NVAAL+CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGAEMFEKAAKFCYGVSFEITVQNVAALQCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++   KAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGTKACDE  177



>ref|XP_010044625.1| PREDICTED: root phototropism protein 2-like [Eucalyptus grandis]
 gb|KCW86717.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=570

 Score =   244 bits (622),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS +KS     S+AMERT QW+ S++ PTDV V V +A+FSLHKFMLVAKSNY+RK++M
Sbjct  1    MASHVKSNGGN-SIAMERTSQWLLSKKFPTDVDVIVSKANFSLHKFMLVAKSNYMRKMVM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKEADLTRI+LS  PGGPEIFE+AA FCY ++FEITV NVAALRCAAEYL+MTD+YCDN
Sbjct  60   ESKEADLTRIDLSDFPGGPEIFEKAANFCYNIDFEITVKNVAALRCAAEYLEMTDQYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDFL QVA SSLSG ++VLKSCE+LLP+AEDLKIVQRC+++ASAK C E
Sbjct  120  NLAGRTEDFLVQVAFSSLSGTILVLKSCEDLLPMAEDLKIVQRCLDVASAKVCKE  174



>ref|XP_003544940.2| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=579

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 148/175 (85%), Gaps = 3/175 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P     TR SLAMERTGQWVFS EIPTDVIV VGE++FSLHKF+L AKSNYIRK+IM
Sbjct  1    MATP---NPTRFSLAMERTGQWVFSPEIPTDVIVAVGESTFSLHKFILAAKSNYIRKVIM  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S+E+DLTRI +S IPGG E FE+AAKFCYGVNFEITVHNVAAL CAA +LQMTD+YCD 
Sbjct  58   ESEESDLTRIEISNIPGGQEAFEKAAKFCYGVNFEITVHNVAALHCAAVFLQMTDEYCDG  117

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDFLSQV LS+L  A+ VLKSC++LLP A ++ IV RCVE  S+KAC E
Sbjct  118  NLAGRTEDFLSQVGLSTLHSAVAVLKSCQKLLPFAVEVNIVDRCVEFISSKACSE  172



>gb|KCW86718.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=577

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS +KS     S+AMERT QW+ S++ PTDV V V +A+FSLHKFMLVAKSNY+RK++M
Sbjct  1    MASHVKSNGGN-SIAMERTSQWLLSKKFPTDVDVIVSKANFSLHKFMLVAKSNYMRKMVM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKEADLTRI+LS  PGGPEIFE+AA FCY ++FEITV NVAALRCAAEYL+MTD+YCDN
Sbjct  60   ESKEADLTRIDLSDFPGGPEIFEKAANFCYNIDFEITVKNVAALRCAAEYLEMTDQYCDN  119

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDFL QVA SSLSG ++VLKSCE+LLP+AEDLKIVQRC+++ASAK C E
Sbjct  120  NLAGRTEDFLVQVAFSSLSGTILVLKSCEDLLPMAEDLKIVQRCLDVASAKVCKE  174



>ref|XP_007142019.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
 gb|ESW14013.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
Length=580

 Score =   239 bits (609),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 148/175 (85%), Gaps = 3/175 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P   + TRLSLAMERTGQW+FS EIPTDVIV VGEA+FSLHKF+L AKSN IRK+IM
Sbjct  1    MATP---SPTRLSLAMERTGQWIFSPEIPTDVIVAVGEANFSLHKFILAAKSNSIRKVIM  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S+E+DLTRI+L+ IPGG E FE+  KFCYGVNFEITVHNVA L CAA +LQMTD+YCD 
Sbjct  58   ESEESDLTRIDLTNIPGGQEAFEKVVKFCYGVNFEITVHNVAPLHCAAVFLQMTDEYCDG  117

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDFLSQV +S+L  A+ VLKSC +LLPLA ++ +V RCV++ S+KAC E
Sbjct  118  NLAGRTEDFLSQVGVSTLHSAIAVLKSCRQLLPLATEINVVDRCVDVISSKACRE  172



>ref|XP_003519296.1| PREDICTED: root phototropism protein 2 [Glycine max]
Length=580

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 147/175 (84%), Gaps = 3/175 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P     TR SLAMERTGQWVFS EIPTDVIV VG+ +FSLHKF+L AKSNY+RK+IM
Sbjct  1    MATP---NPTRFSLAMERTGQWVFSPEIPTDVIVAVGQTNFSLHKFILAAKSNYVRKVIM  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S+E+DLTRI +S IPGG E FE+AAKFCYGVNFEITVHNVAAL CAA +LQMTD+YCD 
Sbjct  58   ESEESDLTRIEISDIPGGSEAFEKAAKFCYGVNFEITVHNVAALHCAAVFLQMTDEYCDG  117

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NLAGRTEDFLSQV LS+L  A+ VLKSC+++LP A ++ +V RCVE+ S KAC E
Sbjct  118  NLAGRTEDFLSQVGLSTLHSAVAVLKSCQKILPFAAEVNVVDRCVEVISCKACNE  172



>ref|XP_003616056.1| Root phototropism protein [Medicago truncatula]
 gb|AES99014.1| root phototropism-like protein [Medicago truncatula]
Length=579

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  68   TRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTR  247
            +RLSLAMERTGQW+FSQEIP+DVIV +GEA++SLHKFMLVAKSNYIRKLIM+S E++LTR
Sbjct  7    SRLSLAMERTGQWIFSQEIPSDVIVTIGEATYSLHKFMLVAKSNYIRKLIMESNESELTR  66

Query  248  INLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDF  427
            ++LS IPGG E FE+AAKFCYGVNFEITV+NVA+L CAA +LQMTD+YCD NLAGRTE F
Sbjct  67   LDLSDIPGGQEAFEKAAKFCYGVNFEITVNNVASLHCAAMFLQMTDEYCDGNLAGRTEGF  126

Query  428  lsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            LSQVAL++LSGA VVLKSC +L+P+A++L IV+RCV+  S+K C E
Sbjct  127  LSQVALTTLSGAAVVLKSCRQLIPVADELNIVKRCVDAVSSKVCNE  172



>ref|XP_006842585.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
 gb|ERN04260.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
Length=564

 Score =   237 bits (604),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  59   SAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD  238
            S   RLSLAMERTG+WVFSQEIPTDV+VEVGEA+FSLHKFMLVAKS YIRKLIM+SKEAD
Sbjct  4    STKNRLSLAMERTGKWVFSQEIPTDVVVEVGEANFSLHKFMLVAKSGYIRKLIMESKEAD  63

Query  239  LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT  418
            L+RI L  IPGGPE FE+AAKFCYG +FEITV NVAAL CAAEYL+M++KYC+ NL  R 
Sbjct  64   LSRIELPDIPGGPETFEKAAKFCYGASFEITVKNVAALLCAAEYLEMSEKYCEGNLISRA  123

Query  419  EDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            EDFL  VAL+SLSGA+ VLKSCEEL  +AE+L IV RC++ AS KAC E
Sbjct  124  EDFLVGVALTSLSGAVAVLKSCEELQRMAEELNIVTRCIDTASIKACNE  172



>emb|CDX84827.1| BnaA03g14030D [Brassica napus]
Length=565

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQ  FSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQLGFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGG E+FE+AAKFCYGV+FEITV NVAAL+CAAE+LQMTDKYCDNNLAGR +DFLS
Sbjct  74   LSDIPGGAEMFEKAAKFCYGVSFEITVQNVAALQCAAEFLQMTDKYCDNNLAGRIQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++   KAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGTKACNE  177



>ref|XP_009132742.1| PREDICTED: root phototropism protein 2-like [Brassica rapa]
Length=575

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQ  FSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQLGFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGG E+FE+AAKFCYGV+FEITV NVAAL+CAAE+LQMTDKYCDNNLAGR +DFLS
Sbjct  74   LSDIPGGAEMFEKAAKFCYGVSFEITVQNVAALQCAAEFLQMTDKYCDNNLAGRIQDFLS  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP++ DL IV+RCV++   KAC E
Sbjct  134  QVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVDVVGTKACNE  177



>gb|ABI34691.1| bZIP transcription factor bZIP84 [Glycine max]
Length=183

 Score =   223 bits (568),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +2

Query  92   RTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG  271
            RTGQWVFS EIPTDVIV VG+ +FSLHKF+L AKSNY+RK+IM+S+E+DLTRI +S IPG
Sbjct  1    RTGQWVFSPEIPTDVIVAVGQTNFSLHKFILAAKSNYVRKVIMESEESDLTRIEISDIPG  60

Query  272  GPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalss  451
            G E FE+AAKFCYGVNFEITVHNVAAL CAA +LQMTD+YCD NLAGRTEDFLSQV LS+
Sbjct  61   GSEAFEKAAKFCYGVNFEITVHNVAALHCAAVFLQMTDEYCDGNLAGRTEDFLSQVGLST  120

Query  452  lsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            L  A+ VLKSC+++LP A ++ +V RCVE+ S KAC E
Sbjct  121  LHSAVAVLKSCQKILPFAAEVNVVDRCVEVISCKACNE  158



>ref|XP_004490729.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=573

 Score =   233 bits (595),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  62   AATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
             ++RLSLAMERTGQW+ SQE+P+DVIV VGEAS+SLHKFMLVAKSNYIRKLI++S +++L
Sbjct  5    TSSRLSLAMERTGQWISSQELPSDVIVTVGEASYSLHKFMLVAKSNYIRKLIIESNDSEL  64

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            TRI+LS IPGG E FE+AAKFCYGVNFEITV+NVA+L CAA +LQMT++YCD NLAGRTE
Sbjct  65   TRIDLSDIPGGKEAFEKAAKFCYGVNFEITVNNVASLHCAALFLQMTEEYCDGNLAGRTE  124

Query  422  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             FLSQVAL++LS A+VVLKSC +LLP+A++L IV RC+E  S+K C E
Sbjct  125  GFLSQVALTNLSSAVVVLKSCSQLLPVADELNIVNRCIEAVSSKVCSE  172



>gb|KHN18647.1| Root phototropism protein 2 [Glycine soja]
Length=312

 Score =   224 bits (570),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 114/129 (88%), Gaps = 4/129 (3%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P      RLSLAMERTGQWVFSQ+IPTDVIVEVGE  FSLHKFMLVAKSNYIRKLI+
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETIFSLHKFMLVAKSNYIRKLIL  56

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S E +LTRI LS IPGGP IFE+ AKFCYGVNFEITVHNVA LRCAAE+LQMTD+YC+N
Sbjct  57   ESNEGELTRIYLSDIPGGPSIFEKTAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCEN  116

Query  401  NLAGRTEDF  427
            NLAGRTE+F
Sbjct  117  NLAGRTEEF  125



>gb|EPS73802.1| hypothetical protein M569_00954 [Genlisea aurea]
Length=566

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 144/169 (85%), Gaps = 5/169 (3%)
 Frame = +2

Query  62   AATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE-AD  238
            A  RLS AMERTGQWV SQ+IPTDV+V VG A FSLHKF L+AKSN +R LI++S+E +D
Sbjct  2    ADDRLSHAMERTGQWVLSQQIPTDVVVAVGTARFSLHKFTLIAKSNLLRTLILESEELSD  61

Query  239  LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT  418
             T I+LS IPGG EIFERAAKFCYGVNFEITV+NVAALRCAAEYLQMT    D  L GRT
Sbjct  62   PTTIDLSEIPGGSEIFERAAKFCYGVNFEITVNNVAALRCAAEYLQMT----DGTLGGRT  117

Query  419  EDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            EDFLS+VAL+SLS A+ VLK+CE+LLP+AEDLKIVQRCVE+ SAKACVE
Sbjct  118  EDFLSKVALTSLSAAVTVLKTCEDLLPIAEDLKIVQRCVEVVSAKACVE  166



>ref|XP_010522018.1| PREDICTED: root phototropism protein 2-like [Tarenaya hassleriana]
Length=572

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            + +AMERT QWV SQ+ P DV+V+V EASFSLHKF+LV KSNYIRKLIM+SK+ DLT I+
Sbjct  10   MDMAMERTDQWVSSQDTPADVVVDVCEASFSLHKFLLVGKSNYIRKLIMESKDTDLTIID  69

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTD+YC++NLA RT DFLS
Sbjct  70   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDEYCESNLASRTLDFLS  129

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            QVALSSLSGA+VVLKSCE LLP A+DL IV+RC+++ S+KAC E
Sbjct  130  QVALSSLSGAIVVLKSCELLLPAAQDLGIVKRCLDVISSKACSE  173



>gb|KJB26283.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=532

 Score =   212 bits (539),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  173  KFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAAL  352
            +FMLVAKSNYIRKLIM++ EADLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAAL
Sbjct  2    QFMLVAKSNYIRKLIMETNEADLTRINLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAAL  61

Query  353  RCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRC  532
            RCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGA+VVLKSCE+LLP+AE+LKIVQRC
Sbjct  62   RCAAEYLQMTDKYCDNNLAGRTEDFLSQVALSSLSGAVVVLKSCEDLLPMAEELKIVQRC  121

Query  533  VELASAKACVE  565
            +++ASA+AC E
Sbjct  122  IDVASARACNE  132



>ref|XP_006432045.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432047.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45285.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45287.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=541

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +2

Query  179  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  358
            MLVAKSNYIRKLI++SKEADLTRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRC
Sbjct  1    MLVAKSNYIRKLIIESKEADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRC  60

Query  359  AAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  538
            AAE+LQMTDKYC+NNLAGRTEDFLSQVALSSLSGA+VVLKSCE LLPLAEDL IVQRC++
Sbjct  61   AAEFLQMTDKYCENNLAGRTEDFLSQVALSSLSGAVVVLKSCEALLPLAEDLLIVQRCID  120

Query  539  LASAKACVE  565
            +A+AKAC E
Sbjct  121  VATAKACYE  129



>gb|KDO54918.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=541

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +2

Query  179  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  358
            MLVAKSNYIRKLI++SKEADLTRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRC
Sbjct  1    MLVAKSNYIRKLIIESKEADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRC  60

Query  359  AAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  538
            AAE+LQMTDKYC+NNLAGRTEDFLSQVALSSLSGA+VVLKSCE LLPLAEDL IVQRC++
Sbjct  61   AAEFLQMTDKYCENNLAGRTEDFLSQVALSSLSGAVVVLKSCEALLPLAEDLLIVQRCID  120

Query  539  LASAKACVE  565
            +A+AKAC E
Sbjct  121  VATAKACYE  129



>ref|XP_008803009.1| PREDICTED: root phototropism protein 2 [Phoenix dactylifera]
Length=583

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 135/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFS-QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            L  A ERTGQWV S Q+IPTD+I+ VG+ SF LHKFMLVAKS YIR+ IMDS   ++ RI
Sbjct  10   LPSATERTGQWVPSDQDIPTDIIIHVGDVSFPLHKFMLVAKSGYIRRKIMDSDRTNVARI  69

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
            +LS +PGG E FE+AAKFCYGVNFEI+V+NV ALRCAAEYL+MT+KYC+ NL GRTE+FL
Sbjct  70   DLSEVPGGVEAFEKAAKFCYGVNFEISVYNVVALRCAAEYLEMTEKYCEGNLEGRTEEFL  129

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +Q AL +L GA++VL+SCEELLP+A +++I +RC +  S KAC E
Sbjct  130  AQAALKTLPGAVIVLRSCEELLPMAGEIQIAKRCFDAISLKACNE  174



>ref|XP_010650806.1| PREDICTED: root phototropism protein 2 isoform X2 [Vitis vinifera]
Length=527

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +2

Query  179  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  358
            MLVAKSNYIRKLIM+SKEADLT I+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRC
Sbjct  1    MLVAKSNYIRKLIMESKEADLTNIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRC  60

Query  359  AAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  538
            AAEYLQMTDKYCD NL+GRTEDFL QVAL+SLSGA+VVLKSCE+LLP AE+LKIVQRCV+
Sbjct  61   AAEYLQMTDKYCDGNLSGRTEDFLKQVALTSLSGAVVVLKSCEDLLPKAEELKIVQRCVD  120

Query  539  LASAKACVE  565
            +AS KAC E
Sbjct  121  VASTKACNE  129



>ref|XP_009384759.1| PREDICTED: root phototropism protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=582

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +2

Query  65   ATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  244
            ++RLS AME T  W FSQ+IP+D++V++G+A+F LHKF+L AKS YIR+ +M+S+ A+L+
Sbjct  10   SSRLSAAMETTSHWDFSQDIPSDIVVQIGDATFQLHKFVLAAKSGYIRRKVMESESANLS  69

Query  245  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  424
             I+LS +  G E+FER AKFCYGVNFEI+V NVAALRCAAEYLQMT++YC  NLA RTE+
Sbjct  70   CIDLSDLSIGAEVFERVAKFCYGVNFEISVRNVAALRCAAEYLQMTEEYCRGNLAARTEE  129

Query  425  FlsqvalsslsgalvvlksCE-ELLPLAEDLKIVQRCVELASAKACVE  565
            F++Q A+ +L GA+ +L+SCE  LLP+AE L++VQR V+  S KAC E
Sbjct  130  FINQAAVKTLPGAVALLRSCEGPLLPMAESLRVVQRSVDAISLKACKE  177



>ref|XP_009402205.1| PREDICTED: root phototropism protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 137/173 (79%), Gaps = 3/173 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS   S  +RL  AME+T QWV SQ+IP+D+IV+VG+ +F LHKFMLVA S YIR+ +M
Sbjct  1    MASSTPS--SRLCAAMEKTSQWVLSQDIPSDIIVQVGDDTFRLHKFMLVANSGYIRRKVM  58

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S+ A+L  I+LS +PGG E+FE+AAKFCYG+NFEI+VHNV ALRCAAEYLQMT+ Y   
Sbjct  59   ESERANLGCIDLSDVPGGAEVFEKAAKFCYGMNFEISVHNVTALRCAAEYLQMTEDYSRG  118

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCE-ELLPLAEDLKIVQRCVELASAKA  556
            NLA R E+F++Q A+ +L GA+ +L+SCE  LLP+AE+++IVQR V+  S KA
Sbjct  119  NLAERAEEFINQAAVKTLPGAVALLRSCEGSLLPMAEEVRIVQRSVDAISLKA  171



>ref|XP_010922790.1| PREDICTED: root phototropism protein 2 [Elaeis guineensis]
Length=577

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 145/171 (85%), Gaps = 3/171 (2%)
 Frame = +2

