BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF019D09

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDX83957.1|  BnaC08g16880D                                          134   2e-54   
ref|XP_010532058.1|  PREDICTED: serine incorporator 3                   130   2e-54   Tarenaya hassleriana [spider flower]
gb|KDP41926.1|  hypothetical protein JCGZ_26944                         129   4e-54   Jatropha curcas
ref|XP_002297693.2|  TMS membrane family protein                        129   4e-54   
gb|ABK96018.1|  unknown                                                 129   4e-54   Populus trichocarpa [western balsam poplar]
ref|NP_173069.1|  Serinc-domain containing serine and sphingolipi...    129   5e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416842.1|  hypothetical protein EUTSA_v10007762mg             129   5e-54   Eutrema salsugineum [saltwater cress]
ref|XP_011034606.1|  PREDICTED: probable serine incorporator            129   5e-54   Populus euphratica
ref|XP_007024820.1|  Serinc-domain containing serine and sphingol...    130   6e-54   
ref|XP_009117776.1|  PREDICTED: serine incorporator 3 isoform X2        130   1e-53   Brassica rapa
gb|KJB68285.1|  hypothetical protein B456_010G236500                    128   1e-53   Gossypium raimondii
emb|CDX81752.1|  BnaC08g38490D                                          130   1e-53   
gb|KJB68286.1|  hypothetical protein B456_010G236500                    128   1e-53   Gossypium raimondii
ref|XP_009110458.1|  PREDICTED: serine incorporator 3-like              130   1e-53   Brassica rapa
emb|CDY70974.1|  BnaAnng35710D                                          130   1e-53   Brassica napus [oilseed rape]
ref|XP_010063622.1|  PREDICTED: probable serine incorporator isof...    130   2e-53   
ref|XP_002890152.1|  TMS membrane family protein                        127   2e-53   
ref|XP_010063623.1|  PREDICTED: probable serine incorporator isof...    130   2e-53   Eucalyptus grandis [rose gum]
gb|KJB68287.1|  hypothetical protein B456_010G236500                    126   5e-53   Gossypium raimondii
ref|XP_002512768.1|  Membrane protein PB1A10.07c, putative              125   5e-53   
gb|KHG09631.1|  Serine incorporator 3                                   126   5e-53   Gossypium arboreum [tree cotton]
gb|EYU21792.1|  hypothetical protein MIMGU_mgv1a007183mg                124   8e-53   Erythranthe guttata [common monkey flower]
gb|EYU21795.1|  hypothetical protein MIMGU_mgv1a007183mg                124   8e-53   Erythranthe guttata [common monkey flower]
ref|XP_002270610.1|  PREDICTED: probable serine incorporator            126   1e-52   Vitis vinifera
emb|CDO98258.1|  unnamed protein product                                125   1e-52   Coffea canephora [robusta coffee]
gb|KJB67012.1|  hypothetical protein B456_010G170100                    126   1e-52   Gossypium raimondii
ref|XP_006427689.1|  hypothetical protein CICLE_v10025720mg             131   2e-52   Citrus clementina [clementine]
ref|XP_006307669.1|  hypothetical protein CARUB_v10009295mg             123   2e-52   Capsella rubella
gb|KJB67006.1|  hypothetical protein B456_010G170100                    126   2e-52   Gossypium raimondii
ref|XP_006493450.1|  PREDICTED: probable serine incorporator-like       131   2e-52   Citrus sinensis [apfelsine]
ref|XP_011073234.1|  PREDICTED: probable serine incorporator            125   4e-52   Sesamum indicum [beniseed]
ref|XP_002304839.2|  hypothetical protein POPTR_0003s18530g             126   5e-52   
ref|XP_011020548.1|  PREDICTED: probable serine incorporator            125   8e-52   Populus euphratica
ref|XP_010459155.1|  PREDICTED: probable serine incorporator            121   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010476724.1|  PREDICTED: serine incorporator 3                   121   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010497691.1|  PREDICTED: probable serine incorporator            121   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010318692.1|  PREDICTED: probable serine incorporator            127   1e-51   Solanum lycopersicum
ref|XP_011082649.1|  PREDICTED: probable serine incorporator            121   1e-51   Sesamum indicum [beniseed]
ref|XP_009759114.1|  PREDICTED: probable serine incorporator isof...    127   1e-51   Nicotiana sylvestris
ref|XP_009759116.1|  PREDICTED: probable serine incorporator isof...    127   1e-51   Nicotiana sylvestris
ref|XP_004492298.1|  PREDICTED: probable serine incorporator-like       127   2e-51   Cicer arietinum [garbanzo]
ref|XP_006341429.1|  PREDICTED: probable serine incorporator-like...    127   2e-51   Solanum tuberosum [potatoes]
ref|XP_006341430.1|  PREDICTED: probable serine incorporator-like...    127   2e-51   Solanum tuberosum [potatoes]
ref|XP_010107188.1|  putative serine incorporator                       127   2e-51   Morus notabilis
ref|XP_010914044.1|  PREDICTED: probable serine incorporator            126   2e-51   Elaeis guineensis
ref|XP_009615679.1|  PREDICTED: probable serine incorporator isof...    127   3e-51   Nicotiana tomentosiformis
ref|XP_009615680.1|  PREDICTED: serine incorporator 3 isoform X2        127   3e-51   
ref|XP_009615681.1|  PREDICTED: probable serine incorporator isof...    127   3e-51   Nicotiana tomentosiformis
gb|KDO46126.1|  hypothetical protein CISIN_1g032312mg                   127   6e-51   Citrus sinensis [apfelsine]
ref|XP_008342757.1|  PREDICTED: probable serine incorporator            134   6e-51   
ref|XP_003532291.1|  PREDICTED: probable serine incorporator-like       128   6e-51   Glycine max [soybeans]
ref|XP_009354238.1|  PREDICTED: probable serine incorporator            134   6e-51   Pyrus x bretschneideri [bai li]
ref|XP_007140603.1|  hypothetical protein PHAVU_008G126100g             127   7e-51   Phaseolus vulgaris [French bean]