Query  53   LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE  232
            L S+++RL  AMERTGQW+ SQ+I TD+I+++G+ SF LHKF+LVAKS YIR+ IMDS  
Sbjct  3    LSSSSSRLPSAMERTGQWILSQDIQTDIIIDIGDVSFPLHKFILVAKSGYIRRKIMDS--  60

Query  233  ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG  412
             D  RINLS +PGG E FE+AAKFCYGVNFEI+VHNV  LRCAAEYL+MT++YC+ NLAG
Sbjct  61   -DDGRINLSEVPGGVEAFEKAAKFCYGVNFEISVHNVVVLRCAAEYLEMTERYCEGNLAG  119

Query  413  RTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            RTE+FL+Q AL +L GA+++L+SCE+LLP+AE+L+IV+RCV+  S+KAC E
Sbjct  120  RTEEFLAQAALKTLPGAVILLQSCEDLLPMAEELQIVKRCVDTISSKACNE  170



>ref|NP_001031446.1| Root phototropism protein 2 [Arabidopsis thaliana]
 ref|NP_001077982.1| Root phototropism protein 2 [Arabidopsis thaliana]
 dbj|BAD43060.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08402.1| Root phototropism protein 2 [Arabidopsis thaliana]
 gb|AEC08403.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=545

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +2

Query  179  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  358
            MLVAKSNYIRKLIM+SK++D+TRINLS IPGGPEIFE+AAKFCYGVNFEITV NVAAL C
Sbjct  1    MLVAKSNYIRKLIMESKDSDVTRINLSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHC  60

Query  359  AAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  538
            AAE+LQMTDKYCDNNLAGRT+DFLSQVALSSLSGA+VVLKSCE LLP++ DL IV+RCV+
Sbjct  61   AAEFLQMTDKYCDNNLAGRTQDFLSQVALSSLSGAIVVLKSCEILLPISRDLGIVRRCVD  120

Query  539  LASAKACVE  565
            +  AKAC E
Sbjct  121  VVGAKACNE  129



>ref|XP_002978505.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
 gb|EFJ20491.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
Length=615

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRI  250
            +S A +RT +WV S ++PTDV+VE G  SF+LHKF LV++S  IRKL+  DS+E D++ I
Sbjct  18   VSSAAKRTAEWVMSTDVPTDVLVEAGGVSFALHKFPLVSRSGKIRKLVAGDSRELDVSFI  77

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             LS +PGGPE FE AAKFCYG+NFEI+V NVA LRCAAEYL MT+ Y D NL  RTE F+
Sbjct  78   KLSDLPGGPEAFELAAKFCYGINFEISVTNVATLRCAAEYLDMTEDYGDGNLVARTEAFI  137

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             ++A  +LS A+ VL SCE LLPLAE+LKIV RCV+ A+ + C E
Sbjct  138  DEIATQNLSNAVAVLHSCESLLPLAEELKIVNRCVDAAATEVCRE  182



>ref|XP_002970426.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
 gb|EFJ28556.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
Length=603

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRI  250
            +S A +RT +WV S ++PTDV+VE G  SF+LHKF LV++S  IRKL+  DS+E D++ I
Sbjct  6    VSSAAKRTAEWVMSTDVPTDVLVEAGGVSFALHKFPLVSRSGKIRKLVAGDSRELDVSFI  65

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             LS +PGGPE FE AAKFCYG+NFEI+V NVA LRCAAEYL MT+ Y D NL  RTE F+
Sbjct  66   KLSDLPGGPEAFELAAKFCYGINFEISVTNVATLRCAAEYLDMTEDYGDGNLVARTEAFI  125

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             ++A  +LS A+ VL SCE LLPLAE+LKIV RCV+ A+ + C E
Sbjct  126  DEIATQNLSNAVAVLHSCESLLPLAEELKIVNRCVDAAATEVCRE  170



>gb|AES70802.2| root phototropism-like protein [Medicago truncatula]
Length=526

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +2

Query  179  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  358
            MLVAKSNYIRKLIM+S E  LTRI+LS IPGG  IFE+AAKFCYGVNFEITVHNVA LRC
Sbjct  1    MLVAKSNYIRKLIMESDETHLTRIDLSDIPGGSGIFEKAAKFCYGVNFEITVHNVAVLRC  60

Query  359  AAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  538
            AAE+LQMTD+YCDNNLAGRT++FLS+VA  +L+G++ VLKSC  LLP A+DL IV+RCVE
Sbjct  61   AAEFLQMTDQYCDNNLAGRTDEFLSKVAFFTLTGSVAVLKSCHHLLPYADDLNIVKRCVE  120

Query  539  LASAKACVE  565
             ASAKAC E
Sbjct  121  AASAKACSE  129



>gb|KGN61975.1| hypothetical protein Csa_2G277660 [Cucumis sativus]
Length=299

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 128/176 (73%), Gaps = 2/176 (1%)
 Frame = +2

Query  38   NMASPLKSAATR--LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRK  211
             ++S L  +A +  LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRK
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRK  69

Query  212  LIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKY  391
            L+ +S +ADL  + L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y
Sbjct  70   LVSESTDADLATVELPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEY  129

Query  392  CDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
               NL GRTE ++++VAL SL+GA+ VL   + LLP AE +K+V RC++  +  AC
Sbjct  130  AVGNLVGRTEAYINEVALKSLAGAVSVLHMSQSLLPTAEKVKLVSRCIDAIAFVAC  185



>ref|XP_007156731.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 ref|XP_007156732.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28725.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28726.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
Length=617

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 125/164 (76%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V+VGE SFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  23   LSSAMKRTSEWIFSQEIPSDVNVQVGEDSFSLHKFPLVSKCGYIRKLVSESNDADVSSIE  82

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS +PGG E FE AAKFCYG+NFEI V N+A LRC AEYL+MT+ Y   NL GRT+ +L+
Sbjct  83   LSDVPGGAEAFELAAKFCYGINFEINVENIATLRCVAEYLEMTEDYSVGNLVGRTDAYLN  142

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL +++GA+ VL   E LLP+AE  K+V RC++  +  AC E
Sbjct  143  EVALKTIAGAVSVLHMSETLLPIAERTKLVSRCIDAIAYIACKE  186



>gb|KHG27515.1| hypothetical protein F383_13864 [Gossypium arboreum]
Length=471

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V+VG  SFSLHKF L++KS Y+RK++ +S +AD + I 
Sbjct  23   LSTAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPLISKSGYVRKVVTESNDADHSIIE  82

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  +PGG + FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRTE +L+
Sbjct  83   IPNVPGGADSFELAAKFCYGINFEISSENIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLN  142

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL SL+GA+ VL   E LLP+AE++K+V RC++  +  AC E
Sbjct  143  EVALKSLAGAVSVLHMSESLLPIAEEVKLVSRCIDAIAYLACKE  186



>gb|EYU44474.1| hypothetical protein MIMGU_mgv1a027075mg [Erythranthe guttata]
Length=577

 Score =   183 bits (464),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 122/162 (75%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V  G  SFSLHKF LV+K  YIRKL+ +S +ADL  + 
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVNAGGTSFSLHKFPLVSKCGYIRKLVTESTDADLAVVE  68

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +   PGGPE FE AA FCYG+NFEIT  N+A LRCAAEYL+MT++Y   NL GRTE +++
Sbjct  69   IPDFPGGPEGFELAANFCYGINFEITTENIATLRCAAEYLEMTEEYSVGNLVGRTESYVN  128

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            +VAL SL+GA+ +L S E LLP+AE +K+V RC++  +  AC
Sbjct  129  EVALKSLAGAVSILHSAENLLPIAEKVKLVSRCIDAIALVAC  170



>gb|KJB48680.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=447

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = +2

Query  53   LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE  232
            + S    LS AM+RT +W+FSQEIP+DV V+VG  SFSLHKF L++KS ++RK++ +S +
Sbjct  16   MSSKKELLSSAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPLISKSGFVRKVVSESND  75

Query  233  ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG  412
            AD + I +  +PGG + FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL G
Sbjct  76   ADHSIIEIPNVPGGADSFELAAKFCYGINFEISTENIAMLRCAAEYLEMTEDYAVGNLVG  135

Query  413  RTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            RTE +L++VAL SL+GA+ VL   E LLP+AE++K+V RC++  +  AC E
Sbjct  136  RTEAYLNEVALKSLAGAVSVLHMSESLLPIAEEVKLVSRCIDAIAYLACKE  186



>ref|XP_003538794.2| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Glycine max]
Length=618

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 125/164 (76%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V+VGEASFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPLVSKCGYIRKLVSESNDADVSFIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            L  +PGG E FE AAKFCYG+NF+I V N+A LRC AEYL+MT+ Y   NL GRT+ +L+
Sbjct  84   LPEVPGGAEAFELAAKFCYGINFDINVENIATLRCVAEYLEMTEDYSVGNLVGRTDAYLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL +++GA+ +L   E LLP+AE  K+V RC++  +  AC E
Sbjct  144  EVALKTIAGAVSILHMSENLLPIAERAKLVSRCIDAIAFIACKE  187



>ref|XP_002963864.1| hypothetical protein SELMODRAFT_141980 [Selaginella moellendorffii]
 gb|EFJ35735.1| hypothetical protein SELMODRAFT_141980 [Selaginella moellendorffii]
Length=631

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +2

Query  56   KSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA  235
            K   +R S   +RTGQW+ S ++PTDV+VE    SFSLHKF LVA+   IR+ + +++E 
Sbjct  11   KRLVSRTSYNKKRTGQWIMSADVPTDVVVEAAGTSFSLHKFPLVARCGRIRRAVAEAREM  70

Query  236  DLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGR  415
            DL+RI    +PGG E FE AAKFCYG+NFEIT  NVAALRCAAEYL+M D+Y   NL GR
Sbjct  71   DLSRIEFPDVPGGAETFELAAKFCYGINFEITTANVAALRCAAEYLEMKDEYGQGNLLGR  130

Query  416  TEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            TE F+++V L S + +L VL SCEELLP+AED  +V RC++  ++ AC
Sbjct  131  TEAFVNEVVLPSFANSLCVLHSCEELLPIAEDNNLVSRCIDAIASIAC  178



>emb|CBI33715.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V  GE SFSLHKF LV+K  YIRKL+ +S +ADL+ I 
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPLVSKCGYIRKLVSESSDADLSVIE  68

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  69   VHDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYSVGNLVGRAEAYLN  128

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL SL+GA+ +L   E LLP+AE +K+V RC++  +  AC E
Sbjct  129  EVALKSLAGAVTILHLSEALLPMAEKVKVVSRCIDAIAYIACKE  172



>ref|XP_002988267.1| hypothetical protein SELMODRAFT_447227 [Selaginella moellendorffii]
 gb|EFJ10686.1| hypothetical protein SELMODRAFT_447227 [Selaginella moellendorffii]
Length=631

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +2

Query  56   KSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA  235
            K   +R S   +RTGQW+ S ++PTDV+VE    SFSLHKF LVA+   IR+ + +++E 
Sbjct  11   KRLVSRTSYNKKRTGQWIMSADVPTDVVVEAAGTSFSLHKFPLVARCGRIRRAVAEAREM  70

Query  236  DLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGR  415
            DL+RI    +PGG E FE AAKFCYG+NFEIT  NVAALRCAAEYL+M D+Y   NL GR
Sbjct  71   DLSRIEFPDVPGGAETFELAAKFCYGINFEITTANVAALRCAAEYLEMKDEYGQGNLLGR  130

Query  416  TEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            TE F+++V L S + +L VL SCEELLP+AED  +V RC++  ++ AC
Sbjct  131  TEAFVNEVVLPSFANSLCVLHSCEELLPIAEDNNLVSRCIDAIASIAC  178



>ref|XP_004511862.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X6 [Cicer arietinum]
Length=627

 Score =   181 bits (458),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 124/164 (76%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS +PGG E FE AAKFCYG+NFEI V N+A LRC AEYL+MT++Y   NL GRT+ +L+
Sbjct  84   LSDVPGGAEAFELAAKFCYGINFEINVENIATLRCVAEYLEMTEEYAVGNLVGRTDAYLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             VAL +++GA+ +L   E LLP+AE  K++ +C++  +  AC E
Sbjct  144  DVALKTIAGAVSILHMSESLLPIAEKAKLMSKCIDAIAYIACKE  187



>ref|XP_004511860.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X4 [Cicer arietinum]
 ref|XP_004511861.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X5 [Cicer arietinum]
Length=628

 Score =   181 bits (458),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 124/164 (76%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS +PGG E FE AAKFCYG+NFEI V N+A LRC AEYL+MT++Y   NL GRT+ +L+
Sbjct  84   LSDVPGGAEAFELAAKFCYGINFEINVENIATLRCVAEYLEMTEEYAVGNLVGRTDAYLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             VAL +++GA+ +L   E LLP+AE  K++ +C++  +  AC E
Sbjct  144  DVALKTIAGAVSILHMSESLLPIAEKAKLMSKCIDAIAYIACKE  187



>ref|XP_002284242.2| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Vitis 
vinifera]
Length=636

 Score =   181 bits (458),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 127/176 (72%), Gaps = 3/176 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM+S  K     LS AM+RT +W+FSQEIP+DV V  GE SFSLHKF LV+K  YIRKL+
Sbjct  15   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPLVSKCGYIRKLV  71

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
             +S +ADL+ I +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y  
Sbjct  72   SESSDADLSVIEVHDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYSV  131

Query  398  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             NL GR E +L++VAL SL+GA+ +L   E LLP+AE +K+V RC++  +  AC E
Sbjct  132  GNLVGRAEAYLNEVALKSLAGAVTILHLSEALLPMAEKVKVVSRCIDAIAYIACKE  187



>ref|XP_002983725.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
 gb|EFJ15221.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
Length=604

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 118/165 (72%), Gaps = 0/165 (0%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S +M RT  WV S ++PTD+ V++   SF+LHKF LV++S  +RKL+ +++++DL+R+
Sbjct  11   RNSFSMRRTNDWVMSTDVPTDITVDICGTSFALHKFPLVSRSGRLRKLVAEARDSDLSRV  70

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
              + IPGGPE FE AAKFCYG+NFEIT  NVA LRC AEYL+MTD +   NLA R+E F+
Sbjct  71   EFNDIPGGPEGFEMAAKFCYGINFEITASNVAILRCVAEYLEMTDDFGQANLASRSEAFI  130

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
              V   S   ++ VL SCE+LLP+AE L IV RCV+ A AKA  E
Sbjct  131  EDVVTHSFGSSITVLHSCEKLLPMAEQLNIVNRCVQAAGAKASHE  175



>ref|XP_002989054.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
 gb|EFJ09848.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
Length=607

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 119/165 (72%), Gaps = 0/165 (0%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S +M RT  WV S ++PTD+ V++   SF+LHKF LV++S  +RKL+ +++++DL+R+
Sbjct  11   RNSFSMRRTNDWVMSTDVPTDITVDICGTSFALHKFPLVSRSGRLRKLVAEARDSDLSRV  70

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
              + IPGGPE FE AAKFCYG+NFEIT  NVA LRC AEYL+MTD +   NLA R+E F+
Sbjct  71   EFNDIPGGPEGFEMAAKFCYGINFEITASNVAILRCVAEYLEMTDDFGQANLASRSEAFI  130

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
              V + S   ++ VL SCE+LLP+AE L IV RCV+ A AKA  E
Sbjct  131  EDVVMHSFGSSITVLHSCEKLLPMAEQLNIVNRCVQAAGAKASHE  175



>emb|CAN71562.1| hypothetical protein VITISV_007563 [Vitis vinifera]
Length=621

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V  GE SFSLHKF LV+K  YIRKL+ +S +ADL+ I 
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPLVSKCGYIRKLVSESSDADLSVIE  68

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  69   VHDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYSVGNLVGRAEAYLN  128

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL SL+GA+ +L   E LLP+AE +K+V RC++  +  AC E
Sbjct  129  EVALKSLAGAVTILHLSEALLPMAEKVKVVSRCIDAIAYIACKE  172



>ref|XP_011006799.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Populus euphratica]
Length=599

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRK++ +S +ADL+ I 
Sbjct  8    LSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKCGYIRKMVSESSDADLSEIK  67

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  RT+ +L+
Sbjct  68   IPNVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYAAGNLVSRTDAYLN  127

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL SL+GA+ VL   E LLP+AE +K+V RC++  +  AC E
Sbjct  128  EVALKSLAGAVSVLHLSENLLPMAEKVKLVSRCIDAIALAACKE  171



>ref|XP_007047478.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOX91635.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=623

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 132/176 (75%), Gaps = 3/176 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM+S  K     LS AM+RT +W+FSQEIP+DV V+VG ASFSLHKF LV+K  +IRK++
Sbjct  15   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVTVQVGGASFSLHKFPLVSKCGFIRKVV  71

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
             +S +AD++ I +  +PGG + FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y  
Sbjct  72   SESNDADVSVIEIPDVPGGADSFELAAKFCYGINFEISTENIAMLRCAAEYLEMTEDYAV  131

Query  398  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             NL GRTE +L++VAL SL+GA+ VL + E LLPLAE +K+V +C++  +  AC E
Sbjct  132  GNLVGRTEAYLNEVALKSLAGAVSVLHTSENLLPLAEKVKLVSQCIDAIAYLACKE  187



>ref|XP_006380639.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58436.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=601

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 122/163 (75%), Gaps = 0/163 (0%)
 Frame = +2

Query  77   SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  256
            S AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+KS YIRK++ +S +ADL+ I +
Sbjct  10   STAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKSGYIRKMVSESSDADLSEIKI  69

Query  257  SGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsq  436
              +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  RT+ +L++
Sbjct  70   PNVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYAVGNLVSRTDAYLNE  129

Query  437  valsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            VAL SL+GA+ VL   E LLP+AE +K+V RC++  +  AC E
Sbjct  130  VALKSLAGAVSVLHLSENLLPMAEKVKLVSRCLDAIALAACKE  172



>ref|XP_011012051.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Populus euphratica]
Length=599

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRK++ +S +ADL+ I 
Sbjct  8    LSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKCGYIRKMVSESSDADLSEIK  67

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  RT+ +L+
Sbjct  68   IPNVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYAVGNLVSRTDAYLN  127

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL SL+GA+ VL   E LLP+AE +K+V RC++  +  AC E
Sbjct  128  EVALKSLAGAVSVLHLSENLLPMAEKVKLVSRCIDAIALAACKE  171



>ref|XP_006339816.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=596

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT  W+FSQEIP+DV V  G  SF+LHKF LV+KS YIRKL+ +S +AD++ IN
Sbjct  9    LSSAMKRTSDWIFSQEIPSDVTVNAGGTSFALHKFPLVSKSGYIRKLVSESNDADVSTIN  68

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  IPGG E FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL  RTE + +
Sbjct  69   IPDIPGGGEAFELAAKFCYGINFEISTENIALLRCAAEYLEMTEDYAVANLVERTEAYFN  128

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            +VA+ SL+GA+ +L+S E LLP+AE +K+V RC++  +  AC
Sbjct  129  EVAIKSLAGAVTILRSSENLLPIAEKVKLVSRCIDTIAYTAC  170



>gb|KJB48677.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=614

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V+VG  SFSLHKF L++KS ++RK++ +S +AD + I 
Sbjct  23   LSSAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPLISKSGFVRKVVSESNDADHSIIE  82

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  +PGG + FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRTE +L+
Sbjct  83   IPNVPGGADSFELAAKFCYGINFEISTENIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLN  142

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL SL+GA+ VL   E LLP+AE++K+V RC++  +  AC E
Sbjct  143  EVALKSLAGAVSVLHMSESLLPIAEEVKLVSRCIDAIAYLACKE  186



>ref|XP_010086959.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB25095.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=624

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS A++RT +W+FSQEIP+DV ++VG  SFSLHKF LV+K  YIRKL+ +S ++DL+ I 
Sbjct  24   LSTALKRTSEWIFSQEIPSDVTIDVGGVSFSLHKFPLVSKCGYIRKLVSESNDSDLSIIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            L+ IPGG E FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRT+ +L+
Sbjct  84   LADIPGGAEAFELAAKFCYGINFEISTENIAMLRCAAEYLEMTEDYAVGNLVGRTDAYLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL SL+ A  +L   E  LP+AE +K+V +C++  +  AC E
Sbjct  144  EVALKSLASAASILHISENFLPIAEKVKLVSKCIDAIAYIACKE  187



>ref|XP_004149698.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=621

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 128/176 (73%), Gaps = 2/176 (1%)
 Frame = +2

Query  38   NMASPLKSAATR--LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRK  211
             ++S L  +A +  LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRK
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRK  69

Query  212  LIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKY  391
            L+ +S +ADL  + L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y
Sbjct  70   LVSESTDADLATVELPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEY  129

Query  392  CDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
               NL GRTE ++++VAL SL+GA+ VL   + LLP AE +K+V RC++  +  AC
Sbjct  130  AVGNLVGRTEAYINEVALKSLAGAVSVLHMSQSLLPTAEKVKLVSRCIDAIAFVAC  185



>gb|KDO78973.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=457

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+  S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSVSSEADLSVIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  +PGG E FE AAKFCYG+NFEI   NVA LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEINTENVAGLRCVAEYLEMTEDYAVGNLVGRAEAYLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL+SL+GA+ VL   + LLP+AE +K+V +C++  +  AC E
Sbjct  144  EVALTSLTGAVTVLHKSQGLLPIAEKVKLVGQCIDAIAYIACKE  187



>ref|XP_009628088.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
tomentosiformis]
Length=620

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT  W+FSQEIP+DV V  G ++FSLHKF LV+KS YIRK+I +S +AD++ + 
Sbjct  26   LSTAMKRTSDWIFSQEIPSDVTVNAGGSAFSLHKFPLVSKSGYIRKIISESNDADVSTVE  85

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  IPGG + FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  86   IPDIPGGSDAFELAAKFCYGINFEISTENIALLRCTAEYLEMTEDYAVGNLVGRTEAYLN  145

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            +VAL SL+GA+ +L S E LLP+AE +K+V RC++  +  AC
Sbjct  146  EVALKSLAGAVSILHSSESLLPIAEKVKLVSRCIDTIAYIAC  187



>ref|XP_008457767.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Cucumis melo]
Length=620

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 121/162 (75%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRKL+ +S +ADL  + 
Sbjct  21   LSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRKLVSESTDADLATVE  80

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y   NL GRTE +++
Sbjct  81   LPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEYAVGNLVGRTEAYIN  140

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            +VAL SL+GA+ VL   + LLP AE +K+V RC++  +  AC
Sbjct  141  EVALKSLAGAVSVLHMSQSLLPTAEKVKLVSRCIDAIAFVAC  182



>ref|XP_008457766.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Cucumis melo]
Length=621

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 121/162 (75%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRKL+ +S +ADL  + 
Sbjct  21   LSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRKLVSESTDADLATVE  80

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y   NL GRTE +++
Sbjct  81   LPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEYAVGNLVGRTEAYIN  140

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            +VAL SL+GA+ VL   + LLP AE +K+V RC++  +  AC
Sbjct  141  EVALKSLAGAVSVLHMSQSLLPTAEKVKLVSRCIDAIAFVAC  182



>ref|XP_006466487.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Citrus 
sinensis]
Length=623

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+ +S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSESSEADLSVIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  +PGG E FE AAKFCYG+NFEI   NVA LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEINTENVAGLRCVAEYLEMTEDYAVGNLVGRAEAYLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL+SL+GA+ VL   + LLP+AE +K+V +C++  +  AC E
Sbjct  144  EVALTSLTGAVTVLHKSQGLLPIAEKVKLVGQCIDAIAYIACKE  187



>ref|XP_009782405.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
sylvestris]
Length=620

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT  W+FSQEIP+DV V  G ++FSLHKF LV+KS YIRK+I +S +AD++ + 
Sbjct  26   LSTAMKRTSDWIFSQEIPSDVTVNAGGSAFSLHKFPLVSKSGYIRKIISESNDADVSIVE  85

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  IPGG + FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  86   IPDIPGGSDAFELAAKFCYGINFEISTENIALLRCTAEYLEMTEDYAVGNLVGRTEAYLN  145

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            +VAL SL+GA+ +L S E LLP+AE +K+V RC++  +  AC
Sbjct  146  EVALKSLAGAVSILHSSESLLPIAEKVKMVSRCIDTIAYIAC  187



>ref|XP_004166154.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=802

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 128/176 (73%), Gaps = 2/176 (1%)
 Frame = +2

Query  38   NMASPLKSAATR--LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRK  211
             ++S L  +A +  LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRK
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRK  69

Query  212  LIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKY  391
            L+ +S +ADL  + L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y
Sbjct  70   LVSESTDADLATVELPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEY  129

Query  392  CDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
               NL GRTE ++++VAL SL+GA+ VL   + LLP AE +K+V RC++  +  AC
Sbjct  130  AVGNLVGRTEAYINEVALKSLAGAVSVLHMSQSLLPTAEKVKLVSRCIDAIAFVAC  185



>ref|XP_010559030.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Tarenaya hassleriana]
Length=588

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
            +S AM+RT +W+ SQEIP+DV   VGEASFSLHKF LV+KS +IRKL+ +S  E+D++ I
Sbjct  9    MSSAMKRTSEWISSQEIPSDVTAHVGEASFSLHKFPLVSKSGFIRKLVSESNNESDISVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             +  IPGG E FE AAKFCYG+NFEIT  N+A LRCAAEYL+MT+++   NL GR E +L
Sbjct  69   GIHEIPGGAEAFEMAAKFCYGINFEITTENIAMLRCAAEYLEMTEEHSVGNLLGRAEAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SLS ++ VL   E+LLP+AE +K+V RC++  +  AC E
Sbjct  129  NEVALKSLSSSITVLHKAEDLLPMAERVKLVSRCIDAIAYAACQE  173



>ref|XP_010028107.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Eucalyptus grandis]
 gb|KCW54768.1| hypothetical protein EUGRSUZ_I00715 [Eucalyptus grandis]
Length=614

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 119/164 (73%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  MERT  W+FSQEIP+DV V     SF+LHKF LV++   IRKL+ +S EADL+ I 
Sbjct  21   LSTVMERTSAWIFSQEIPSDVTVHAAGTSFALHKFPLVSRCGCIRKLVSESSEADLSNIE  80

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            L GIPGG E FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRTE +L 
Sbjct  81   LVGIPGGAEAFELAAKFCYGINFEISTKNIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLK  140

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL S++GA+ VL   E LLP+AE +K+V RC++  +  AC E
Sbjct  141  EVALKSIAGAITVLHMTESLLPIAEKVKLVVRCIDAIAFLACKE  184



>ref|XP_010028106.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Eucalyptus grandis]
Length=615

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 119/164 (73%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  MERT  W+FSQEIP+DV V     SF+LHKF LV++   IRKL+ +S EADL+ I 
Sbjct  21   LSTVMERTSAWIFSQEIPSDVTVHAAGTSFALHKFPLVSRCGCIRKLVSESSEADLSNIE  80

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            L GIPGG E FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRTE +L 
Sbjct  81   LVGIPGGAEAFELAAKFCYGINFEISTKNIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLK  140

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL S++GA+ VL   E LLP+AE +K+V RC++  +  AC E
Sbjct  141  EVALKSIAGAITVLHMTESLLPIAEKVKLVVRCIDAIAFLACKE  184



>ref|XP_004231910.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
lycopersicum]
Length=596

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = +2

Query  83   AMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSG  262
            AM+RT  W+FSQEIP+DV V  G  SF+LHKF LV+KS YIRKLI +S EAD++ I++  
Sbjct  12   AMKRTSDWIFSQEIPSDVTVNAGGTSFTLHKFPLVSKSGYIRKLISESNEADVSTIDIPD  71

Query  263  IPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqva  442
            IPGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  RTE + ++VA
Sbjct  72   IPGGGEAFELAAKFCYGINFEISTENIALLRCVAEYLEMTEDYAVANLVERTEAYFNEVA  131

Query  443  lsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            ++SL+GA+ +L+S E LLP+AE +K+V RC++  +  AC
Sbjct  132  ITSLAGAVTILRSSENLLPIAEKVKLVSRCIDTIAYTAC  170



>gb|KDO78972.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=623

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+  S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSVSSEADLSVIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  +PGG E FE AAKFCYG+NFEI   NVA LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEINTENVAGLRCVAEYLEMTEDYAVGNLVGRAEAYLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL+SL+GA+ VL   + LLP+AE +K+V +C++  +  AC E
Sbjct  144  EVALTSLTGAVTVLHKSQGLLPIAEKVKLVGQCIDAIAYIACKE  187



>emb|CDP02580.1| unnamed protein product [Coffea canephora]
Length=620

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 125/174 (72%), Gaps = 3/174 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM+S  K     LS AM+RT +W+FSQEIP+DVIV  G   FSLHKF LV+K  YIRKL+
Sbjct  16   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVIVHAGGTPFSLHKFPLVSKCGYIRKLV  72

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
             +S +ADL+ I +  IPGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT++   
Sbjct  73   SESNDADLSEIEVPDIPGGAEAFELAAKFCYGINFEISTENIAMLRCGAEYLGMTEECAI  132

Query  398  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
             NL GRTE +L++VAL SL+ A+ +L S E  LP+AE++K+V RC++  +  AC
Sbjct  133  GNLVGRTEAYLNEVALKSLASAVSILHSTESFLPVAEEVKLVSRCIDTIAYIAC  186



>ref|XP_006426057.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
 gb|ESR39297.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
Length=623

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+  S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSVSSEADLSVIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  +PGG E FE AAKFCYG+NFEI   NVA LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEINTENVAGLRCVAEYLEMTEDYAVGNLVGRAEAYLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL+SL+GA+ VL   + LLP+AE +K+V +C++  +  AC E
Sbjct  144  EVALTSLTGAVTVLHKSQGLLPIAEKVKLVGQCIDAIAYIACKE  187



>ref|XP_002533158.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF29217.1| Root phototropism protein, putative [Ricinus communis]
Length=621

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 125/176 (71%), Gaps = 3/176 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM+S  K     L+ AM+RT +W+FSQEIP+DV V  G  SFSLHKF LV+K  YIRKL+
Sbjct  20   NMSSKKKEL---LTTAMKRTSEWIFSQEIPSDVTVHAGGVSFSLHKFPLVSKCGYIRKLV  76

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
             +S +ADL  I +  IPGG E FE AAKFCYG+NFEI+  N+A LRC A+YL+MT+ Y  
Sbjct  77   SESSDADLGEIEIPDIPGGAEAFELAAKFCYGINFEISTENIALLRCGADYLEMTEDYAV  136

Query  398  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             NL  R+E +L++VAL SL+GA+ +L   E LLP+AE +K+V RC++  +  AC E
Sbjct  137  GNLVARSESYLNEVALKSLAGAVTILHLAENLLPVAEKVKLVSRCIDAIAYMACKE  192



>ref|XP_003597110.1| Root phototropism protein [Medicago truncatula]
 ref|XP_003611625.1| Root phototropism protein [Medicago truncatula]
 gb|AES94583.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=630

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT  W+FSQEIP+DV V++GE+SF+LHK+ LV+K  YIRKL+ +S ++D++ + 
Sbjct  24   LSSAMKRTSDWIFSQEIPSDVNVQIGESSFTLHKYPLVSKCGYIRKLVSESNDSDVSFVE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            LS +PGG E FE AAKFCYG+NFEI V N+A LRC AEYL+MT+ Y   NL  RT+ +L+
Sbjct  84   LSDVPGGAEAFELAAKFCYGINFEINVENIAMLRCVAEYLEMTEDYSVGNLVARTDAYLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             VAL +++G++ +L   E LLP+AE  K+V +C++  +  AC E
Sbjct  144  DVALKTIAGSVSILHISESLLPIAEKTKLVSKCIDAIAYIACNE  187



>ref|XP_006841959.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
 gb|ERN03634.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
Length=609

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V+ G A+FSLHKF LV+K  Y+RKL+ ++ +ADL+ I 
Sbjct  20   LSSAMKRTSEWIFSQEIPSDVTVQAGGATFSLHKFPLVSKCGYMRKLVSEANDADLSMIE  79

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  IPGG E FE AAKFCYG+NFEI+  NVA LRC AEYL+MT+ Y   NL  RTE +++
Sbjct  80   IPDIPGGAEAFELAAKFCYGINFEISTENVAMLRCVAEYLEMTEDYTTGNLVNRTEAYVT  139

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  538
            +VAL SLSGA+ VL   E LLP+AE +K+V RC++
Sbjct  140  EVALKSLSGAITVLHRSESLLPMAEKVKLVSRCID  174



>gb|KJB43881.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=437

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 124/164 (76%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S AM+RT +W+FSQEIP+DV V+V   SFSLHKF LV+K  YIRK++ +S +AD++ I 
Sbjct  24   MSTAMKRTSEWIFSQEIPSDVTVQVAGVSFSLHKFPLVSKCGYIRKVVSESNDADVSVIV  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  +PGG E FE AAKFCYG+NFEI   N+AALRC AEYL+MT+ Y   +L  RTE FL+
Sbjct  84   IPDVPGGAESFELAAKFCYGINFEINTENIAALRCVAEYLEMTEDYAVGSLVERTEAFLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL SL+GA+ VL + E LLP+AE++K+V RC++  +  AC E
Sbjct  144  EVALQSLAGAISVLHASENLLPIAEEVKLVGRCIDAIAYLACKE  187



>gb|KHN36285.1| BTB/POZ domain-containing protein [Glycine soja]
Length=618

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V+VGEASFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPLVSKCGYIRKLVSESNDADVSFIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            L  +PGG E FE AAKFCYG+NFEI V N+A L C AEYL+MT+ Y   NL GRT+ +L+
Sbjct  84   LPDVPGGAEAFELAAKFCYGINFEINVENIATLCCVAEYLEMTEDYSVGNLMGRTDAYLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL +++GA+ VL   E LL +AE  K+V RC++  +  AC E
Sbjct  144  EVALKTIAGAVSVLHMSENLLAIAERAKLVSRCIDAIAFIACKE  187



>ref|XP_003517336.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
Length=618

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V+VGEASFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPLVSKCGYIRKLVSESNDADVSFIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            L  +PGG E FE AAKFCYG+NFEI V N+A L C AEYL+MT+ Y   NL GRT+ +L+
Sbjct  84   LPDVPGGAEAFELAAKFCYGINFEINVENIATLCCVAEYLEMTEDYSVGNLMGRTDAYLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL +++GA+ VL   E LL +AE  K+V RC++  +  AC E
Sbjct  144  EVALKTIAGAVSVLHMSENLLAIAERAKLVSRCIDAIAFIACKE  187



>ref|XP_011099322.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Sesamum 
indicum]
Length=616

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+D+ V  G  SFSLHKF LV+K  YIRKL+ +S +ADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDITVNAGGTSFSLHKFPLVSKCGYIRKLVSESSDADLSAIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEISTENIARLRCVAEYLEMTEDYAVGNLVGRTEAYLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  538
            +VAL SL+GA+ VL S E  LP AE +K+V RC++
Sbjct  144  EVALKSLAGAVSVLHSSESFLPTAEKVKLVSRCID  178



>ref|XP_010277089.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010277090.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
Length=605

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
             S AMERT +W+FSQEIP+D+ V  G ASFSLHKF LV+K  YIRKL+ +  +AD++ + 
Sbjct  9    FSTAMERTSEWIFSQEIPSDITVHAGGASFSLHKFPLVSKCGYIRKLVSEDSDADVSVVE  68

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            L  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTED+L+
Sbjct  69   LPDVPGGEEAFELAAKFCYGINFEISTENIATLRCVAEYLEMTEDYAVGNLVGRTEDYLN  128

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  538
            +VAL SL+GA+ VL + E LLP AE +K+V R ++
Sbjct  129  EVALKSLAGAISVLHTSENLLPTAEKVKLVSRSID  163



>gb|KDP32052.1| hypothetical protein JCGZ_12513 [Jatropha curcas]
Length=622

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  M+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRKL+ +  +ADLT I+
Sbjct  25   LSTVMKRTSEWIFSQEIPSDVTVLAGGASFSLHKFPLVSKCGYIRKLVSECNDADLTEIH  84

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  IPGG E FE AAKFCYG+NFEI   N+A LRC AEYL+MT+ Y   NL  RTE +L+
Sbjct  85   IPDIPGGGEAFELAAKFCYGINFEIGTENIAMLRCVAEYLEMTEDYAVGNLVARTEAYLN  144

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL SL+GA+ +L S E  LPLA+ +K+V RC++  +  AC E
Sbjct  145  EVALKSLAGAVSILYSSENFLPLADKVKLVSRCIDAIAFMACRE  188