ref|XP_004158797.1|  PREDICTED: probable serine incorporator-like       129   9e-51   
gb|EPS57849.1|  hypothetical protein M569_16968                         122   1e-50   Genlisea aurea
ref|XP_010929190.1|  PREDICTED: probable serine incorporator isof...    121   1e-50   Elaeis guineensis
ref|XP_009365247.1|  PREDICTED: probable serine incorporator            134   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_008794380.1|  PREDICTED: probable serine incorporator            120   3e-50   Phoenix dactylifera
ref|XP_004135884.1|  PREDICTED: probable serine incorporator-like       127   4e-50   
ref|XP_008461193.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    127   5e-50   Cucumis melo [Oriental melon]
ref|XP_003552131.1|  PREDICTED: probable serine incorporator-like       125   6e-50   Glycine max [soybeans]
ref|XP_008381162.1|  PREDICTED: probable serine incorporator            134   5e-49   
ref|XP_009399576.1|  PREDICTED: probable serine incorporator            121   8e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383181.1|  PREDICTED: probable serine incorporator            116   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008228861.1|  PREDICTED: probable serine incorporator            126   5e-48   Prunus mume [ume]
ref|XP_007215457.1|  hypothetical protein PRUPE_ppa006404mg             126   5e-48   Prunus persica
emb|CDY52849.1|  BnaA09g56410D                                          111   1e-47   Brassica napus [oilseed rape]
gb|EAZ24909.1|  hypothetical protein OsJ_08689                          115   3e-46   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048364.1|  Os02g0792900                                       115   4e-46   
ref|XP_006845424.1|  hypothetical protein AMTR_s00019p00091080          109   8e-46   Amborella trichopoda
ref|NP_001130490.1|  hypothetical protein precursor                     114   1e-45   Zea mays [maize]
ref|XP_002454688.1|  hypothetical protein SORBIDRAFT_04g035670          114   1e-45   Sorghum bicolor [broomcorn]
ref|XP_004954190.1|  PREDICTED: probable serine incorporator-like       114   1e-45   Setaria italica
gb|KEH22798.1|  serinc-domain serine and sphingolipid biosynthesi...    127   3e-45   Medicago truncatula
gb|ACL54492.1|  unknown                                                 113   3e-45   Zea mays [maize]
emb|CAN80335.1|  hypothetical protein VITISV_009414                     126   3e-45   Vitis vinifera
ref|XP_003570284.1|  PREDICTED: probable serine incorporator            110   3e-45   Brachypodium distachyon [annual false brome]
ref|XP_006649122.1|  PREDICTED: probable serine incorporator-like       115   2e-42   
gb|EMT13726.1|  Putative serine incorporator                            113   4e-42   
gb|KEH22799.1|  serinc-domain serine and sphingolipid biosynthesi...    127   4e-42   Medicago truncatula
ref|XP_007215456.1|  hypothetical protein PRUPE_ppa006404mg             117   5e-41   
ref|XP_011466994.1|  PREDICTED: serine incorporator 3                   102   4e-40   Fragaria vesca subsp. vesca
ref|XP_010255869.1|  PREDICTED: probable serine incorporator            100   7e-40   Nelumbo nucifera [Indian lotus]
gb|ABR16232.1|  unknown                                                 106   1e-39   Picea sitchensis
gb|ABR17762.1|  unknown                                               99.8    2e-39   Picea sitchensis
ref|XP_008799134.1|  PREDICTED: probable serine incorporator          96.3    2e-37   Phoenix dactylifera
ref|XP_009391591.1|  PREDICTED: serine incorporator 3                 97.8    3e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB28193.1|  hypothetical protein B456_005G040500                  94.7    6e-35   Gossypium raimondii
ref|XP_006419802.1|  hypothetical protein CICLE_v10005070mg           97.1    8e-35   Citrus clementina [clementine]
gb|KDO74827.1|  hypothetical protein CISIN_1g039061mg                 97.1    9e-35   Citrus sinensis [apfelsine]
ref|XP_001765634.1|  predicted protein                                91.7    1e-34   
gb|KJB28194.1|  hypothetical protein B456_005G040500                  94.0    2e-34   Gossypium raimondii
ref|XP_009129653.1|  PREDICTED: probable serine incorporator          97.1    3e-34   Brassica rapa
emb|CDY24707.1|  BnaA05g31060D                                        97.1    3e-34   Brassica napus [oilseed rape]
ref|XP_008223013.1|  PREDICTED: probable serine incorporator          92.8    4e-34   Prunus mume [ume]
ref|XP_007034589.1|  Serinc-domain containing serine and sphingol...  91.7    5e-34   
emb|CDY05246.1|  BnaC05g45570D                                        93.6    5e-34   
emb|CDO98987.1|  unnamed protein product                              93.2    6e-34   Coffea canephora [robusta coffee]
ref|NP_187268.2|  Serinc-domain containing serine and sphingolipi...  94.0    8e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297798.1|  hypothetical protein CARUB_v10013833mg           93.6    1e-33   
ref|XP_002882452.1|  TMS membrane family protein                      94.4    1e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_002280143.1|  PREDICTED: serine incorporator 3                 93.6    1e-33   Vitis vinifera
ref|XP_010693925.1|  PREDICTED: serine incorporator 3                 93.6    1e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002979274.1|  hypothetical protein SELMODRAFT_110336           90.9    1e-33   
ref|XP_002988580.1|  hypothetical protein SELMODRAFT_128126           90.9    1e-33   
ref|XP_006407970.1|  hypothetical protein EUTSA_v10020853mg           92.4    2e-33   Eutrema salsugineum [saltwater cress]
gb|KDP40096.1|  hypothetical protein JCGZ_02094                       93.2    2e-33   Jatropha curcas
ref|XP_010103434.1|  putative serine incorporator                     93.2    3e-33   Morus notabilis