>ref|XP_002533880.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF28503.1| Root phototropism protein, putative [Ricinus communis]
Length=549

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +2

Query  230  EADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLA  409
            E DLTRINLSGIPGGPE+FE+AAKFCYGVNFEITV NVAALRCAAEYLQMTD YCDNNLA
Sbjct  38   ETDLTRINLSGIPGGPEMFEKAAKFCYGVNFEITVQNVAALRCAAEYLQMTDLYCDNNLA  97

Query  410  GRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            GRT+DFL QVALSSLSGA+VVLKSCE+LLP+AEDLKIVQRCV + S KAC E
Sbjct  98   GRTDDFLGQVALSSLSGAVVVLKSCEDLLPMAEDLKIVQRCVNVISIKACNE  149



>ref|XP_010272171.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nelumbo 
nucifera]
Length=620

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 128/176 (73%), Gaps = 4/176 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM+S  K     LS AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRKL+
Sbjct  15   NMSSKKKQL---LSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKCGYIRKLV  71

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
             ++ +A ++ I L  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y  
Sbjct  72   SEASDAAVSVIELPDVPGG-EAFELAAKFCYGINFEISTENIAMLRCMAEYLEMTEDYAV  130

Query  398  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             NL GRTED+L++VAL SLSGA+ VL + E LLP+AE +K+V R ++  +  AC E
Sbjct  131  GNLVGRTEDYLNEVALKSLSGAISVLHASENLLPMAEKVKLVSRSIDAVAYIACKE  186



>ref|XP_006590635.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Glycine max]
Length=628

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 125/174 (72%), Gaps = 10/174 (6%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHK----------FMLVAKSNYIRKLIMD  223
            LS AM+RT +W+FSQEIP+DV V+VGEASFSLHK          F LV+K  YIRKL+ +
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKVANQFKYDSLFPLVSKCGYIRKLVSE  83

Query  224  SKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNN  403
            S +AD++ I L  +PGG E FE AAKFCYG+NF+I V N+A LRC AEYL+MT+ Y   N
Sbjct  84   SNDADVSFIELPEVPGGAEAFELAAKFCYGINFDINVENIATLRCVAEYLEMTEDYSVGN  143

Query  404  LAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            L GRT+ +L++VAL +++GA+ +L   E LLP+AE  K+V RC++  +  AC E
Sbjct  144  LVGRTDAYLNEVALKTIAGAVSILHMSENLLPIAERAKLVSRCIDAIAFIACKE  197



>gb|KJB43880.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=611

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 124/164 (76%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S AM+RT +W+FSQEIP+DV V+V   SFSLHKF LV+K  YIRK++ +S +AD++ I 
Sbjct  24   MSTAMKRTSEWIFSQEIPSDVTVQVAGVSFSLHKFPLVSKCGYIRKVVSESNDADVSVIV  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  +PGG E FE AAKFCYG+NFEI   N+AALRC AEYL+MT+ Y   +L  RTE FL+
Sbjct  84   IPDVPGGAESFELAAKFCYGINFEINTENIAALRCVAEYLEMTEDYAVGSLVERTEAFLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL SL+GA+ VL + E LLP+AE++K+V RC++  +  AC E
Sbjct  144  EVALQSLAGAISVLHASENLLPIAEEVKLVGRCIDAIAYLACKE  187



>ref|XP_010559028.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Tarenaya hassleriana]
Length=589

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 125/166 (75%), Gaps = 2/166 (1%)
 Frame = +2

Query  74   LSLAMERTGQW-VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTR  247
            +S AM+RT +W + SQEIP+DV   VGEASFSLHKF LV+KS +IRKL+ +S  E+D++ 
Sbjct  9    MSSAMKRTSEWWISSQEIPSDVTAHVGEASFSLHKFPLVSKSGFIRKLVSESNNESDISV  68

Query  248  INLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDF  427
            I +  IPGG E FE AAKFCYG+NFEIT  N+A LRCAAEYL+MT+++   NL GR E +
Sbjct  69   IGIHEIPGGAEAFEMAAKFCYGINFEITTENIAMLRCAAEYLEMTEEHSVGNLLGRAEAY  128

Query  428  lsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            L++VAL SLS ++ VL   E+LLP+AE +K+V RC++  +  AC E
Sbjct  129  LNEVALKSLSSSITVLHKAEDLLPMAERVKLVSRCIDAIAYAACQE  174



>ref|XP_008238282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
 ref|XP_008238290.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
Length=624

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS A++RT +W+FSQEIP+DV + VG  SFSLHKF L++K  YIRKLI +S +ADL+ I 
Sbjct  26   LSSALKRTSEWIFSQEIPSDVNIHVGGVSFSLHKFPLISKCGYIRKLISESSDADLSVIE  85

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            L  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT+ +   NL GRT+ +L+
Sbjct  86   LPDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLVMTEDHAVGNLVGRTDAYLN  145

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +VAL SL+GA+ VL   E  LP+AE +K+V RC++  +   C E
Sbjct  146  EVALESLAGAVSVLHISESFLPMAEKVKLVSRCIDAIALIVCKE  189



>ref|XP_010679598.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679599.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679600.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679601.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679602.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679603.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679604.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=624

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            L+ AM+RT +W+ SQEIP+DV + + +ASFSLHKF LV+KS YI+KL+ +S ++++  + 
Sbjct  14   LTSAMKRTSEWIISQEIPSDVTINIDDASFSLHKFPLVSKSGYIKKLLSESNDSEICNLE  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  IPGG E FE AAKFCYG+NFEI   N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  74   IHDIPGGAEAFELAAKFCYGINFEICTENIAMLRCVAEYLEMTEDYAVGNLVGRTETYLN  133

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            +VA+ SLS    +L + E LLP+AE +K+V RCV+  +  AC
Sbjct  134  EVAVKSLSSCASILLTSENLLPMAEQVKVVSRCVDAIAYLAC  175



>ref|XP_003608469.1| BTB/POZ domain-containing protein [Medicago truncatula]
Length=424

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 119/153 (78%), Gaps = 2/153 (1%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA--DLTRINLS  259
            M+RT +W +SQEIP+DV +++GEAS+SLHKF L++KS YIRKLI +S +A  D+  I L 
Sbjct  1    MKRTSEWNYSQEIPSDVAIQIGEASYSLHKFPLISKSGYIRKLISESSDAVDDVPLIELI  60

Query  260  GIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqv  439
             +PGG E FE AAKFCYG+NFEI+V N+A LRC AEYL+MT+ Y   NL GRT+ +L++V
Sbjct  61   DVPGGSEAFELAAKFCYGINFEISVENIAMLRCVAEYLEMTEDYSVGNLVGRTDSYLNEV  120

Query  440  alsslsgalvvlksCEELLPLAEDLKIVQRCVE  538
            AL S+SGA+ +L + E LLP+AE  K+V RC++
Sbjct  121  ALKSMSGAISILHTSETLLPIAEKAKLVSRCID  153



>ref|XP_010679597.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=634

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            L+ AM+RT +W+ SQEIP+DV + + +ASFSLHKF LV+KS YI+KL+ +S ++++  + 
Sbjct  24   LTSAMKRTSEWIISQEIPSDVTINIDDASFSLHKFPLVSKSGYIKKLLSESNDSEICNLE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  IPGG E FE AAKFCYG+NFEI   N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  84   IHDIPGGAEAFELAAKFCYGINFEICTENIAMLRCVAEYLEMTEDYAVGNLVGRTETYLN  143

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            +VA+ SLS    +L + E LLP+AE +K+V RCV+  +  AC
Sbjct  144  EVAVKSLSSCASILLTSENLLPMAEQVKVVSRCVDAIAYLAC  185



>ref|XP_010905282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Elaeis guineensis]
Length=609

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+ SQEIP+D+ +  G ++F+LHKF LV+K  YIR+L+ ++ +++++ I 
Sbjct  22   LSTAMKRTSEWILSQEIPSDITIHAGGSTFALHKFPLVSKCGYIRRLVSEANDSNMSVIE  81

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  +PGG E FE AAKFCYG+NFEIT+ N+A LRCAAE+L+MT+ Y   NL  RTED+L 
Sbjct  82   IPDVPGGSEAFELAAKFCYGINFEITMENIAMLRCAAEHLEMTEDYAAGNLVNRTEDYLE  141

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            +VAL SLSGA+ +L+  E+LLP+AE +K+V RC++  +  AC
Sbjct  142  EVALLSLSGAVTLLQKSEDLLPMAEKVKLVSRCIDAVAYIAC  183



>ref|XP_004288469.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=623

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 126/174 (72%), Gaps = 3/174 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM+S  K     L+ A++RT +W+FSQEIP+DV V VGE SFSLHKF LV+K  YIRKL+
Sbjct  18   NMSSKKKEL---LTSALKRTSEWIFSQEIPSDVSVRVGEVSFSLHKFPLVSKCGYIRKLV  74

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
             +S + +++ I L  +PGG E FE AAKFCYG+NFEI+  N+A LRC +EYL MT++Y  
Sbjct  75   SESTDDEISVIELPDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVSEYLLMTEEYAI  134

Query  398  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
             NL GRT+ +L++VAL SL+GA+ VL + E  LP+AE +K+V RC++  +   C
Sbjct  135  GNLVGRTDAYLNEVALKSLAGAVSVLHTAESFLPIAEKVKLVSRCIDAIAYMTC  188



>ref|XP_007208165.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
 gb|EMJ09364.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
Length=624

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 123/176 (70%), Gaps = 3/176 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM S  K     LS A++RT +W+FSQEIP+DV + VG  SFSLHKF L++K  YIRKLI
Sbjct  17   NMTSKKKEL---LSSALKRTSEWIFSQEIPSDVNIHVGGVSFSLHKFPLISKCGYIRKLI  73

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
             +S +ADL+ I L  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT+    
Sbjct  74   SESSDADLSVIELPDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLVMTEDNAV  133

Query  398  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             NL GRT+ +L++VAL SL+GA+ VL   E  LP+AE +K+V RC++  +   C E
Sbjct  134  GNLVGRTDAYLNEVALKSLAGAVSVLHISESFLPMAEKVKLVSRCIDAIALIVCKE  189



>gb|KEH28209.1| root phototropism-like protein [Medicago truncatula]
Length=536

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +2

Query  179  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  358
            MLVAKSNYIRKLIM+S E++LTR++LS IPGG E FE+AAKFCYGVNFEITV+NVA+L C
Sbjct  1    MLVAKSNYIRKLIMESNESELTRLDLSDIPGGQEAFEKAAKFCYGVNFEITVNNVASLHC  60

Query  359  AAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  538
            AA +LQMTD+YCD NLAGRTE FLSQVAL++LSGA VVLKSC +L+P+A++L IV+RCV+
Sbjct  61   AAMFLQMTDEYCDGNLAGRTEGFLSQVALTTLSGAAVVLKSCRQLIPVADELNIVKRCVD  120

Query  539  LASAKACVE  565
              S+K C E
Sbjct  121  AVSSKVCNE  129



>gb|AES90666.2| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=595

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 119/153 (78%), Gaps = 2/153 (1%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA--DLTRINLS  259
            M+RT +W +SQEIP+DV +++GEAS+SLHKF L++KS YIRKLI +S +A  D+  I L 
Sbjct  1    MKRTSEWNYSQEIPSDVAIQIGEASYSLHKFPLISKSGYIRKLISESSDAVDDVPLIELI  60

Query  260  GIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqv  439
             +PGG E FE AAKFCYG+NFEI+V N+A LRC AEYL+MT+ Y   NL GRT+ +L++V
Sbjct  61   DVPGGSEAFELAAKFCYGINFEISVENIAMLRCVAEYLEMTEDYSVGNLVGRTDSYLNEV  120

Query  440  alsslsgalvvlksCEELLPLAEDLKIVQRCVE  538
            AL S+SGA+ +L + E LLP+AE  K+V RC++
Sbjct  121  ALKSMSGAISILHTSETLLPIAEKAKLVSRCID  153



>gb|KHN12984.1| BTB/POZ domain-containing protein [Glycine soja]
Length=640

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 125/186 (67%), Gaps = 22/186 (12%)
 Frame = +2

Query  74   LSLAMERTGQW----------------------VFSQEIPTDVIVEVGEASFSLHKFMLV  187
            LS AM+RT +W                      +FSQEIP+DV V+VGEASFSLHKF LV
Sbjct  24   LSSAMKRTSEWYASCPLNETNTLVAFMSNVHNLIFSQEIPSDVNVQVGEASFSLHKFPLV  83

Query  188  AKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAE  367
            +K  YIRKL+ +S +AD++ I L  +PGG E FE AAKFCYG+NF+I V N+A LRC AE
Sbjct  84   SKCGYIRKLVSESNDADVSFIELPEVPGGAEAFELAAKFCYGINFDINVENIATLRCVAE  143

Query  368  YLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELAS  547
            YL+MT+ Y   NL GRT+ +L++VAL +++GA+ +L   E LLP+AE  K+V RC++  +
Sbjct  144  YLEMTEDYSVGNLVGRTDAYLNEVALKTIAGAVSILHMSENLLPIAERAKLVSRCIDAIA  203

Query  548  AKACVE  565
              AC E
Sbjct  204  FIACKE  209



>ref|XP_009342777.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Pyrus 
x bretschneideri]
Length=629

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 125/177 (71%), Gaps = 4/177 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM+S  K     LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +IRKLI
Sbjct  21   NMSSKKKEL---LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIRKLI  77

Query  218  MDSKEA-DLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYC  394
             +S +A DL+ I LS +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT+ Y 
Sbjct  78   SESSDAADLSIIELSDVPGGSEAFELAAKFCYGINFEISTENIAMLRCVAEYLLMTEDYA  137

Query  395  DNNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
              NL GR + +L++VAL S +GA+ VL   E  LP+AE +K+V RC++  +  AC E
Sbjct  138  VGNLVGRADAYLNEVALKSPAGAVTVLHMSESFLPMAEKVKLVNRCIDAIAFIACKE  194



>ref|XP_008354715.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=626

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA-DLTRI  250
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +IRKLI +S +A DL+ I
Sbjct  27   LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIRKLISESSDAADLSVI  86

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             LS +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT+ Y   NL GR + +L
Sbjct  87   ELSDVPGGSEAFELAAKFCYGINFEISTENIAMLRCVAEYLLMTEDYGVGNLVGRADAYL  146

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SL+GA+ VL   E  LP+AE +K+V RC++  +  AC E
Sbjct  147  NEVALKSLAGAVTVLHMSESFLPMAEKVKLVNRCIDAIAFIACKE  191



>ref|XP_004233453.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Solanum lycopersicum]
Length=605

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 116/162 (72%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  M+RT +W+ SQ+IP+D+ + VG  SF+LHKF LV+K  YIRKL+  S +A L+ I 
Sbjct  22   LSNVMKRTSEWILSQDIPSDITIHVGRTSFALHKFPLVSKCGYIRKLVSKSNDAKLSTIE  81

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  IPGGPE FE AAKFCY +NFEI+  N+A +RC AEYL+MTD Y   NL G TE +L+
Sbjct  82   IPDIPGGPEAFELAAKFCYEINFEISPENIALIRCVAEYLEMTDDYAVGNLVGLTETYLT  141

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            +V L S++ ++ +L S E+LLP+AED+K+V R ++  +   C
Sbjct  142  EVGLKSIASSVSILHSSEKLLPIAEDIKLVNRSIDTIAYIVC  183



>gb|EPS72379.1| hypothetical protein M569_02379, partial [Genlisea aurea]
Length=583

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 123/164 (75%), Gaps = 3/164 (2%)
 Frame = +2

Query  77   SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD-LTRIN  253
            S AM+RT +W+FSQEIP+D+ ++VG+ SFSLHKF LV+K  YIR+ + +S EAD  T + 
Sbjct  14   STAMKRTSEWIFSQEIPSDITIKVGDNSFSLHKFPLVSKCGYIRRFVSESDEADDPTTLE  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  IPGG E F+ AAKFCYG+NFE+   N+AA+RCAAE+L+MT+ Y   NL  R E ++S
Sbjct  74   IDDIPGGAESFDYAAKFCYGINFEMNAGNIAAIRCAAEFLEMTEDYAVGNLVSRAESYIS  133

Query  434  qvalsslsgalvvlksCE--ELLPLAEDLKIVQRCVELASAKAC  559
            +VAL+SLS A+ VL +CE   LLP+AED+K+V RC++  +  AC
Sbjct  134  EVALTSLSVAVSVLHTCENNNLLPVAEDVKLVSRCIDAIALFAC  177



>ref|XP_002866705.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42964.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
Length=604

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLVSESNKDSDSTVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
            N++ IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   NITDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAESYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             +VAL SLS ++ VL   EELLP+AE +K+V RC++  +   C E
Sbjct  129  DEVALKSLSSSITVLHKSEELLPIAERVKLVSRCIDAIAYMTCQE  173



>ref|XP_009611132.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Nicotiana 
tomentosiformis]
Length=606

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 122/169 (72%), Gaps = 4/169 (2%)
 Frame = +2

Query  68   TRLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD  238
            ++LSLA    +R  +WVF +++P+D+ +EV   +FSLHKF LV++S  IRKL+   +++D
Sbjct  6    SQLSLAKCSRQRYSEWVF-RDVPSDITIEVDGGTFSLHKFPLVSRSGRIRKLVAGHRDSD  64

Query  239  LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT  418
            ++RI L  +PGG E FE AAKFCYGVNFEIT  NVA L C ++YL+MT+ Y  NNL  R 
Sbjct  65   ISRIELLSLPGGAESFELAAKFCYGVNFEITAANVAQLCCVSDYLEMTEDYSKNNLGSRA  124

Query  419  EDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            E++L  VA  +L   + VLK CE LLPLA++LKIV RC++  ++KACVE
Sbjct  125  EEYLDIVACKNLEMCVEVLKQCENLLPLADELKIVTRCIDAIASKACVE  173



>ref|XP_008352542.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=448

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 120/165 (73%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +I+KLI +S   ADL+ I
Sbjct  9    LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIKKLISESSYAADLSVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             LS +PGG E FE AA+FCYG+NFE++  N+A LRC AEYL MT+ Y   NL GR + +L
Sbjct  69   ELSDVPGGSEAFELAARFCYGINFELSTGNIAMLRCVAEYLLMTEDYAVGNLVGRADAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SL+GA+ VL   E  LP+AE +K+V RC++  +  AC E
Sbjct  129  NEVALKSLAGAVTVLHMSENFLPMAEKVKLVSRCIDAIAFMACKE  173