gb|AFK46909.1|  unknown                                                 132   3e-33   Lotus japonicus
ref|XP_008340909.1|  PREDICTED: probable serine incorporator          90.9    4e-33   Malus domestica [apple tree]
ref|XP_010464184.1|  PREDICTED: probable serine incorporator          92.4    4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010436570.1|  PREDICTED: probable serine incorporator          92.4    5e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010486107.1|  PREDICTED: probable serine incorporator          92.4    5e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010546829.1|  PREDICTED: serine incorporator 3 isoform X1      92.4    8e-33   Tarenaya hassleriana [spider flower]
ref|XP_010546830.1|  PREDICTED: serine incorporator 3 isoform X2      92.4    8e-33   Tarenaya hassleriana [spider flower]
ref|XP_010938752.1|  PREDICTED: probable serine incorporator          97.4    1e-32   Elaeis guineensis
ref|XP_010322266.1|  PREDICTED: serine incorporator 3                 93.6    3e-32   Solanum lycopersicum
ref|XP_006356686.1|  PREDICTED: serine incorporator 3-like            92.4    3e-32   Solanum tuberosum [potatoes]
ref|XP_007222705.1|  hypothetical protein PRUPE_ppa006444mg           88.6    4e-32   Prunus persica
ref|XP_004150322.1|  PREDICTED: serine incorporator 3-like            92.8    5e-32   Cucumis sativus [cucumbers]
ref|XP_010237604.1|  PREDICTED: probable serine incorporator          90.5    6e-32   Brachypodium distachyon [annual false brome]
ref|XP_004169518.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...  92.4    7e-32   
ref|XP_008458551.1|  PREDICTED: serine incorporator 3                 90.9    7e-32   Cucumis melo [Oriental melon]
ref|XP_011090806.1|  PREDICTED: probable serine incorporator          88.6    1e-31   Sesamum indicum [beniseed]
ref|XP_010687311.1|  PREDICTED: probable serine incorporator            128   1e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009623079.1|  PREDICTED: probable serine incorporator          92.4    1e-31   Nicotiana tomentosiformis
ref|XP_009799680.1|  PREDICTED: probable serine incorporator          92.0    2e-31   Nicotiana sylvestris
ref|XP_004982576.1|  PREDICTED: probable serine incorporator-like     90.5    4e-31   Setaria italica
ref|XP_010024424.1|  PREDICTED: serine incorporator 3                 83.2    1e-30   Eucalyptus grandis [rose gum]
gb|KCW60869.1|  hypothetical protein EUGRSUZ_H03603                   82.8    1e-30   Eucalyptus grandis [rose gum]
ref|XP_002516786.1|  Membrane protein PB1A10.07c, putative            84.0    3e-30   Ricinus communis
gb|EYU43840.1|  hypothetical protein MIMGU_mgv1a006662mg              87.8    7e-30   Erythranthe guttata [common monkey flower]
gb|EPS68630.1|  hypothetical protein M569_06136                       89.4    1e-29   Genlisea aurea
ref|XP_006650244.1|  PREDICTED: probable serine incorporator-like     91.7    2e-29   Oryza brachyantha
ref|XP_004486156.1|  PREDICTED: probable serine incorporator-like     85.5    2e-29   Cicer arietinum [garbanzo]
ref|XP_010929191.1|  PREDICTED: probable serine incorporator isof...    121   3e-29   Elaeis guineensis
gb|ACJ84561.1|  unknown                                               82.4    7e-29   Medicago truncatula
ref|XP_002312742.1|  TMS membrane family protein                      76.6    2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_009365799.1|  PREDICTED: probable serine incorporator isof...  76.6    2e-28   Pyrus x bretschneideri [bai li]
ref|XP_008790112.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    119   2e-28   Phoenix dactylifera
ref|XP_009342179.1|  PREDICTED: probable serine incorporator          76.6    2e-28   Pyrus x bretschneideri [bai li]
ref|XP_009365800.1|  PREDICTED: probable serine incorporator isof...  76.6    2e-28   Pyrus x bretschneideri [bai li]
ref|XP_008390818.1|  PREDICTED: probable serine incorporator          76.3    3e-28   
ref|XP_011010290.1|  PREDICTED: probable serine incorporator          75.5    5e-28   Populus euphratica
ref|XP_004296950.1|  PREDICTED: probable serine incorporator          75.5    2e-27   Fragaria vesca subsp. vesca
ref|XP_010268463.1|  PREDICTED: serine incorporator 3-like              116   2e-27   Nelumbo nucifera [Indian lotus]
ref|NP_001050476.1|  Os03g0454100                                     80.1    4e-27   
gb|ABF97020.1|  TMS membrane family protein, putative, expressed      80.1    4e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006595390.1|  PREDICTED: probable serine incorporator-like     75.9    1e-26   
dbj|BAJ86142.1|  predicted protein                                    74.7    1e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN37564.1|  Putative serine incorporator                          75.9    2e-26   Glycine soja [wild soybean]
ref|XP_007147778.1|  hypothetical protein PHAVU_006G154400g           73.2    1e-25   Phaseolus vulgaris [French bean]
gb|AFK34472.1|  unknown                                               69.3    2e-23   Lotus japonicus
ref|XP_010246591.1|  PREDICTED: serine incorporator 3-like              102   2e-22   
gb|KCW70853.1|  hypothetical protein EUGRSUZ_F03990                   92.0    5e-19   Eucalyptus grandis [rose gum]
ref|XP_006366267.1|  PREDICTED: cell wall integrity and stress re...  88.2    8e-19   Solanum tuberosum [potatoes]
tpg|DAA49274.1|  TPA: hypothetical protein ZEAMMB73_017777            90.9    2e-18   
ref|NP_001130812.1|  uncharacterized protein LOC100191916             90.9    3e-18   Zea mays [maize]
ref|XP_006850791.1|  hypothetical protein AMTR_s00025p00104130        90.1    3e-18   
ref|XP_002466928.1|  hypothetical protein SORBIDRAFT_01g016840        90.5    4e-18   Sorghum bicolor [broomcorn]
ref|XP_008673654.1|  PREDICTED: uncharacterized protein LOC100191...  87.0    3e-17   Zea mays [maize]
ref|XP_011397622.1|  putative serine incorporator                     62.8    6e-16   Auxenochlorella protothecoides
ref|XP_004302121.1|  PREDICTED: serine incorporator 3-like            81.6    2e-15   Fragaria vesca subsp. vesca
ref|XP_002506090.1|  predicted protein                                70.1    2e-15   Micromonas commoda
gb|KIZ05916.1|  putative serine incorporator                          58.9    3e-15   Monoraphidium neglectum
ref|XP_001696805.1|  hypothetical protein CHLREDRAFT_192111           60.1    4e-15   Chlamydomonas reinhardtii
gb|EMS53525.1|  putative serine incorporator                          76.6    1e-13   Triticum urartu
ref|XP_003062471.1|  predicted protein                                64.3    3e-13   Micromonas pusilla CCMP1545
ref|XP_005850950.1|  hypothetical protein CHLNCDRAFT_48549            56.2    4e-11   Chlorella variabilis
ref|XP_002956760.1|  hypothetical protein VOLCADRAFT_83749            47.8    6e-11   Volvox carteri f. nagariensis
gb|AAF30310.1|AC018907_10  hypothetical protein                       68.2    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407969.1|  hypothetical protein EUTSA_v10020853mg           67.0    4e-10   
ref|XP_005651318.1|  TMS membrane protein/tumor differentially hy...  66.2    1e-09   Coccomyxa subellipsoidea C-169
emb|CAN71158.1|  hypothetical protein VITISV_036762                   65.1    2e-09   Vitis vinifera
ref|XP_002515588.1|  conserved hypothetical protein                   60.5    9e-08   Ricinus communis
gb|KDP32305.1|  hypothetical protein JCGZ_13230                       60.1    1e-07   Jatropha curcas
ref|XP_001753882.1|  predicted protein                                59.3    2e-07   
ref|XP_010249828.1|  PREDICTED: probable serine incorporator          59.3    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_002965853.1|  hypothetical protein SELMODRAFT_83891            58.9    3e-07   
gb|KHN33071.1|  hypothetical protein glysoja_010062                   54.7    8e-07   Glycine soja [wild soybean]
ref|XP_010435285.1|  PREDICTED: probable serine incorporator          57.0    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_003620496.1|  Serine incorporator                              56.6    2e-06   Medicago truncatula
ref|XP_002863245.1|  hypothetical protein ARALYDRAFT_497050           56.2    2e-06   
ref|XP_010527190.1|  PREDICTED: probable serine incorporator          56.2    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_010488550.1|  PREDICTED: probable serine incorporator          55.8    3e-06   Camelina sativa [gold-of-pleasure]
gb|AET05293.2|  serinc-domain serine and sphingolipid biosynthesi...  55.5    4e-06   Medicago truncatula
ref|XP_003630817.1|  Serine incorporator                              55.5    4e-06   
ref|XP_006414928.1|  hypothetical protein EUTSA_v10025402mg           55.5    4e-06   Eutrema salsugineum [saltwater cress]
emb|CDY39551.1|  BnaC07g07190D                                        55.5    5e-06   Brassica napus [oilseed rape]
gb|EGC49614.1|  DNA mismatch repair protein                           54.3    6e-06   Histoplasma capsulatum H88
gb|EER41787.1|  DNA mismatch repair protein                           54.3    6e-06   Histoplasma capsulatum H143
gb|EEH05886.1|  DNA mismatch repair protein pms1                      54.3    6e-06   Histoplasma capsulatum G186AR
ref|XP_010450223.1|  PREDICTED: probable serine incorporator          55.1    6e-06   Camelina sativa [gold-of-pleasure]
ref|NP_189089.3|  Serinc-domain containing serine and sphingolipi...  55.1    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885648.1|  TMS membrane family protein                      54.7    7e-06   
ref|XP_002982341.1|  hypothetical protein SELMODRAFT_179397           54.7    8e-06   Selaginella moellendorffii
ref|XP_010656351.1|  PREDICTED: serine incorporator 3 isoform X3      54.3    8e-06   
ref|XP_007152808.1|  hypothetical protein PHAVU_004G161400g           54.7    8e-06   Phaseolus vulgaris [French bean]
ref|XP_011043440.1|  PREDICTED: probable serine incorporator          54.7    8e-06   Populus euphratica
ref|XP_010656344.1|  PREDICTED: probable serine incorporator isof...  54.3    9e-06   
ref|XP_010656350.1|  PREDICTED: probable serine incorporator isof...  54.3    1e-05   
ref|XP_868873.1|  hypothetical protein AN9491.2                       52.8    1e-05   Aspergillus nidulans FGSC A4
ref|XP_010440600.1|  PREDICTED: probable serine incorporator          54.3    1e-05   Camelina sativa [gold-of-pleasure]
emb|CAN70494.1|  hypothetical protein VITISV_041932                   54.3    1e-05   Vitis vinifera
ref|XP_002966499.1|  hypothetical protein SELMODRAFT_85365            54.3    1e-05   
dbj|GAA56306.1|  serine incorporator 1                                54.3    1e-05   Clonorchis sinensis [oriental liver fluke]
ref|XP_010513493.1|  PREDICTED: probable serine incorporator          53.9    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006285723.1|  hypothetical protein CARUB_v10007195mg           53.9    2e-05   Capsella rubella
ref|XP_010466851.1|  PREDICTED: probable serine incorporator          53.9    2e-05   Camelina sativa [gold-of-pleasure]
gb|KIJ14234.1|  hypothetical protein PAXINDRAFT_163421                53.5    2e-05   Paxillus involutus ATCC 200175
ref|XP_007013229.1|  Serinc-domain containing serine and sphingol...  53.5    2e-05   
ref|XP_007013228.1|  Serinc-domain containing serine and sphingol...  53.5    2e-05   
ref|XP_006297795.1|  hypothetical protein CARUB_v10013830mg           53.5    2e-05   Capsella rubella
ref|XP_001223754.1|  hypothetical protein CHGG_04540                  53.5    2e-05   Chaetomium globosum CBS 148.51