>ref|XP_010939121.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Elaeis 
guineensis]
Length=606

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 121/173 (70%), Gaps = 2/173 (1%)
 Frame = +2

Query  47   SPLKSAATR--LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            SP  +A  +  LS  M+RT +W+ SQE+P+D+ V  G A+F+LHKF L++K  YIR+L+ 
Sbjct  9    SPPSAAIKKELLSTTMKRTSEWILSQEVPSDITVHAGGATFALHKFPLISKCGYIRRLVS  68

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            ++ +++++ I +  +PGG E F  AAKFCYG+NFEIT  N+A LRC AEYL+MT+ Y   
Sbjct  69   EANDSNISLIEIPDVPGGAEAFGFAAKFCYGINFEITTENIAMLRCVAEYLEMTEDYVVG  128

Query  401  NLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            NL  RTE FL +VAL SL  A+ VL   EELLP+AE +K+V RC++  +  AC
Sbjct  129  NLVSRTEIFLEEVALMSLPDAVTVLHKSEELLPMAEKVKLVSRCIDAVAYIAC  181



>ref|XP_002521098.1| protein binding protein, putative [Ricinus communis]
 gb|EEF41249.1| protein binding protein, putative [Ricinus communis]
Length=610

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 123/173 (71%), Gaps = 4/173 (2%)
 Frame = +2

Query  56   KSAATRLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS  226
            K    +LSLA    +R  +W+F +++P+D+ +EV   +F+LHKF LV++S  IRKL+ + 
Sbjct  3    KQQQQQLSLAKCSRQRCNEWIF-RDVPSDITIEVSGGTFALHKFPLVSRSGRIRKLVAEH  61

Query  227  KEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL  406
            ++AD++R+ L  +PGGPE FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL
Sbjct  62   RDADISRVELLNLPGGPETFELAAKFCYGINFEITSTNVAQLCCVSDYLEMTEEFSKDNL  121

Query  407  AGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
              R E+++  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E
Sbjct  122  GSRAEEYVESIVCKNLEMCVEVLQQCENLLPLADELKIVSRCIDAIASKACAE  174



>ref|XP_008372448.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=448

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L+ K  +I+KLI +S   ADL+ I
Sbjct  9    LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLIXKCGHIKKLISESSYAADLSVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             LS +PGG E FE AA+FCYG+NFE++  N+A LRC AEYL MT+ Y   NL GR + +L
Sbjct  69   ELSDVPGGSEAFELAARFCYGINFELSTGNIAMLRCVAEYLLMTEDYAVGNLVGRADAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SL+GA+ VL   E  LP+AE +K+V RC++  +  AC E
Sbjct  129  NEVALKSLAGAVTVLHMSENFLPMAEKVKLVSRCIDAIAFMACKE  173



>ref|XP_004509079.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509080.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=598

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMD-SKEADLTRINLSG  262
            M+RT +W +SQEIP+DV +++GEAS+SLHKF L++KS YIRK I + S  A++  I L  
Sbjct  1    MKRTSEWNYSQEIPSDVTIQIGEASYSLHKFPLISKSGYIRKFISEYSDAAEVPTIELFD  60

Query  263  IPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqva  442
            +PGG E FE AAKFCYG+NFEI+V N+A LRC AEYL+MT+ Y   NL GRT+ +L++VA
Sbjct  61   VPGGSEAFELAAKFCYGINFEISVENIAMLRCVAEYLEMTEDYSVGNLVGRTDSYLNEVA  120

Query  443  lsslsgalvvlksCEELLPLAEDLKIVQRCVE  538
            L S SGA+ +L   E LLP+AE  K++ RC++
Sbjct  121  LKSFSGAISILHISETLLPIAEKAKLISRCID  152



>ref|XP_009766799.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X1 [Nicotiana sylvestris]
Length=598

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 120/172 (70%), Gaps = 6/172 (3%)
 Frame = +2

Query  50   PLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK  229
            PL  + +R     +R  +WVF +++P+D+ +EV    FSLHKF LV++S  IR+L+ + +
Sbjct  9    PLTKSTSR-----QRYNEWVF-RDVPSDITIEVDGGIFSLHKFPLVSRSGRIRRLVAEHR  62

Query  230  EADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLA  409
            ++D++RI L  +PGG E FE AAKFCYGVNFEIT  NVA L C ++YL+M++ Y  NNL 
Sbjct  63   DSDISRIELVSLPGGTESFELAAKFCYGVNFEITAANVAQLCCVSDYLEMSEDYSKNNLG  122

Query  410  GRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             R E++L  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KACVE
Sbjct  123  SRAEEYLDSIVCKNLEMCVEVLRQCENLLPLADELKIVSRCIDAVASKACVE  174



>ref|XP_004511859.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X3 [Cicer arietinum]
Length=678

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 115/153 (75%), Gaps = 0/153 (0%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  286
            +FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I LS +PGG E F
Sbjct  86   IFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIELSDVPGGAEAF  145

Query  287  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgal  466
            E AAKFCYG+NFEI V N+A LRC AEYL+MT++Y   NL GRT+ +L+ VAL +++GA+
Sbjct  146  ELAAKFCYGINFEINVENIATLRCVAEYLEMTEEYAVGNLVGRTDAYLNDVALKTIAGAV  205

Query  467  vvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             +L   E LLP+AE  K++ +C++  +  AC E
Sbjct  206  SILHMSESLLPIAEKAKLMSKCIDAIAYIACKE  238



>ref|XP_006364419.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=602

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 115/162 (71%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  M+RT +W+ SQ+IP+D+ + VG  SFSLHKF LV+K  YIRKL+  S +A L+ I 
Sbjct  22   LSNVMKRTSEWILSQDIPSDITIHVGRTSFSLHKFPLVSKCGYIRKLVSKSSDAKLSAIE  81

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  IPGG E FE AAKFCY +NFEI   N+A +RC AEYL+MTD+Y   NL G TE +L+
Sbjct  82   IPDIPGGAEAFELAAKFCYDINFEINPENIALIRCVAEYLEMTDEYAVGNLVGLTEAYLN  141

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            +V L S++ ++ +L S E+LLP+AED+K+V R ++  +   C
Sbjct  142  EVGLKSIASSVSILHSSEKLLPIAEDIKLVNRSIDTIAYIVC  183



>ref|XP_009599429.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Nicotiana 
tomentosiformis]
Length=598

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 120/172 (70%), Gaps = 6/172 (3%)
 Frame = +2

Query  50   PLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK  229
            PL  + +R     +R  +WVF +++P+D+ +EV    FSLHKF LV++S  IRKL+ + +
Sbjct  9    PLTKSTSR-----QRYNEWVF-RDVPSDITIEVDGGIFSLHKFPLVSRSGRIRKLVAEHR  62

Query  230  EADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLA  409
            ++D++RI L  +PGG E FE AAKFCYGVNFEIT  NVA L C ++YL+M++ Y  NNL 
Sbjct  63   DSDISRIELVSLPGGAESFELAAKFCYGVNFEITAANVAQLCCVSDYLEMSEDYSKNNLG  122

Query  410  GRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             R E++L  +   +L   + VL+ CE LLPLA++LK+V RC++  ++KACVE
Sbjct  123  SRAEEYLDSIVCKNLEMCVEVLRQCENLLPLADELKVVSRCIDAVASKACVE  174



>ref|XP_009630230.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Nicotiana tomentosiformis]
Length=446

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 117/162 (72%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  M+RT +W+ SQEIP+D+ V V   SF+LHKF LV+K  YIRKL+  S +A+L+ I 
Sbjct  26   LSNVMKRTSEWILSQEIPSDITVHVAGTSFALHKFPLVSKCGYIRKLVAKSNDANLSEIE  85

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  IPGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MTD Y   NL G +E +L+
Sbjct  86   IPDIPGGAEAFEFAAKFCYGINFEISSGNIALLRCVAEYLDMTDYYAVGNLVGLSEAYLN  145

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            +VAL S++GA+ VL S E+LLP+AE++K+V R ++  +   C
Sbjct  146  EVALKSIAGAVSVLHSSEKLLPIAENIKLVNRSIDTIAYIVC  187



>ref|XP_004511857.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511858.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=679

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 115/153 (75%), Gaps = 0/153 (0%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  286
            +FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I LS +PGG E F
Sbjct  86   IFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIELSDVPGGAEAF  145

Query  287  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgal  466
            E AAKFCYG+NFEI V N+A LRC AEYL+MT++Y   NL GRT+ +L+ VAL +++GA+
Sbjct  146  ELAAKFCYGINFEINVENIATLRCVAEYLEMTEEYAVGNLVGRTDAYLNDVALKTIAGAV  205

Query  467  vvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             +L   E LLP+AE  K++ +C++  +  AC E
Sbjct  206  SILHMSESLLPIAEKAKLMSKCIDAIAYIACKE  238



>ref|XP_006380638.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58435.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=643

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 114/153 (75%), Gaps = 0/153 (0%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  286
            +FSQEIP+DV V  G ASFSLHKF LV+KS YIRK++ +S +ADL+ I +  +PGG E F
Sbjct  62   IFSQEIPSDVTVHAGGASFSLHKFPLVSKSGYIRKMVSESSDADLSEIKIPNVPGGAEAF  121

Query  287  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgal  466
            E AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  RT+ +L++VAL SL+GA+
Sbjct  122  ELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYAVGNLVSRTDAYLNEVALKSLAGAV  181

Query  467  vvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             VL   E LLP+AE +K+V RC++  +  AC E
Sbjct  182  SVLHLSENLLPMAEKVKLVSRCLDAIALAACKE  214



>ref|XP_011089690.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X4 [Sesamum indicum]
Length=423

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+I++V   +FSLHKF LV++S  IRKL+ + +++D++RI L  +P
Sbjct  17   QRCSEWVF-RDVPSDIIIDVDGGTFSLHKFPLVSRSGRIRKLVAEHRDSDISRIELLSLP  75

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG + FE AA+FCYG+NFEIT  NVA L C ++YL+MT++Y  NNL  R E++L  V   
Sbjct  76   GGAKSFELAAQFCYGINFEITAANVAQLCCVSDYLEMTEEYSKNNLGSRAEEYLESVVCK  135

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VL+ CE LLPLA++L IV RC++  ++KACVE
Sbjct  136  NLEMCVEVLQQCENLLPLADELNIVPRCIDAIASKACVE  174



>ref|XP_001770455.1| predicted protein [Physcomitrella patens]
 gb|EDQ64792.1| predicted protein [Physcomitrella patens]
Length=622

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 115/156 (74%), Gaps = 5/156 (3%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM---DSKEADLTRINLSGIPGGP  277
            V + ++P+D++VE G  +FSLHKF LVA+S  IRKL+    DS+  +L  + L+ +PGG 
Sbjct  27   VLTTDVPSDIVVEAGGMNFSLHKFPLVARSGRIRKLVANLADSENPNL--LQLTDVPGGA  84

Query  278  EIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalssls  457
            E F+ AAKFCYG+NFEIT  NVA LRCAAEYL MT+ Y +NNL  RTE FLS+V L SL+
Sbjct  85   EAFDLAAKFCYGINFEITTSNVAVLRCAAEYLDMTESYGENNLVARTEAFLSEVVLQSLA  144

Query  458  galvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             ++ VL +CE LLPLAEDL IV RC+E A+ KAC E
Sbjct  145  DSIAVLHNCENLLPLAEDLGIVSRCIESAATKACRE  180



>ref|XP_008382632.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Malus 
domestica]
Length=621

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 123/168 (73%), Gaps = 5/168 (3%)
 Frame = +2

Query  74   LSLA----MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            LSLA     +R  +W+F +++P+D+ ++V   +FSLHKF LV++S  IR+L+ + +++D+
Sbjct  18   LSLAKSSRQQRYNEWIF-RDVPSDITIQVNGGAFSLHKFPLVSRSGRIRRLVAEHRDSDI  76

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L CA++YL+MT+++  +NL  RTE
Sbjct  77   SRVELLNLPGGAESFELAAKFCYGINFEITSSNVAQLCCASDYLEMTEEFSKDNLGSRTE  136

Query  422  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++L  V   +L   + VL+ CE LLPLA++L+IV RC++  ++KACVE
Sbjct  137  EYLESVVCKNLEMCVEVLQQCESLLPLADELRIVSRCIDAIASKACVE  184



>ref|XP_009792130.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Nicotiana 
sylvestris]
Length=606

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+ +EV   +FSLHKF LV++S  IRKL+   +++D++RI L  +P
Sbjct  16   QRYSEWVF-RDVPSDITIEVDGGTFSLHKFPLVSRSGRIRKLVAGHRDSDISRIELLSLP  74

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG E FE AAKFCYGVNFEIT  NVA L C ++YL+MT+ Y  NNL  R E++L  VA  
Sbjct  75   GGVESFELAAKFCYGVNFEITAANVAQLCCVSDYLEMTEDYSKNNLGSRAEEYLDIVACK  134

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VLK CE LLPLA++LKIV RC++  ++KAC E
Sbjct  135  NLEMCVEVLKQCENLLPLADELKIVTRCIDAIASKACAE  173



>ref|XP_009334929.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Pyrus 
x bretschneideri]
Length=687

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 123/168 (73%), Gaps = 5/168 (3%)
 Frame = +2

Query  74   LSLA----MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            LSLA     +R  +W+F +++P+D+ ++V   +FSLHKF LV++S  IR+L+ + +++D+
Sbjct  84   LSLAKSSRQQRYNEWIF-RDVPSDITIQVNGGAFSLHKFPLVSRSGRIRRLVAEHRDSDI  142

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L CA++YL+MT+++  +NL  RTE
Sbjct  143  SRVELLNLPGGAESFELAAKFCYGINFEITSSNVAQLCCASDYLEMTEEFSKDNLGSRTE  202

Query  422  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++L  V   +L   + VL+ CE LLPLA++L+IV RC++  ++KACVE
Sbjct  203  EYLESVVCKNLEMCVEVLQQCESLLPLADELRIVSRCIDAIASKACVE  250



>ref|XP_009630229.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nicotiana tomentosiformis]
Length=618

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 117/162 (72%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  M+RT +W+ SQEIP+D+ V V   SF+LHKF LV+K  YIRKL+  S +A+L+ I 
Sbjct  26   LSNVMKRTSEWILSQEIPSDITVHVAGTSFALHKFPLVSKCGYIRKLVAKSNDANLSEIE  85

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  IPGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MTD Y   NL G +E +L+
Sbjct  86   IPDIPGGAEAFEFAAKFCYGINFEISSGNIALLRCVAEYLDMTDYYAVGNLVGLSEAYLN  145

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            +VAL S++GA+ VL S E+LLP+AE++K+V R ++  +   C
Sbjct  146  EVALKSIAGAVSVLHSSEKLLPIAENIKLVNRSIDTIAYIVC  187



>ref|XP_007201187.1| hypothetical protein PRUPE_ppa002993mg [Prunus persica]
 gb|EMJ02386.1| hypothetical protein PRUPE_ppa002993mg [Prunus persica]
Length=614

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 122/169 (72%), Gaps = 5/169 (3%)
 Frame = +2

Query  71   RLSLA----MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD  238
            +LSLA     +R  +W+F +++P+D+ ++V   +FSLHKF LV++S  IRKL+ + +++D
Sbjct  10   QLSLAKSSRQQRNNEWIF-RDVPSDITIQVNGGAFSLHKFPLVSRSGRIRKLVAEHRDSD  68

Query  239  LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT  418
            ++R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L CA++YL+MT+++  +NL  R 
Sbjct  69   ISRVELLNLPGGAESFELAAKFCYGINFEITSGNVAQLCCASDYLEMTEEFSKDNLGSRA  128

Query  419  EDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            E++L  +   +L   + VL  CE LLPLA++LKIV RC++  ++KACVE
Sbjct  129  EEYLECIVCKNLEMCVEVLLQCESLLPLADELKIVSRCIDAIASKACVE  177



>ref|XP_011089103.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Sesamum 
indicum]
Length=612

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+ +EV  A+FSLHKF LV++S  IRKL+ + +++D++ I L G+P
Sbjct  17   QRCSEWVF-RDVPSDITIEVDGAAFSLHKFPLVSRSGRIRKLVAEHRDSDISGIELPGLP  75

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG E FE AA+FCYGVNFEIT  NVA L C ++YL+MT++Y  NNL  R E++L  +   
Sbjct  76   GGAESFELAAQFCYGVNFEITAANVAQLCCVSDYLEMTEEYSKNNLGLRCEEYLESIVCK  135

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VL+ CE L PLA++LKIV RC++  ++KAC E
Sbjct  136  NLEMCVEVLQQCENLFPLADELKIVTRCIDATASKACAE  174



>ref|XP_010028108.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X3 [Eucalyptus grandis]
Length=597

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  286
            +FSQEIP+DV V     SF+LHKF LV++   IRKL+ +S EADL+ I L GIPGG E F
Sbjct  14   IFSQEIPSDVTVHAAGTSFALHKFPLVSRCGCIRKLVSESSEADLSNIELVGIPGGAEAF  73

Query  287  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgal  466
            E AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRTE +L +VAL S++GA+
Sbjct  74   ELAAKFCYGINFEISTKNIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLKEVALKSIAGAI  133

Query  467  vvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             VL   E LLP+AE +K+V RC++  +  AC E
Sbjct  134  TVLHMTESLLPIAEKVKLVVRCIDAIAFLACKE  166



>ref|XP_004247086.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Solanum 
lycopersicum]
Length=607

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+++ V   +FSLHKF LV++S  IRKL+   +++D++ I L  +P
Sbjct  17   QRYNEWVF-RDVPSDIMIVVDGGTFSLHKFPLVSRSGRIRKLVAGHRDSDISMIELHSLP  75

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG E FE AAKFCYGVNFEIT  NVA L C ++YL+MT++Y  NNL  R E++L  V   
Sbjct  76   GGAESFELAAKFCYGVNFEITSANVAQLYCVSDYLEMTEEYSKNNLGSRAEEYLEVVVSK  135

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VLK CE LLPLA++LKIV RC++  ++KACVE
Sbjct  136  NLEMCVEVLKQCENLLPLADELKIVIRCIDAIASKACVE  174



>ref|XP_011089689.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X3 [Sesamum indicum]
Length=603