ref|XP_009107689.1|  PREDICTED: probable serine incorporator          53.1    2e-05   
ref|XP_009171257.1|  hypothetical protein T265_07464                  53.5    2e-05   Opisthorchis viverrini [Southeast Asian liver fluke]
emb|CDY43689.1|  BnaC08g46960D                                        53.1    3e-05   Brassica napus [oilseed rape]
ref|XP_010047746.1|  PREDICTED: probable serine incorporator isof...  53.1    3e-05   Eucalyptus grandis [rose gum]
ref|XP_006418745.1|  hypothetical protein EUTSA_v10002545mg           52.8    3e-05   
ref|XP_001538371.1|  conserved hypothetical protein                   53.1    3e-05   Histoplasma capsulatum NAm1
emb|CDX94813.1|  BnaC03g43750D                                        52.8    3e-05   
ref|XP_008471585.1|  PREDICTED: serine incorporator 1                 53.1    3e-05   
ref|XP_006418744.1|  hypothetical protein EUTSA_v10002545mg           52.8    3e-05   
gb|KIK77929.1|  hypothetical protein PAXRUDRAFT_834805                52.8    3e-05   Paxillus rubicundulus Ve08.2h10
gb|AGG38116.1|  maternal effect embryo arrest 55-3 protein            50.8    4e-05   Dimocarpus longan [longan]
ref|XP_003660386.1|  hypothetical protein MYCTH_2298645               52.8    4e-05   Thermothelomyces thermophila ATCC 42464
emb|CDY71080.1|  BnaAnng36040D                                        52.4    4e-05   Brassica napus [oilseed rape]
emb|CDX93013.1|  BnaA03g37350D                                        52.4    4e-05   
ref|XP_009135894.1|  PREDICTED: probable serine incorporator isof...  52.4    5e-05   Brassica rapa
ref|XP_009135897.1|  PREDICTED: probable serine incorporator isof...  52.4    5e-05   Brassica rapa
ref|XP_010915041.1|  PREDICTED: probable serine incorporator          52.0    6e-05   Elaeis guineensis
ref|NP_001131274.1|  uncharacterized protein LOC100192587             52.0    6e-05   
gb|ACG28988.1|  TMS membrane protein/tumor differentially express...  52.0    6e-05   Zea mays [maize]
ref|XP_007709253.1|  hypothetical protein COCCADRAFT_88158            52.0    7e-05   Bipolaris zeicola 26-R-13
ref|XP_010532841.1|  PREDICTED: probable serine incorporator          52.0    7e-05   
ref|XP_009102507.1|  PREDICTED: probable serine incorporator isof...  52.0    7e-05   Brassica rapa
ref|XP_002324973.1|  TMS membrane family protein                      52.0    7e-05   
emb|CDX77425.1|  BnaA07g05630D                                        51.6    7e-05   
ref|XP_009102508.1|  PREDICTED: probable serine incorporator isof...  51.6    7e-05   Brassica rapa
ref|XP_010049922.1|  PREDICTED: probable serine incorporator isof...  51.6    8e-05   
ref|XP_010049913.1|  PREDICTED: probable serine incorporator isof...  51.6    9e-05   Eucalyptus grandis [rose gum]
ref|XP_006842248.1|  hypothetical protein AMTR_s00078p00195500        51.2    1e-04   Amborella trichopoda
ref|XP_009545469.1|  hypothetical protein HETIRDRAFT_458668           51.6    1e-04   Heterobasidion irregulare TC 32-1
gb|EUN26863.1|  hypothetical protein COCVIDRAFT_99736                 51.2    1e-04   Bipolaris victoriae FI3
ref|XP_008337449.1|  PREDICTED: probable serine incorporator          51.2    1e-04   
gb|EMD93772.1|  hypothetical protein COCHEDRAFT_1132482               51.2    1e-04   Bipolaris maydis C5
ref|XP_002841809.1|  hypothetical protein                             47.0    1e-04   Tuber melanosporum Mel28
ref|XP_007687418.1|  hypothetical protein COCMIDRAFT_93798            51.2    1e-04   Bipolaris oryzae ATCC 44560
ref|XP_007160349.1|  hypothetical protein PHAVU_002G314300g           51.2    1e-04   Phaseolus vulgaris [French bean]
ref|XP_009381145.1|  PREDICTED: probable serine incorporator          51.2    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008024685.1|  hypothetical protein SETTUDRAFT_168930           51.2    1e-04   Exserohilum turcica Et28A
ref|XP_004512855.1|  PREDICTED: probable serine incorporator-like     51.2    1e-04   Cicer arietinum [garbanzo]
ref|XP_007701878.1|  hypothetical protein COCSADRAFT_121304           51.2    1e-04   Bipolaris sorokiniana ND90Pr
gb|KDO54165.1|  hypothetical protein CISIN_1g0159802mg                50.8    1e-04   Citrus sinensis [apfelsine]
ref|XP_006451100.1|  hypothetical protein CICLE_v10008536mg           51.2    1e-04   Citrus clementina [clementine]
ref|XP_001416509.1|  predicted protein                                50.8    1e-04   Ostreococcus lucimarinus CCE9901
ref|NP_849373.1|  protein MATERNAL EFFECT EMBRYO ARREST 55            50.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KDN52824.1|  TMS membrane protein/tumor differentially express...  50.8    1e-04   Tilletiaria anomala UBC 951
ref|NP_567403.1|  protein MATERNAL EFFECT EMBRYO ARREST 55            50.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AGG38115.1|  maternal effect embryo arrest 55-2 protein            50.8    2e-04   Dimocarpus longan [longan]
gb|EJU04752.1|  TMS membrane protein                                  50.8    2e-04   Dacryopinax primogenitus
ref|XP_010925321.1|  PREDICTED: probable serine incorporator          50.8    2e-04   Elaeis guineensis
gb|AGG19193.1|  maternal effect embryo arrest 55-1                    50.8    2e-04   Dimocarpus longan [longan]
ref|XP_009336915.1|  PREDICTED: probable serine incorporator          50.8    2e-04   
ref|XP_008362934.1|  PREDICTED: probable serine incorporator          50.4    2e-04   
emb|CCX14994.1|  Similar to Membrane protein TMS1; acc. no. Q12116    48.5    2e-04   Pyronema omphalodes CBS 100304
ref|XP_001190705.2|  PREDICTED: probable serine incorporator-like     50.4    2e-04   
ref|XP_010049722.1|  PREDICTED: probable serine incorporator          50.4    2e-04   Eucalyptus grandis [rose gum]