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+I++V   +FSLHKF LV++S  IRKL+ + +++D++RI L  +P
Sbjct  17   QRCSEWVF-RDVPSDIIIDVDGGTFSLHKFPLVSRSGRIRKLVAEHRDSDISRIELLSLP  75

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG + FE AA+FCYG+NFEIT  NVA L C ++YL+MT++Y  NNL  R E++L  V   
Sbjct  76   GGAKSFELAAQFCYGINFEITAANVAQLCCVSDYLEMTEEYSKNNLGSRAEEYLESVVCK  135

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VL+ CE LLPLA++L IV RC++  ++KACVE
Sbjct  136  NLEMCVEVLQQCENLLPLADELNIVPRCIDAIASKACVE  174



>ref|XP_001763717.1| predicted protein [Physcomitrella patens]
 gb|EDQ71359.1| predicted protein [Physcomitrella patens]
Length=599

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 116/154 (75%), Gaps = 5/154 (3%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI---MDSKEADLTRINLSGIPGGP  277
            V + ++P+D++VE G  +FSLHKF LVA+S  IRKL+   +D++  +L R  L+ +PGG 
Sbjct  22   VLTTDVPSDLVVEAGGMNFSLHKFPLVARSGRIRKLVPNLVDNENPNLLR--LTDVPGGA  79

Query  278  EIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalssls  457
            E F+ AAKFCYG+NFEIT  NVA LRCAAEYL+MT+ Y +NNL  RTE FLS+V L SL+
Sbjct  80   EAFDLAAKFCYGINFEITTSNVAVLRCAAEYLEMTEPYGENNLVARTETFLSEVVLQSLA  139

Query  458  galvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
             ++ VL +CE LLPLAEDL IV +C+E A+ KAC
Sbjct  140  DSIAVLHNCENLLPLAEDLGIVSKCIESAATKAC  173



>ref|XP_003600551.1| Root phototropism protein [Medicago truncatula]
Length=513

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
            M+S E  LTRI+LS IPGG  IFE+AAKFCYGVNFEITVHNVA LRCAAE+LQMTD+YCD
Sbjct  1    MESDETHLTRIDLSDIPGGSGIFEKAAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCD  60

Query  398  NNLAGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            NNLAGRT++FLS+VA  +L+G++ VLKSC  LLP A+DL IV+RCVE ASAKAC E
Sbjct  61   NNLAGRTDEFLSKVAFFTLTGSVAVLKSCHHLLPYADDLNIVKRCVEAASAKACSE  116



>ref|XP_011089687.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X2 [Sesamum indicum]
 ref|XP_011089688.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X2 [Sesamum indicum]
Length=607

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+I++V   +FSLHKF LV++S  IRKL+ + +++D++RI L  +P
Sbjct  17   QRCSEWVF-RDVPSDIIIDVDGGTFSLHKFPLVSRSGRIRKLVAEHRDSDISRIELLSLP  75

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG + FE AA+FCYG+NFEIT  NVA L C ++YL+MT++Y  NNL  R E++L  V   
Sbjct  76   GGAKSFELAAQFCYGINFEITAANVAQLCCVSDYLEMTEEYSKNNLGSRAEEYLESVVCK  135

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VL+ CE LLPLA++L IV RC++  ++KACVE
Sbjct  136  NLEMCVEVLQQCENLLPLADELNIVPRCIDAIASKACVE  174



>ref|XP_006356774.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Solanum 
tuberosum]
Length=607

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+++ V   +FSLHKF LV++S  IRKL+   +++D++ I L  +P
Sbjct  17   QRYNEWVF-RDVPSDIMIVVDGGTFSLHKFPLVSRSGRIRKLVAGHRDSDISMIELLSLP  75

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG E FE AAKFCYGVNFEIT  NVA L C ++YL+MTD+Y  NNL  R E++L  V   
Sbjct  76   GGAESFELAAKFCYGVNFEITAANVAQLCCVSDYLEMTDEYSKNNLGSRAEEYLEVVVSK  135

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VLK CE LLPLA++LK+V RC++  ++KACVE
Sbjct  136  NLEMCVEVLKQCENLLPLADELKVVIRCIDAIASKACVE  174



>ref|XP_011089686.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X1 [Sesamum indicum]
Length=620

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+I++V   +FSLHKF LV++S  IRKL+ + +++D++RI L  +P
Sbjct  17   QRCSEWVF-RDVPSDIIIDVDGGTFSLHKFPLVSRSGRIRKLVAEHRDSDISRIELLSLP  75

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG + FE AA+FCYG+NFEIT  NVA L C ++YL+MT++Y  NNL  R E++L  V   
Sbjct  76   GGAKSFELAAQFCYGINFEITAANVAQLCCVSDYLEMTEEYSKNNLGSRAEEYLESVVCK  135

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VL+ CE LLPLA++L IV RC++  ++KACVE
Sbjct  136  NLEMCVEVLQQCENLLPLADELNIVPRCIDAIASKACVE  174



>ref|XP_004240632.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Solanum 
lycopersicum]
Length=599

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 121/172 (70%), Gaps = 6/172 (3%)
 Frame = +2

Query  50   PLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK  229
            PL  +A+R     +R  +WVF +++P+D+ +EV  A FSLHKF LV++S  IR+L+ + +
Sbjct  12   PLTKSASR-----QRYNEWVF-RDVPSDITIEVDGAIFSLHKFPLVSRSGRIRRLVAEHR  65

Query  230  EADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLA  409
            ++D++RI L  +PGG E FE AAKFCYGVNFEIT  NVA L C ++YL+M++ +  NNL 
Sbjct  66   DSDISRIELVSLPGGSESFELAAKFCYGVNFEITSSNVAQLCCVSDYLEMSEDHSKNNLG  125

Query  410  GRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
             R E++L  +   +L   + VL+  E LLPLA++LKI+ RC++  ++KACVE
Sbjct  126  SRAEEYLDSIVCKNLEMCVEVLRQSENLLPLADELKIITRCIDAVASKACVE  177



>ref|XP_008235484.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Prunus 
mume]
Length=614

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 122/169 (72%), Gaps = 5/169 (3%)
 Frame = +2

Query  71   RLSLA----MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD  238
            +LSLA     +R  +W+F +++P+D+ ++V   +FSLHKF LV++S  IRKL+ + +++D
Sbjct  10   QLSLAKSSRQQRNNEWIF-RDVPSDITIQVNGGAFSLHKFPLVSRSGRIRKLVAEHRDSD  68

Query  239  LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT  418
            ++R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L CA++YL+MT+++  +NL  R 
Sbjct  69   ISRVELLHLPGGAESFELAAKFCYGINFEITSGNVAQLCCASDYLEMTEEFSKDNLGSRA  128

Query  419  EDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            E++L  +   +L   + VL  CE LLPLA++LKIV RC++  ++KACVE
Sbjct  129  EEYLECIVCKNLEMCVEVLLQCESLLPLADELKIVSRCIDAIASKACVE  177



>gb|EYU40606.1| hypothetical protein MIMGU_mgv1a003057mg [Erythranthe guttata]
Length=611

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            ++  +WVF +++P+D+I+EV  A+FSLHKF LV++S  +RKL+ + +E+D++RI L  +P
Sbjct  20   QKCSEWVF-RDVPSDIIIEVDGATFSLHKFPLVSRSGRMRKLVAEHRESDISRIELLSLP  78

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG   FE AA+FCYG+NFEI+  NVA L C ++YL+MT++Y +NNL+ R E++L+ +   
Sbjct  79   GGAASFELAAQFCYGINFEISTSNVAHLCCVSDYLEMTEEYSNNNLSSRAEEYLNTIVCK  138

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VL  C+ LLPL+++LKIV RC++  ++KACVE
Sbjct  139  NLEMCVQVLHHCQTLLPLSDNLKIVTRCIDGIASKACVE  177



>gb|AAU05485.1| At5g67385 [Arabidopsis thaliana]
 gb|AAU95431.1| At5g67385 [Arabidopsis thaliana]
Length=604

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 122/165 (74%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLMSKCGFIKKLVSESSKDSDSTVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   KIPDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SLS ++ VL   E+LLP+AE +K+V RC++  +   C E
Sbjct  129  NEVALKSLSSSITVLHKSEKLLPIAERVKLVSRCIDAIAYMTCQE  173



>ref|XP_009780159.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nicotiana 
sylvestris]
Length=621

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 116/162 (72%), Gaps = 0/162 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  M+RT +W+ SQEIP+D+ V V   SF+LHKF LV+K  YIRKL+  S +A+L+   
Sbjct  26   LSNVMKRTSEWILSQEIPSDITVHVAGTSFALHKFPLVSKCGYIRKLVAKSNDANLSVFE  85

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFls  433
            +  IPGG E FE AAKFCYG+NFEI+  NVA LRC AEYL MTD Y   NL G +E +L+
Sbjct  86   IPDIPGGAEAFEFAAKFCYGINFEISSGNVALLRCVAEYLDMTDDYAVGNLVGLSEAYLN  145

Query  434  qvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            ++AL S++GA+ VL S E+LLP+AE++K+V R ++  +   C
Sbjct  146  ELALKSIAGAVSVLHSSEKLLPIAENIKLVNRSIDTIAYMVC  187



>ref|NP_680473.2| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
 sp|Q66GP0.2|Y5738_ARATH RecName: Full=BTB/POZ domain-containing protein At5g67385 [Arabidopsis 
thaliana]
 gb|AED98336.1| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
Length=604

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 122/165 (74%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLMSKCGFIKKLVSESSKDSDSTVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   KIPDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SLS ++ VL   E+LLP+AE +K+V RC++  +   C E
Sbjct  129  NEVALKSLSSSITVLHKSEKLLPIAERVKLVSRCIDAIAYMTCQE  173



>gb|KFK28391.1| hypothetical protein AALP_AA8G509000 [Arabis alpina]
Length=604

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 120/165 (73%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
             S AM+RT +W+ SQE+ +DV V +GEASFSLHKF L++K  +I+KL+ +SK +AD T +
Sbjct  9    FSSAMKRTSEWISSQEVSSDVTVHIGEASFSLHKFPLLSKCGFIKKLVSESKTDADSTIV  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             +  IPGG E FE AAKFCYG+NF++   N+A LRCAAEYL+MT+++   NL  RTE +L
Sbjct  69   KIPDIPGGSEAFELAAKFCYGINFDMGTENIAMLRCAAEYLEMTEEHSVENLVVRTEAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SLS ++ VL   EELLP AE +K+V RC++  +   C E
Sbjct  129  NEVALKSLSSSITVLHKSEELLPTAERVKLVSRCIDAIAYMTCQE  173



>ref|XP_006393938.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
 gb|ESQ31224.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
Length=603

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 120/165 (73%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
             S AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +SK ++D T I
Sbjct  9    FSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLVSESKSDSDATVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             L  IPGG E FE  AKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   KLPDIPGGSEAFELTAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SLS ++ VL   EELLP+AE +K+V RC++  +   C E
Sbjct  129  NEVALKSLSSSITVLHKSEELLPVAERVKLVSRCIDAIAYMTCQE  173



>dbj|BAJ34215.1| unnamed protein product [Thellungiella halophila]
Length=603

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 120/165 (73%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
             S AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +SK ++D T I
Sbjct  9    FSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLVSESKSDSDATVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             L  IPGG E FE  AKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   KLPDIPGGSEAFELTAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SLS ++ VL   EELLP+AE +K+V RC++  +   C E
Sbjct  129  NEVALKSLSSSITVLHKSEELLPVAERVKLVSRCIDAIAYMTCQE  173



>ref|XP_006280202.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
 gb|EOA13100.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
Length=605

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 122/165 (74%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            L+ AM+RT +W+ SQE+ +D+ V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct  9    LTSAMKRTSEWISSQEVSSDITVHVGEASFSLHKFPLLSKCGFIKKLMSESTKDSDSTVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E ++
Sbjct  69   KIPDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYV  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SLS ++ VL   EELLP+AE +K+V RC++  +   C E
Sbjct  129  NEVALKSLSSSITVLHKSEELLPIAERVKLVSRCIDAIAYLTCQE  173



>gb|KDP26391.1| hypothetical protein JCGZ_17549 [Jatropha curcas]
Length=619

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 120/167 (72%), Gaps = 4/167 (2%)
 Frame = +2

Query  74   LSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  244
            LSLA    +R  +W+F +++P+D+ +EV   +F+LHKF LV++S  IRKL+ + ++AD++
Sbjct  12   LSLAKSSRQRCNEWIF-RDVPSDITIEVSGGTFALHKFPLVSRSGRIRKLVAEHRDADIS  70

Query  245  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  424
            R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL  R E+
Sbjct  71   RVELLNLPGGAESFELAAKFCYGINFEITSANVAQLCCVSDYLEMTEEFSKDNLGSRAEE  130

Query  425  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E
Sbjct  131  YLESIVCKNLEMCVEVLQQCENLLPLADELKIVSRCIDAIASKACAE  177



>gb|KHN13450.1| BTB/POZ domain-containing protein [Glycine soja]
Length=624

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 119/167 (71%), Gaps = 4/167 (2%)
 Frame = +2

Query  74   LSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  244
            LSLA    +R  +W+F +++P+DV +EV   +FSLHKF LV++S  IR+L+ + +++D++
Sbjct  15   LSLAKGTRQRNNEWIF-RDVPSDVTIEVNGGTFSLHKFPLVSRSGRIRRLVAEHRDSDIS  73

Query  245  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  424
            R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+ +  +NL  R E+
Sbjct  74   RVELLNLPGGAECFELAAKFCYGINFEITSTNVAQLCCVSDYLEMTEDFSKDNLGSRAEE  133

Query  425  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L  +   +L   + VL+ CE LLPLA++LK+V RC++  ++KAC E
Sbjct  134  YLDSIVCKNLEMCVEVLQQCESLLPLADELKVVSRCIDAIASKACAE  180



>ref|XP_007155848.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 ref|XP_007155849.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27842.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27843.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
Length=591

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  265
            M+RT  W FS EIP+DV V+VGE SFSLHKF LV+K  YI KL+ +S   D++ I L  +
Sbjct  1    MKRTSGWAFSHEIPSDVTVQVGEVSFSLHKFPLVSKCGYIEKLVSESSGEDVSFIELYDV  60

Query  266  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqval  445
            PGG E FE A KFCYGVNFEI+V N+A LRC AEYL+MT+ Y   NL GR + +L+++AL
Sbjct  61   PGGAEAFELATKFCYGVNFEISVENIAMLRCVAEYLEMTEDYSVGNLVGRADSYLNEMAL  120

Query  446  sslsgalvvlksCEELLPLAEDLKIVQRCVE  538
             ++SGA+ +L      LP+AE  K+V RC++
Sbjct  121  KTISGAVSILHVSARFLPIAEKAKLVSRCID  151



>ref|XP_008787157.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Phoenix 
dactylifera]
Length=610

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  256
            S AM+RT +W+ SQEIP+D+ +  G ++F+LHK  LV+K  YIR+L+ ++  ++++ I +
Sbjct  23   STAMKRTSEWILSQEIPSDITIHAGGSAFALHKLPLVSKCGYIRRLVSEANGSNISVIEI  82

Query  257  SGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsq  436
              +PGG E F+ AAKFCYG+NFEIT  N+A LRC A YL+MT+ Y   NL  RTE +L +
Sbjct  83   PDVPGGAEAFKFAAKFCYGINFEITTENIAMLRCVAGYLEMTEDYAAGNLVNRTEGYLEE  142

Query  437  valsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
            VAL SLSGA+ VL   E+LLP+AE +K+V RC++  +  AC
Sbjct  143  VALMSLSGAVTVLHKSEDLLPMAEKVKLVSRCIDAVAYTAC  183



>ref|XP_006844655.1| hypothetical protein AMTR_s00016p00237490 [Amborella trichopoda]
 gb|ERN06330.1| hypothetical protein AMTR_s00016p00237490 [Amborella trichopoda]
Length=616

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 114/161 (71%), Gaps = 1/161 (1%)
 Frame = +2

Query  83   AMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSG  262
             M++T  W+ + ++P+D+ VEVG  +FSLHKF L ++S  IRKL+   K+  +T+INLS 
Sbjct  25   TMQKTSDWLLT-DVPSDLTVEVGSKNFSLHKFPLASQSGRIRKLLAQPKDVKITKINLSD  83

Query  263  IPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqva  442
            IPGGPE FE AAKFCYGV+ EIT  NVA LRCAA+YL+MT++Y   +L  RTE  L+++ 
Sbjct  84   IPGGPEAFEHAAKFCYGVSLEITASNVAMLRCAADYLEMTEEYGQGSLESRTERHLNEIV  143

Query  443  lsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            + S+  ++ VL  CE L+P AE+ KI+ RC+   ++ AC E
Sbjct  144  IPSIPLSVTVLHRCETLIPSAEETKIICRCINAIASNACKE  184



>ref|XP_010484507.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
 ref|XP_010484508.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
Length=603

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 120/165 (73%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+  S K++D + I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLMSGSNKDSDSSVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MTD++   NL  R E +L
Sbjct  69   KILDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTDEHSVENLVVRAEAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SLS ++ VL   EELLP AE +K+V RC++  +   C E
Sbjct  129  NEVALKSLSSSITVLHKSEELLPTAERVKLVSRCIDAIAYMTCQE  173



>ref|XP_010109730.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXC24200.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=626

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 119/167 (71%), Gaps = 4/167 (2%)
 Frame = +2

Query  74   LSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  244
            LSLA     R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IR+L+ + +++D++
Sbjct  16   LSLAKSSRHRCSEWIF-RDVPSDITLEVSGGTFSLHKFPLVSRSGRIRRLVAEYRDSDVS  74

Query  245  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  424
            R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NL  R E+
Sbjct  75   RVELLNLPGGAETFELAAKFCYGINFEITSTNVAQLCCVSDYLEMTEEYSKDNLGSRAEE  134

Query  425  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E
Sbjct  135  YIESIVCKNLEMCVEVLQQCENLLPLADELKIVSRCIDAIASKACAE  181



>gb|KJB26098.1| hypothetical protein B456_004G225600 [Gossypium raimondii]
Length=612

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +W+F +++P+D+ +EV   SF+LHKF LV++S  I+KL+ + +++D+ R+ L  +P
Sbjct  16   QRCNEWIF-RDVPSDITIEVNGVSFALHKFPLVSRSGRIQKLVAEHRDSDMLRVELVNVP  74

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL  RTE++L  V   
Sbjct  75   GGAESFELAAKFCYGINFEITSFNVAQLYCVSDYLEMTEEFSKDNLGSRTEEYLEIVVCK  134

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VL+ CE LLPLA++LKI+ RC++  ++KAC E
Sbjct  135  NLEMCVEVLQQCESLLPLADELKIISRCIDAIASKACAE  173



>ref|XP_011024680.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Populus 
euphratica]
Length=610

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = +2

Query  56   KSAATRLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS  226
            K    +LSLA    ++  +W+F +++P+D+ +EV   +F+LHKF LV++S  IRKL+ + 
Sbjct  3    KHQQQQLSLAKCSRQKYSEWIF-RDVPSDITIEVSGGTFALHKFPLVSRSGRIRKLVAEH  61

Query  227  KEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL  406
            ++AD++R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C +EYL+MT+ +  +NL
Sbjct  62   RDADISRVELLNLPGGAEAFELAAKFCYGINFEITSSNVAQLCCVSEYLEMTEDFSKDNL  121

Query  407  AGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
              R E++L  +   +L   + VL+ CE L+PLA++L+IV RC++  ++KAC E
Sbjct  122  GSRAEEYLESIVCKNLEMCVEVLQQCENLIPLADELRIVSRCIDAIASKACAE  174



>ref|XP_010524688.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Tarenaya 
hassleriana]
Length=633

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 114/156 (73%), Gaps = 1/156 (1%)
 Frame = +2

Query  98   GQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGP  277
             +W+F +++P+D+ ++V   +F+LHKF LV++S  IRK+I + ++AD++++ L  +PGG 
Sbjct  38   SEWIF-RDVPSDITIDVNSGTFALHKFPLVSRSGRIRKIIAEHRDADISKVELLNLPGGA  96

Query  278  EIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalssls  457
            E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+ Y  +NLA R E++L  +   +L 
Sbjct  97   ETFEMAAKFCYGINFEITSSNVAQLCCVSDYLEMTEDYSKDNLASRAEEYLESIVCKNLE  156

Query  458  galvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
              + VL+ CE LLPLA++LKIV RC++  ++KAC E
Sbjct  157  MCVQVLQQCESLLPLADELKIVSRCIDSIASKACAE  192



>ref|XP_002301784.2| hypothetical protein POPTR_0002s24380g [Populus trichocarpa]
 gb|EEE81057.2| hypothetical protein POPTR_0002s24380g [Populus trichocarpa]
Length=610

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = +2

Query  56   KSAATRLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS  226
            K    +LSLA    ++  +W+F +++P+D+ +EV   +F+LHKF LV++S  IRKL+ + 
Sbjct  3    KHQQQQLSLAKCSRQKYSEWIF-RDVPSDITIEVSGGTFALHKFPLVSRSGRIRKLVAEH  61

Query  227  KEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL  406
            ++AD++R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C +EYL+MT+ +  +NL
Sbjct  62   RDADISRVELLNLPGGAEAFELAAKFCYGINFEITSSNVAQLCCVSEYLEMTEDFSKDNL  121

Query  407  AGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
              R E++L  +   +L   + VL+ CE L+PLA++L+IV RC++  ++KAC E
Sbjct  122  GSRAEEYLESIVCKNLEMCVEVLQQCENLIPLADELRIVSRCIDAIASKACAE  174



>ref|XP_007049780.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOX93937.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=619

 Score =   158 bits (400),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 120/167 (72%), Gaps = 4/167 (2%)
 Frame = +2

Query  74   LSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  244
            LSLA    +R  +W+F +++P+D+ +EV   +F+LHKF LV++S  IRKL+ + +++D++
Sbjct  17   LSLAKSSRQRYNEWIF-RDVPSDITIEVNGGTFALHKFPLVSRSGRIRKLVAEHRDSDIS  75

Query  245  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  424
            R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL  R E+
Sbjct  76   RVELLNLPGGAESFELAAKFCYGINFEITSLNVAQLCCVSDYLEMTEEFSKDNLGSRAEE  135

Query  425  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E
Sbjct  136  YLESIVCKNLEMCVEVLQQCENLLPLADELKIVSRCIDAIASKACAE  182



>ref|XP_003551322.2| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Glycine 
max]
Length=616

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 118/167 (71%), Gaps = 4/167 (2%)
 Frame = +2

Query  74   LSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  244
            LSLA    +R  +W+F +++P+DV +EV   +FSLHKF LV++S  IR+L+ + +++D++
Sbjct  15   LSLAKGTRQRNNEWIF-RDVPSDVTIEVNRGTFSLHKFPLVSRSGRIRRLVAEHRDSDIS  73

Query  245  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  424
            R+ L  +PGG E FE AAKFCYG+NFEI   NVA L C ++YL+MT+ +  +NL  R E+
Sbjct  74   RVELLNLPGGAECFELAAKFCYGINFEIRSTNVAQLCCVSDYLEMTEDFSKDNLGSRAEE  133

Query  425  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L  +   +L   + VL+ CE LLPLA++LK+V RC++  ++KAC E
Sbjct  134  YLDSIVCKNLEMCVEVLQQCESLLPLADELKVVSRCIDAIASKACAE  180



>ref|XP_010464139.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Camelina 
sativa]
Length=603

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D + I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLMSESNKDSDSSVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   KILDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SLS ++ VL   EELLP AE +K+V RC++  +   C E
Sbjct  129  NEVALKSLSSSITVLHKSEELLPTAERVKLVSRCIDAIAYMTCQE  173



>ref|XP_006443605.1| hypothetical protein CICLE_v10019330mg [Citrus clementina]
 ref|XP_006479282.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Citrus 
sinensis]
 gb|ESR56845.1| hypothetical protein CICLE_v10019330mg [Citrus clementina]
 gb|KDO65925.1| hypothetical protein CISIN_1g007123mg [Citrus sinensis]
Length=617

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = +2

Query  71   RLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            +LSLA    +R  +W+F +++P+D+ ++V   +F+LHKF LV++S  IRKL+ + +++D+
Sbjct  13   QLSLAKSSRQRCNEWIF-RDVPSDITIDVNGGTFALHKFPLVSRSGRIRKLVAEHRDSDI  71

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +RI L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+ +  +NL  R E
Sbjct  72   SRIELLNLPGGAETFELAAKFCYGINFEITSANVAQLCCVSDYLEMTEDFSKDNLGSRAE  131

Query  422  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +++  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E
Sbjct  132  EYIDCIVCKNLEMCVEVLQQCESLLPLADELKIVSRCIDAVASKACAE  179



>gb|KHG21232.1| hypothetical protein F383_08117 [Gossypium arboreum]
 gb|KHG21831.1| hypothetical protein F383_08674 [Gossypium arboreum]
Length=616

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +W+F +++P+D+ +EV   +F+LHKF LV++S  I+KL+ + +++D+ R+ L  +P
Sbjct  20   QRCNEWIF-RDVPSDITIEVNGVAFALHKFPLVSRSGRIQKLVAEHRDSDMLRVELVNVP  78

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL  RTE++L  V   
Sbjct  79   GGAESFELAAKFCYGINFEITSFNVAQLYCVSDYLEMTEEFSKDNLGSRTEEYLEIVVCK  138

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VL+ CE LLPLA++LKI+ RC++  ++KAC E
Sbjct  139  NLEMCVEVLQQCESLLPLADELKIISRCIDAIASKACAE  177



>ref|XP_010277091.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Nelumbo nucifera]
Length=594

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  286
            +FSQEIP+D+ V  G ASFSLHKF LV+K  YIRKL+ +  +AD++ + L  +PGG E F
Sbjct  9    IFSQEIPSDITVHAGGASFSLHKFPLVSKCGYIRKLVSEDSDADVSVVELPDVPGGEEAF  68

Query  287  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgal  466
            E AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTED+L++VAL SL+GA+
Sbjct  69   ELAAKFCYGINFEISTENIATLRCVAEYLEMTEDYAVGNLVGRTEDYLNEVALKSLAGAI  128

Query  467  vvlksCEELLPLAEDLKIVQRCVE  538
             VL + E LLP AE +K+V R ++
Sbjct  129  SVLHTSENLLPTAEKVKLVSRSID  152



>emb|CDY43566.1| BnaC02g16630D [Brassica napus]
Length=295

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 117/165 (71%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             +  IPG  E FE   KFCYG+NF+++  N+A LRCA+EYL+MT+++   NL  R+E +L
Sbjct  69   KIPDIPGSSEAFELTTKFCYGINFDMSTENIAMLRCASEYLEMTEEHSVENLVSRSEAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SLS A+ VL   EELLP+AE +K+V RC++  +   C E
Sbjct  129  NEVALKSLSSAITVLHKSEELLPIAERVKLVSRCIDAIAYMTCQE  173



>ref|XP_011459733.1| PREDICTED: BTB/POZ domain-containing protein At5g48800, partial 
[Fragaria vesca subsp. vesca]
Length=611

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 117/163 (72%), Gaps = 1/163 (1%)
 Frame = +2

Query  77   SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  256
            S    R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IRKL+ + +++D++R+ L
Sbjct  12   SARQHRYNEWIF-RDVPSDITIEVNGGAFSLHKFPLVSRSGRIRKLVAEHRDSDISRVEL  70

Query  257  SGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsq  436
              +PGG E FE AAKFCYG+NFEIT  NVA L C +++L+MT+++  +NL  R E++L  
Sbjct  71   LNLPGGAETFELAAKFCYGINFEITSANVAQLCCISDFLEMTEEFSKDNLGSRAEEYLES  130

Query  437  valsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +   SL   + VL+ CE LLPLA++L++V RC++  ++KACVE
Sbjct  131  IVCKSLEMCVEVLQQCEALLPLADELRVVSRCIDAIASKACVE  173



>ref|XP_003520918.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Glycine 
max]
 gb|KHN29840.1| BTB/POZ domain-containing protein [Glycine soja]
Length=612

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 119/168 (71%), Gaps = 4/168 (2%)
 Frame = +2

Query  71   RLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            +LSLA    +R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IR+L+ + +++D+
Sbjct  10   QLSLAKGTRQRYNEWIF-RDVPSDITIEVNGGTFSLHKFPLVSRSGRIRRLVAEHRDSDI  68

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+ +  +NL  R E
Sbjct  69   SRVELLNLPGGAECFELAAKFCYGINFEITSTNVAQLCCVSDYLEMTEDFSKDNLGSRAE  128

Query  422  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++L  +   +L   + VL+ CE LLPLA+ LK+V RC++  ++KAC E
Sbjct  129  EYLDSIVCKNLEMCVEVLQQCESLLPLADALKVVSRCIDAIASKACAE  176



>ref|XP_007050812.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX94969.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
Length=631

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S ++    +W  S ++ +D+ +EVG +SF+LHKF LV++S  IRKL++D+K+A ++R+
Sbjct  20   RPSSSIRHATEWPIS-DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLIDAKDAKISRV  78

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
            N+S +PGGPE FE AAKFCYG+N EIT+ NVA LRCA+ +L+MT+++ + NL  RTE +L
Sbjct  79   NISSVPGGPEAFELAAKFCYGINVEITLSNVAMLRCASHFLEMTEEFAEKNLEARTEAYL  138

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
              + L ++S ++ VL  CE LLP++E++ +V R +   +  AC E
Sbjct  139  KDMVLPNISSSISVLHRCESLLPISEEINLVNRLINAIANNACKE  183



>gb|EYU39234.1| hypothetical protein MIMGU_mgv1a003527mg [Erythranthe guttata]
Length=580

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+ +EV   +F LHKF LV++S  IRKL+ D +++D++RI L  + 
Sbjct  8    QRCSEWVF-RDVPSDITIEVDGTTFLLHKFPLVSRSGRIRKLVADHRDSDISRIELVSLQ  66

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG + FE AA+FCYGVNFEIT  NVA L C ++YL+MT+ Y  NNL  R E++L  +   
Sbjct  67   GGADSFELAAQFCYGVNFEITPTNVAHLYCISDYLEMTEDYSKNNLFTRAEEYLEIIVSK  126

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            SL   + VL+ CE+LLPLA++LKIVQ C++  ++KACVE
Sbjct  127  SLEMCVKVLQQCEKLLPLADELKIVQICIDSIASKACVE  165



>gb|KHG00255.1| hypothetical protein F383_19997 [Gossypium arboreum]
Length=611

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = +2

Query  56   KSAATRLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS  226
            K    +LSLA    +R  +W+F +++ +D+ +EV   +F+LHKF LV++S  IRKL+ + 
Sbjct  3    KQQHHQLSLAKSSRQRCNEWIF-RDVKSDITIEVNGGTFALHKFPLVSRSGRIRKLVAEH  61

Query  227  KEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL  406
            +++D++R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL
Sbjct  62   RDSDISRVELLNLPGGAETFELAAKFCYGINFEITSSNVAQLCCVSDYLEMTEEFSKDNL  121

Query  407  AGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
              R E++L  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E
Sbjct  122  GSRAEEYLESIVCKNLEMCVEVLQQCENLLPLADELKIVSRCIDAIASKACAE  174



>gb|KJB42465.1| hypothetical protein B456_007G154300 [Gossypium raimondii]
Length=611

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = +2

Query  56   KSAATRLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS  226
            K    +LSLA    +R  +W+F +++ +D+ +EV   +F+LHKF LV++S  IRKL+ + 
Sbjct  3    KQQHHQLSLAKSSRQRCNEWIF-RDVKSDITIEVNGGTFALHKFPLVSRSGRIRKLVAEH  61

Query  227  KEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL  406
            +++D++R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL
Sbjct  62   RDSDISRVELLNLPGGAETFELAAKFCYGINFEITSSNVAQLCCVSDYLEMTEEFSKDNL  121

Query  407  AGRTEDFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
              R E++L  +   +L   + VL+ CE LLPLA++LKIV RC++  ++KAC E
Sbjct  122  GSRAEEYLESIVCKNLEMCVEVLQQCENLLPLADELKIVSRCIDAIASKACAE  174



>ref|XP_002961348.1| hypothetical protein SELMODRAFT_74933 [Selaginella moellendorffii]
 ref|XP_002983215.1| hypothetical protein SELMODRAFT_118052 [Selaginella moellendorffii]
 gb|EFJ15557.1| hypothetical protein SELMODRAFT_118052 [Selaginella moellendorffii]
 gb|EFJ38887.1| hypothetical protein SELMODRAFT_74933 [Selaginella moellendorffii]
Length=573

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = +2

Query  110  FSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  289
             + ++PTD+ VEV   SF+LHKF LV++S  IRKL++++++ D ++I L  IPGG E+FE
Sbjct  1    MTSDVPTDISVEVAGTSFALHKFPLVSRSGRIRKLVVETRDLDPSQIKLLEIPGGAEVFE  60

Query  290  RAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalv  469
              AKFCYG+NFEIT  NVA LRCAA YL+MTD Y + NL  RTE +L++V +   S +L 
Sbjct  61   LVAKFCYGINFEITTANVAVLRCAAHYLEMTDDYGEGNLVVRTETYLNEVVIQDFSVSLA  120

Query  470  vlksCEELLPLAEDLKIVQRCVELASAKA  556
            VL +CE L+PLAE+LKIV RCV+  +A A
Sbjct  121  VLHNCENLVPLAEELKIVSRCVDAVAAIA  149



>ref|XP_010036820.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Eucalyptus 
grandis]
 gb|KCW48472.1| hypothetical protein EUGRSUZ_K02165 [Eucalyptus grandis]
Length=623

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +W+F +++P+D+ ++VG  +F+LHKF LV++   IRKL+ + +++D++RI L  +P
Sbjct  24   QRYSEWIF-RDVPSDITLDVGGGTFALHKFPLVSRCGKIRKLVAEHRDSDISRIELLNLP  82

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG + FE AAKFCYG+NFEIT  NVA L C ++YL+M ++Y  +NL  R E++L  +   
Sbjct  83   GGADSFELAAKFCYGINFEITPLNVAQLCCVSDYLEMNEEYSKDNLGSRAEEYLETIICK  142

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L  ++ VL+ CE LLPLA++LKIV RCV+  ++KAC E
Sbjct  143  NLEMSVEVLQQCENLLPLADELKIVSRCVDAIASKACAE  181



>gb|EYU46717.1| hypothetical protein MIMGU_mgv1a003257mg [Erythranthe guttata]
Length=596

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA  298
            ++ +D+ +EVG ASF+LHKF LV++S  IRKL+M+SK++ ++R+NLSG+PGGP  FE+AA
Sbjct  7    DVSSDLTIEVGSASFALHKFPLVSRSGRIRKLLMESKDSKISRLNLSGVPGGPHTFEQAA  66

Query  299  KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlk  478
            KFCYGVN +I++ N+A LRCAA +L+M ++Y + NL  RTE +L    L S+  ++ VL 
Sbjct  67   KFCYGVNIDISLSNIATLRCAAHFLEMNEEYSEKNLESRTEAYLKDTILPSIPNSITVLH  126

Query  479  sCEELLPLAEDLKIVQRCVELASAKACVE  565
             C+ L+P++ED+ +V R +   +  AC E
Sbjct  127  HCQNLIPISEDINLVNRIINGIANNACKE  155



>ref|XP_009379310.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Pyrus x bretschneideri]
Length=625

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 1/156 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +IRKLI +S   ADL+ I
Sbjct  29   LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIRKLISESSYAADLSVI  88

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             L  +PGG E FE AAKFCYG+NFE++  N+A LRC AEYL MT+ Y   NL  R + +L
Sbjct  89   ELFDVPGGSEAFEFAAKFCYGINFELSTGNIAMLRCVAEYLLMTEDYAVGNLVERADAYL  148

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVE  538
            ++VAL SL+GA+ VL   E  LP+AE +K+V RC++
Sbjct  149  NEVALKSLAGAVTVLHMSENFLPMAEKVKLVSRCID  184



>ref|XP_010685004.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Beta 
vulgaris subsp. vulgaris]
Length=610

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R+ +W+F +++P+D+ +EV   +F+LHKF LV++S  +RKL+ D +++D+++I L  +P
Sbjct  17   QRSNEWIF-RDVPSDITLEVPGGTFALHKFPLVSRSGRLRKLVADYRDSDISKIELPNLP  75

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG E FE AAKFCYG NFEIT  NVA L C ++YL+MT+ Y  ++L  R E++L  V   
Sbjct  76   GGAESFELAAKFCYGNNFEITPANVAQLCCVSDYLEMTENYSKDSLGSRAEEYLDSVVCK  135