ref|XP_009408948.1|  PREDICTED: probable serine incorporator          50.4    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|KIL67495.1|  hypothetical protein M378DRAFT_258687                 50.4    3e-04   Amanita muscaria Koide BX008
dbj|GAD92421.1|  DNA mismatch repair protein (Pms1), putative         47.4    3e-04   Byssochlamys spectabilis No. 5
ref|NP_001053258.1|  Os04g0506300                                     50.1    3e-04   
ref|XP_001836185.1|  membrane protein                                 50.1    3e-04   Coprinopsis cinerea okayama7#130
ref|XP_004512960.1|  PREDICTED: probable serine incorporator-like     50.1    3e-04   Cicer arietinum [garbanzo]
ref|XP_008242601.1|  PREDICTED: probable serine incorporator          49.7    3e-04   Prunus mume [ume]
ref|XP_007202140.1|  hypothetical protein PRUPE_ppa006940mg           49.7    3e-04   
ref|XP_009352478.1|  PREDICTED: probable serine incorporator          49.7    3e-04   
ref|XP_002994401.1|  hypothetical protein SELMODRAFT_449363           49.7    3e-04   Selaginella moellendorffii
ref|XP_003653050.1|  hypothetical protein THITE_2115040               50.1    4e-04   Thielavia terrestris NRRL 8126
ref|XP_010879048.1|  PREDICTED: serine incorporator 3-like            49.7    4e-04   
ref|XP_005057115.1|  PREDICTED: serine incorporator 3                 49.7    4e-04   
ref|XP_003842629.1|  similar to membrane protein TMS1                 49.7    4e-04   
ref|XP_009390129.1|  PREDICTED: probable serine incorporator          49.7    4e-04   
ref|NP_001085879.1|  serine incorporator 3 precursor                  49.7    4e-04   
gb|KGQ04935.1|  Membrane protein TMS1                                 48.1    4e-04   
gb|KDE07206.1|  hypothetical protein MVLG_02606                       49.7    4e-04   
ref|XP_009161557.1|  hypothetical protein HMPREF1120_09034            49.7    4e-04   
gb|KIV97946.1|  hypothetical protein PV10_01642                       49.7    5e-04   
ref|XP_009865640.1|  PREDICTED: serine incorporator 3                 49.3    5e-04   
gb|KIZ04409.1|  Serine incorporator 3                                 42.7    5e-04   
ref|NP_001016331.1|  serine incorporator 3 precursor                  49.3    5e-04   
emb|CEJ00743.1|  hypothetical protein RMCBS344292_14792               49.3    5e-04   
gb|KFP75273.1|  Serine incorporator 3                                 49.3    5e-04   
ref|XP_006693860.1|  hypothetical protein CTHT_0034250                49.3    6e-04   
ref|XP_010073800.1|  PREDICTED: serine incorporator 3-like            49.3    6e-04   
ref|XP_005646031.1|  Serinc-domain-containing protein                 40.4    6e-04   
ref|XP_007338591.1|  TMS membrane protein/tumor differentially ex...  49.3    6e-04   
gb|KFU98253.1|  Serine incorporator 3                                 49.3    6e-04   
gb|KJB54128.1|  hypothetical protein B456_009G023600                  48.9    7e-04   
gb|KJB54127.1|  hypothetical protein B456_009G023600                  48.9    7e-04   
gb|KJB54130.1|  hypothetical protein B456_009G023600                  48.9    7e-04   
gb|KJB06649.1|  hypothetical protein B456_001G003900                  48.9    7e-04   
gb|KJB06650.1|  hypothetical protein B456_001G003900                  48.9    7e-04   
ref|XP_004287083.1|  PREDICTED: probable serine incorporator isof...  48.9    7e-04   
gb|KIX04087.1|  hypothetical protein Z518_07640                       48.9    7e-04   
ref|XP_011458210.1|  PREDICTED: probable serine incorporator isof...  48.9    8e-04   
gb|KHG16194.1|  Serine incorporator 3                                 48.9    8e-04   
ref|NP_001240143.1|  uncharacterized protein LOC100788574             48.9    8e-04   
ref|XP_001245605.1|  hypothetical protein CIMG_05046                  48.5    8e-04   
gb|KDQ57032.1|  hypothetical protein JAAARDRAFT_35631                 48.9    8e-04   
ref|XP_008210220.1|  PREDICTED: serine incorporator 1 isoform X4      48.5    8e-04   
ref|XP_002426175.1|  serine incorporator, putative                    48.5    9e-04   
ref|XP_008210211.1|  PREDICTED: probable serine incorporator isof...  48.5    9e-04   
ref|XP_008210231.1|  PREDICTED: serine incorporator 1 isoform X5      48.5    9e-04   
ref|XP_008210203.1|  PREDICTED: probable serine incorporator isof...  48.5    9e-04   
ref|XP_005073402.1|  PREDICTED: serine incorporator 1                 48.9    9e-04   
ref|XP_002626102.1|  serine incorporator                              48.5    9e-04   
gb|EEC70050.1|  hypothetical protein OsI_00646                        48.5    9e-04   
ref|XP_008210234.1|  PREDICTED: serine incorporator 1 isoform X6      48.5    9e-04   
gb|AAS66282.1|  LRRGT00191                                            48.9    9e-04   
gb|EEQ92459.1|  membrane protein TMS1                                 48.5    9e-04   
gb|EPE08329.1|  membrane protein                                      48.9    0.001   
ref|XP_755673.1|  membrane protein TMS1                               47.8    0.001   
ref|XP_001603720.2|  PREDICTED: probable serine incorporator isof...  48.5    0.001   
ref|NP_001042203.1|  Os01g0179800                                     48.5    0.001   
gb|EEE53986.1|  hypothetical protein OsJ_00615                        48.5    0.001   
ref|XP_001399368.2|  membrane protein TMS1                            48.5    0.001   
gb|EDP54845.1|  membrane protein TMS1, putative                       47.8    0.001   
dbj|GAA82425.1|  membrane protein TMS1                                48.5    0.001   
gb|KEY81584.1|  hypothetical protein membrane TMS1                    47.8    0.001   
ref|XP_003019590.1|  hypothetical protein TRV_06386                   48.5    0.001   
emb|CAK96401.1|  unnamed protein product                              48.5    0.001   
ref|XP_007893061.1|  PREDICTED: serine incorporator 1-like            48.5    0.001   



>emb|CDX83957.1| BnaC08g16880D [Brassica napus]
Length=821

 Score =   134 bits (337),  Expect(2) = 2e-54, Method: Composition-based stats.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEVISFYE  142


 Score =   105 bits (262),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDRE  73



>ref|XP_010532058.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
 ref|XP_010532059.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
Length=414

 Score =   130 bits (327),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFT+LS+MM+G+KNQKDPRD +HHGGWMMKVICW +LVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFIFFTVLSVMMVGVKNQKDPRDGIHHGGWMMKVICWCILVIFMFFLP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   108 bits (270),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>gb|KDP41926.1| hypothetical protein JCGZ_26944 [Jatropha curcas]
Length=413

 Score =   129 bits (324),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFT+L+I+M+G+KNQKDPRD+LHHGGWMMKVICW +LVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTVLAILMVGVKNQKDPRDSLHHGGWMMKVICWCILVIFMFFLP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score =   108 bits (271),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>ref|XP_002297693.2| TMS membrane family protein [Populus trichocarpa]
 gb|EEE82498.2| TMS membrane family protein [Populus trichocarpa]
Length=414

 Score =   129 bits (325),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+IMM+G+KNQKDPRD+LHHGGWM KV+CW LLVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAIMMVGVKNQKDPRDSLHHGGWMAKVVCWCLLVIFMFFLP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score =   108 bits (269),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            TVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFHKTPDRE
Sbjct  21   TVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEQIPWINHFHKTPDRE  73



>gb|ABK96018.1| unknown [Populus trichocarpa]
Length=414

 Score =   129 bits (325),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+IMM+G+KNQKDPRD+LHHGGWM KV+CW LLVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAIMMVGVKNQKDPRDSLHHGGWMAKVVCWCLLVIFMFFLP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score =   108 bits (269),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            TVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFHKTPDRE
Sbjct  21   TVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEQIPWINHFHKTPDRE  73



>ref|NP_173069.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 ref|NP_001185008.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAF18512.1|AC010924_25 Contains similarity to gb|AF181686 membrane protein TMS1d from 
Drosophila melanogaster. ESTs gb|R64994, gb|AI994832, gb|Z47674 
come from this gene [Arabidopsis thaliana]
 gb|AEE29416.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AEE29417.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=412

 Score =   129 bits (324),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FF+ILS+MMIG+KNQKDPRD +HHGGWMMK+ICW +LVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKIICWCILVIFMFFLP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   108 bits (271),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>ref|XP_006416842.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 ref|XP_006416843.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35195.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35196.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
Length=412

 Score =   129 bits (324),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FF+ILS+MMIG+KNQKDPRD +HHGGWMMKVICW +LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKVICWCILVILMFFVP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   108 bits (270),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>ref|XP_011034606.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034607.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034608.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=414

 Score =   129 bits (325),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+IMM+G+KNQKDPRD+LHHGGWM KV+CW LLVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAIMMVGVKNQKDPRDSLHHGGWMAKVVCWCLLVIFMFFLP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score =   108 bits (269),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            TVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFHKTPDRE
Sbjct  21   TVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEQIPWINHFHKTPDRE  73



>ref|XP_007024820.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 ref|XP_007024821.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27442.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27443.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
Length=413

 Score =   130 bits (327),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTILS +MIG+KNQ+DPRD LHHGGWMMKVICWF+LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILSFLMIGVKNQRDPRDGLHHGGWMMKVICWFILVILMFFVP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   107 bits (266),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP+RE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPNREWFET  77



>ref|XP_009117776.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
 ref|XP_009117777.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
Length=413

 Score =   130 bits (327),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEVISFYE  142


 Score =   106 bits (265),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>gb|KJB68285.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
 gb|KJB68288.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
 gb|KJB68289.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=413

 Score =   128 bits (322),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTILS+ M+G+KNQ+DPRD +HHGGWMMK+ICWF+LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILSVSMVGVKNQRDPRDAVHHGGWMMKIICWFILVILMFFVP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   108 bits (269),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME +PWINHFHKTPDRE  +
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKLPWINHFHKTPDREWFE  76



>emb|CDX81752.1| BnaC08g38490D [Brassica napus]
Length=412

 Score =   130 bits (326),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEVISFYE  142