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VLK CE LLPLA++LKIV RC++  ++KACVE
Sbjct  136  NLEMCVEVLKQCENLLPLADELKIVGRCIDAIASKACVE  174



>ref|XP_008465052.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Cucumis 
melo]
Length=616

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
             R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IR+L+ + +++D++++ L  +P
Sbjct  21   HRCNEWIF-RDVPSDITIEVAGVTFSLHKFPLVSRSGRIRRLVAEHRDSDISKVELLNLP  79

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL  R E++L  +   
Sbjct  80   GGAESFELAAKFCYGINFEITPGNVAQLCCVSDYLEMTEEFAKDNLGSRAEEYLESIVSK  139

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VL+ CE LLPLA++LK+V RC++  ++KAC E
Sbjct  140  NLEMCVEVLQQCENLLPLADELKVVSRCIDAIASKACSE  178



>ref|XP_006600924.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN28330.1| BTB/POZ domain-containing protein [Glycine soja]
Length=583

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 108/151 (72%), Gaps = 3/151 (2%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  265
            M+R  +W +S EIP+DV ++VGE SFSLHKF LV+KS YI KL+ +S +A    I L  +
Sbjct  1    MKRASEWAYSHEIPSDVTIQVGEVSFSLHKFPLVSKSGYIGKLVSESSDA---FIELYDV  57

Query  266  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqval  445
            PGG E FE A KFCYG+NFEI++ N+A LRC AEYL MT+ Y   NL GR + +L++VAL
Sbjct  58   PGGAEAFELATKFCYGINFEISIENIAMLRCVAEYLDMTEDYSVGNLVGRADSYLNEVAL  117

Query  446  sslsgalvvlksCEELLPLAEDLKIVQRCVE  538
             ++SGA  +L   E LLP+AE  K+V RC++
Sbjct  118  KTISGAASILHVSERLLPIAEKAKLVSRCID  148



>ref|XP_006395119.1| hypothetical protein EUTSA_v10003813mg [Eutrema salsugineum]
 gb|ESQ32405.1| hypothetical protein EUTSA_v10003813mg [Eutrema salsugineum]
Length=640

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = +2

Query  71   RLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct  21   KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI  79

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +++ L  +PGG EIFE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct  80   SKVELLNLPGGAEIFELAAKFCYGINFEITSSNVAQLFCVSDYLEMTEEYSKDNLASRTE  139

Query  422  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++L  +   +L   + VLK  E LLPLA++L I+ RC++  ++KAC E
Sbjct  140  EYLESIVCKNLEMCVEVLKQSENLLPLADELNIISRCIDAIASKACAE  187



>ref|XP_004506596.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Cicer 
arietinum]
Length=616

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = +2

Query  71   RLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            +LSLA    +R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IR+L+ + +++D+
Sbjct  13   QLSLAKNGRQRYNEWIF-RDVPSDITIEVNGVTFSLHKFPLVSRSGRIRRLVAEHRDSDI  71

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+ +  +NL+ R E
Sbjct  72   SRVELLNLPGGAECFELAAKFCYGINFEITSTNVAQLCCVSDYLEMTEDFSKDNLSSRAE  131

Query  422  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++L  +   +L   + VL+ CE L+PLA++++IV RC++  ++KAC E
Sbjct  132  EYLDCIVCKNLEMCVEVLQQCESLIPLADEMRIVTRCIDAIASKACAE  179



>dbj|BAC41926.1| non-phototropic hypocotyl-like protein [Arabidopsis thaliana]
Length=321

 Score =   151 bits (382),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = +2

Query  71   RLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct  22   KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI  80

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +++ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct  81   SKVELLNLPGGAETFELAAKFCYGINFEITSSNVAQLFCVSDYLEMTEEYSKDNLASRTE  140

Query  422  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++L  +   +L   + VLK  E LLPLA++L I+ RC++  ++KAC E
Sbjct  141  EYLESIVCKNLEMCVQVLKQSEILLPLADELNIIGRCIDAIASKACAE  188



>ref|XP_007133999.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
 gb|ESW05993.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
Length=610

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IR+++ ++++ D++R+ L+ +P
Sbjct  17   QRYNEWIF-RDVPSDITIEVNGGAFSLHKFPLVSRSGRIRRIVAENRDDDISRVVLNNLP  75

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT+ +  +NL  R E++L  V   
Sbjct  76   GGAECFELAAKFCYGINFEITSTNVAQLCCVSDYLEMTEDFSKDNLGSRAEEYLESVVCK  135

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VL+ CE LLPLA++LK+V RC++  ++KAC E
Sbjct  136  NLEMCVEVLQQCESLLPLADELKVVIRCIDAIASKACAE  174



>emb|CBI37309.3| unnamed protein product [Vitis vinifera]
Length=605

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +W+F +++P+D+ +EV    F+LHKF LV++S  IRKL+ + ++++ +RI L  +P
Sbjct  26   QRCNEWIF-RDVPSDITIEVSGGMFALHKFPLVSRSGRIRKLVAERRDSENSRIELLSLP  84

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG E FE AAKFCYGVNFEIT  NVA L C ++YL+MT+++  +NL  R E++L  V   
Sbjct  85   GGAESFELAAKFCYGVNFEITSANVAQLCCVSDYLEMTEEFSKDNLGSRAEEYLESVVCK  144

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VL+ CE LLPLA++LKIV RC++  ++KACVE
Sbjct  145  NLEMCVEVLQQCENLLPLADELKIVGRCIDAIASKACVE  183



>ref|XP_009411062.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Musa 
acuminata subsp. malaccensis]
Length=583

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 112/158 (71%), Gaps = 0/158 (0%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  265
            M+RTG+W++S E+P+D+ V+VG + F LHK++LV+K  YIRKL  ++ + + + I +  +
Sbjct  1    MKRTGEWIYSPEVPSDIDVKVGGSIFPLHKYLLVSKCGYIRKLASEANQPNTSAIEIPDV  60

Query  266  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqval  445
            PGG E FE   K+CYGVNFEIT  N+A LRC AEYL+MT+ Y   NL  R E +L +VAL
Sbjct  61   PGGAEAFELVTKYCYGVNFEITAENIAMLRCVAEYLEMTEDYTVGNLVSRAEAYLEEVAL  120

Query  446  sslsgalvvlksCEELLPLAEDLKIVQRCVELASAKAC  559
             SLS A+ VL   EELLP++E +K+V RC++  +  AC
Sbjct  121  LSLSAAVTVLHKSEELLPVSEKVKMVSRCIDAVAYMAC  158



>ref|XP_002265786.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 isoform 
X1 [Vitis vinifera]
Length=616

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +W+F +++P+D+ +EV    F+LHKF LV++S  IRKL+ + ++++ +RI L  +P
Sbjct  26   QRCNEWIF-RDVPSDITIEVSGGMFALHKFPLVSRSGRIRKLVAERRDSENSRIELLSLP  84

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG E FE AAKFCYGVNFEIT  NVA L C ++YL+MT+++  +NL  R E++L  V   
Sbjct  85   GGAESFELAAKFCYGVNFEITSANVAQLCCVSDYLEMTEEFSKDNLGSRAEEYLESVVCK  144

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VL+ CE LLPLA++LKIV RC++  ++KACVE
Sbjct  145  NLEMCVEVLQQCENLLPLADELKIVGRCIDAIASKACVE  183



>ref|XP_003604967.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|AES87164.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=617

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 118/167 (71%), Gaps = 4/167 (2%)
 Frame = +2

Query  74   LSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  244
            LSLA    +R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IR+L+ + +++D++
Sbjct  16   LSLAKNVRQRYNEWIF-RDVPSDITIEVCGVTFSLHKFPLVSRSGRIRRLVAEHRDSDIS  74

Query  245  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  424
            R+    +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MTD +  +NL+ R E+
Sbjct  75   RVEFLNLPGGAECFELAAKFCYGINFEITSSNVAQLCCVSDYLEMTDDFSKDNLSSRAEE  134

Query  425  FlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L  +   +L   + VL+ CE L+PLA++LKIV RC++  ++K C E
Sbjct  135  YLDCIVCKNLEMCVGVLQQCESLIPLADELKIVTRCIDAIASKTCAE  181



>gb|KHG21965.1| hypothetical protein F383_08186 [Gossypium arboreum]
Length=632

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 115/165 (70%), Gaps = 1/165 (1%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S ++    +W  S ++ +D+ +EVG +SF+LHKF LV++S  IRKL++D+K+  ++RI
Sbjct  20   RPSSSIRHATEWPIS-DVSSDLKIEVGTSSFALHKFPLVSRSGRIRKLLIDTKDTKISRI  78

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
            NLS  PGGPE FE AAKFCYG+N EIT+ NVA LRC + YL+M +++ +NNL  RTE +L
Sbjct  79   NLSSAPGGPEAFELAAKFCYGINVEITLSNVAMLRCISHYLEMAEEFAENNLEARTEAYL  138

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
              + L ++S  + VL  CE LLP++E++ +V R +   +  AC E
Sbjct  139  KDMVLPNISSTIAVLHRCESLLPISEEINLVNRLINAIANNACKE  183



>emb|CDX85365.1| BnaC07g26760D [Brassica napus]
Length=620

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = +2

Query  71   RLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct  21   KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI  79

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +++ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct  80   SKVELLNLPGGAETFELAAKFCYGINFEITSSNVAQLLCVSDYLEMTEEYSKDNLASRTE  139

Query  422  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++L  +   SL   + VLK  E LLPLA++L IV RC++  ++KAC E
Sbjct  140  EYLDSIVCKSLEMCVQVLKQSENLLPLADELNIVTRCIDAIASKACAE  187



>ref|XP_009151678.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Brassica 
rapa]
Length=620

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = +2

Query  71   RLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct  21   KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI  79

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +++ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct  80   SKVELLNLPGGAETFELAAKFCYGINFEITSSNVAQLLCVSDYLEMTEEYSKDNLASRTE  139

Query  422  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++L  +   SL   + VLK  E LLPLA++L IV RC++  ++KAC E
Sbjct  140  EYLDSIVCKSLEMCVQVLKQSENLLPLADELSIVTRCIDAIASKACAE  187



>emb|CDX86278.1| BnaA06g29950D [Brassica napus]
Length=620

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = +2

Query  71   RLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct  21   KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI  79

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +++ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct  80   SKVELLNLPGGAETFELAAKFCYGINFEITSSNVAQLLCVSDYLEMTEEYSKDNLASRTE  139

Query  422  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++L  +   SL   + VLK  E LLPLA++L IV RC++  ++KAC E
Sbjct  140  EYLDSIVCKSLEMCVQVLKQSENLLPLADELSIVTRCIDAIASKACAE  187



>dbj|BAJ33928.1| unnamed protein product [Thellungiella halophila]
Length=617

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 120/168 (71%), Gaps = 4/168 (2%)
 Frame = +2

Query  71   RLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct  21   KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI  79

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +++ L  +PGG EIFE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct  80   SKVELLNLPGGAEIFELAAKFCYGINFEITSSNVAQLFCVSDYLEMTEEYSKDNLASRTE  139

Query  422  DFlsqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++L  +   +L   + VLK  E LLPLA+ L I+ RC++  ++KAC E
Sbjct  140  EYLESIVCKNLEMCVEVLKQSENLLPLADGLNIISRCIDAIASKACAE  187



>ref|XP_010264099.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 isoform 
X2 [Nelumbo nucifera]
Length=504

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 113/157 (72%), Gaps = 1/157 (1%)
 Frame = +2

Query  95   TGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGG  274
              +W+FS ++P+D+ +EV  A+F+LHKF LV++S  IRKL+ + ++ ++++I L  +PGG
Sbjct  80   NNEWIFS-DVPSDITIEVSGATFALHKFPLVSRSGRIRKLVAEHRDFNISQIELPSLPGG  138

Query  275  PEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalssl  454
             + F+ AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NL  R E +L  V   SL
Sbjct  139  ADSFDMAAKFCYGINFEITASNVAQLCCVSDYLEMTEEYSKDNLGSRAEAYLDSVVCKSL  198

Query  455  sgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
               + VL+ CE LLPLA++LKIV RC +  ++KACVE
Sbjct  199  EMCVEVLQKCENLLPLADELKIVSRCTDAIASKACVE  235



>emb|CDY68489.1| BnaCnng59210D [Brassica napus]
Length=449

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 117/165 (71%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT  W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSVWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             +  IPGG E FE   KFCYG+NF+++  N+A LRCA+EYL+MT+++   NL  R+E +L
Sbjct  69   KIPDIPGGSEAFELTTKFCYGINFDMSTENIAMLRCASEYLEMTEEHSVENLVSRSEAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SLS A+ VL   EELLP+AE +K+V RC++  +   C E
Sbjct  129  NEVALKSLSSAITVLHKSEELLPIAERVKLVSRCIDAIAYMTCQE  173



>emb|CDY37857.1| BnaAnng05180D [Brassica napus]
Length=600

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 118/165 (72%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             +  IPGG E FE   KFCYG+NF+++  N+A LRCA+EYL+MT+++   NL  R+E +L
Sbjct  69   KIPDIPGGSEAFELTTKFCYGINFDMSTENIAMLRCASEYLEMTEEHSVENLISRSEAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SLS A+ VL   EELLP+AE +K+V RC++  +   C E
Sbjct  129  NEVALKSLSSAITVLHKSEELLPIAERVKLVSRCIDAIAYMTCQE  173



>ref|XP_009103425.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Brassica 
rapa]
Length=601

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K   I+KL+ +SK ++D + I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLIKKLMSESKNDSDASVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             +  IPGG E FE  AKFCYG+NF+++  N+A LRCAAEYL MT+++   NL  R E +L
Sbjct  69   KIPDIPGGFEAFELTAKFCYGINFDMSTENIAMLRCAAEYLDMTEEHSVENLVVRAEAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SLS A+ VL   E+LLP+AE +K+V RC++  +   C E
Sbjct  129  NEVALKSLSSAITVLHKSEDLLPIAERVKLVSRCIDAIAYMTCQE  173



>ref|XP_009130549.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g67385-like [Brassica rapa]
Length=600

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 118/165 (72%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFl  430
             +  IPGG E FE   KFCYG+NF+++  N+A LRCA+EYL+MT+++   NL  R+E +L
Sbjct  69   KIPDIPGGSEAFELTTKFCYGINFDMSTENIAMLRCASEYLEMTEEHSVENLISRSEAYL  128

Query  431  sqvalsslsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            ++VAL SLS A+ VL   EELLP+AE +K+V RC++  +   C E
Sbjct  129  NEVALKSLSSAITVLHKSEELLPIAERVKLVSRCIDAIAYMTCQE  173



>ref|XP_010264098.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 isoform 
X1 [Nelumbo nucifera]
Length=681

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 113/157 (72%), Gaps = 1/157 (1%)
 Frame = +2

Query  95   TGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGG  274
              +W+FS ++P+D+ +EV  A+F+LHKF LV++S  IRKL+ + ++ ++++I L  +PGG
Sbjct  80   NNEWIFS-DVPSDITIEVSGATFALHKFPLVSRSGRIRKLVAEHRDFNISQIELPSLPGG  138

Query  275  PEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalssl  454
             + F+ AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NL  R E +L  V   SL
Sbjct  139  ADSFDMAAKFCYGINFEITASNVAQLCCVSDYLEMTEEYSKDNLGSRAEAYLDSVVCKSL  198

Query  455  sgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
               + VL+ CE LLPLA++LKIV RC +  ++KACVE
Sbjct  199  EMCVEVLQKCENLLPLADELKIVSRCTDAIASKACVE  235



>ref|XP_006579934.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN06007.1| BTB/POZ domain-containing protein [Glycine soja]
Length=590

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 109/151 (72%), Gaps = 1/151 (1%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  265
            M+R  +W +S EI +DV V+VGE SFSLHKF LV+KS YI KL+ +S + D++ I L  +
Sbjct  1    MKRASEWAYSHEILSDVTVQVGEVSFSLHKFPLVSKSGYIGKLVSESSD-DVSFIELYDV  59

Query  266  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqval  445
            PGG E FE A KFCYG+NFEI+V N+A LRC AEYL MT+ Y   NL GR + +L++VAL
Sbjct  60   PGGAEAFELATKFCYGINFEISVENIATLRCVAEYLDMTEDYSVGNLVGRADSYLNEVAL  119

Query  446  sslsgalvvlksCEELLPLAEDLKIVQRCVE  538
             ++SGA+ +L   E  LP+AE  K+V RC++
Sbjct  120  KTISGAVSILHMSERFLPIAEKAKLVSRCID  150



>ref|XP_007050813.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOX94970.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
Length=626

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA  298
            ++ +D+ +EVG +SF+LHKF LV++S  IRKL++D+K+A ++R+N+S +PGGPE FE AA
Sbjct  30   DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLIDAKDAKISRVNISSVPGGPEAFELAA  89

Query  299  KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvalsslsgalvvlk  478
            KFCYG+N EIT+ NVA LRCA+ +L+MT+++ + NL  RTE +L  + L ++S ++ VL 
Sbjct  90   KFCYGINVEITLSNVAMLRCASHFLEMTEEFAEKNLEARTEAYLKDMVLPNISSSISVLH  149

Query  479  sCEELLPLAEDLKIVQRCVELASAKACVE  565
             CE LLP++E++ +V R +   +  AC E
Sbjct  150  RCESLLPISEEINLVNRLINAIANNACKE  178



>gb|KGN58361.1| hypothetical protein Csa_3G627720 [Cucumis sativus]
Length=616

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 114/159 (72%), Gaps = 1/159 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
             R  +W+F +++P+D+ +EV   +FSLHKF LV++S  IR+L+ + +++D++++ L  +P
Sbjct  21   HRCNEWIF-RDVPSDITIEVAGVTFSLHKFPLVSRSGRIRRLVAEHRDSDISKVELLNLP  79

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFlsqvals  448
            GG E FE AAKFCYG+NFEIT  NVA L C ++YL+M +++  +NL  R E++L  +   
Sbjct  80   GGAESFELAAKFCYGINFEITPGNVAQLCCVSDYLEMAEEFSKDNLGSRAEEYLESIVSK  139

Query  449  slsgalvvlksCEELLPLAEDLKIVQRCVELASAKACVE  565
            +L   + VL+ CE LLPLA++LK+V RC++  ++KAC E
Sbjct  140  NLEMCVEVLQQCENLLPLADELKVVSRCIDAIASKACSE  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920