 Score =   106 bits (265),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>gb|KJB68286.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=411

 Score =   128 bits (322),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTILS+ M+G+KNQ+DPRD +HHGGWMMK+ICWF+LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILSVSMVGVKNQRDPRDAVHHGGWMMKIICWFILVILMFFVP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   108 bits (269),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME +PWINHFHKTPDRE  +
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKLPWINHFHKTPDREWFE  76



>ref|XP_009110458.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
 ref|XP_009110459.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
Length=412

 Score =   130 bits (326),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEVISFYE  142


 Score =   106 bits (265),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>emb|CDY70974.1| BnaAnng35710D [Brassica napus]
Length=412

 Score =   130 bits (327),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFFVP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEVISFYE  142


 Score =   106 bits (264),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>ref|XP_010063622.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
Length=414

 Score =   130 bits (328),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+IMMIG+KNQ+DPRD +HHGGWMMK+ICW LLVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAIMMIGVKNQRDPRDGIHHGGWMMKIICWCLLVIFMFFLP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   105 bits (262),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISR+SARIAYCGLF LSLIVSWILREVAAPLME +PWIN FHKTPDRE  + 
Sbjct  20   RTVVSGISRKSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINQFHKTPDREWFET  77



>ref|XP_002890152.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66411.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   127 bits (319),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FF+ILS+MMIG+KNQKDPRD +HHGGWMMK+ICW +LVI MFF+P
Sbjct  75   FETDAVLRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKIICWCILVILMFFLP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   108 bits (270),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>ref|XP_010063623.1| PREDICTED: probable serine incorporator isoform X2 [Eucalyptus 
grandis]
 gb|KCW70852.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=412

 Score =   130 bits (327),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+IMMIG+KNQ+DPRD +HHGGWMMK+ICW LLVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAIMMIGVKNQRDPRDGIHHGGWMMKIICWCLLVIFMFFLP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   105 bits (262),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISR+SARIAYCGLF LSLIVSWILREVAAPLME +PWIN FHKTPDRE  + 
Sbjct  20   RTVVSGISRKSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINQFHKTPDREWFET  77



>gb|KJB68287.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=411

 Score =   126 bits (316),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTILS+ M+G+KNQ+DPRD +HHGGWMMK+ICWF+LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILSVSMVGVKNQRDPRDAVHHGGWMMKIICWFILVILMFFVP  134

Query  517  NELISFYE  540
            NE+ISFY 
Sbjct  135  NEIISFYA  142


 Score =   108 bits (269),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>ref|XP_002512768.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF49271.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=413

 Score =   125 bits (314),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+ +M+G+K+QKDPRD LHHGGWMMK+ICW +LVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILATLMVGVKSQKDPRDGLHHGGWMMKIICWCVLVIFMFFLP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score =   108 bits (271),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>gb|KHG09631.1| Serine incorporator 3 [Gossypium arboreum]
Length=413

 Score =   126 bits (316),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+  M+G+KNQ+DPRD +HHGGWMMK+ICWF+LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILAFSMVGVKNQRDPRDAVHHGGWMMKIICWFILVILMFFVP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   108 bits (270),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME +PWINHFHKTPDRE  +
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKLPWINHFHKTPDREWFE  76



>gb|EYU21792.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21793.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21794.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=416

 Score =   124 bits (312),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I MIG+KNQKDPRD++HHGGWMMK+ICW +LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILAIFMIGVKNQKDPRDSVHHGGWMMKIICWCVLVILMFFVP  134

Query  517  NELISFYE  540
            N +ISFYE
Sbjct  135  NGIISFYE  142


 Score =   108 bits (271),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFH+TPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINHFHQTPDREWFET  77



>gb|EYU21795.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=414

 Score =   124 bits (312),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I MIG+KNQKDPRD++HHGGWMMK+ICW +LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILAIFMIGVKNQKDPRDSVHHGGWMMKIICWCVLVILMFFVP  134

Query  517  NELISFYE  540
            N +ISFYE
Sbjct  135  NGIISFYE  142


 Score =   108 bits (271),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFH+TPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINHFHQTPDREWFET  77



>ref|XP_002270610.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 ref|XP_010655133.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 emb|CBI25248.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   126 bits (316),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVS GNF FFTIL+I+MIG+KNQKDPRD +HHGGWMMK+ICW +LVIF FF+P
Sbjct  75   FETDAVLRVSFGNFLFFTILAILMIGVKNQKDPRDGMHHGGWMMKIICWCILVIFTFFLP  134

Query  517  NELISFYE  540
            NELISFYE
Sbjct  135  NELISFYE  142


 Score =   106 bits (265),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP+RE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPNREWFET  77



>emb|CDO98258.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   125 bits (315),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL++ M+GIKNQKDPRD++HHGGWM+K+ICW LLVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILAVFMMGIKNQKDPRDSVHHGGWMIKIICWCLLVILMFFVP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   107 bits (266),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISR+SARIAYCGLF  SLIVSWILREVAAPLME IPWINHFH+TPDRE  + 
Sbjct  20   RTVVSGISRKSARIAYCGLFAFSLIVSWILREVAAPLMEKIPWINHFHQTPDREWFET  77



>gb|KJB67012.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
Length=374

 Score =   126 bits (317),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTILS +MIG+KNQ+DPRD LHHG WMMK++CWF+LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILSFLMIGVKNQRDPRDGLHHGRWMMKIVCWFILVILMFFVP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   106 bits (265),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            RTVVSGISRRSARIAYCGLF LSL VSWILREVAAPLME +PWINHFHKTP+RE
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLFVSWILREVAAPLMEQLPWINHFHKTPNRE  73



>ref|XP_006427689.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
 gb|ESR40929.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
Length=413

 Score =   131 bits (330),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTILSI+M+G+KNQKDPRD+LHHGGWMMK+ICW LLVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILSILMVGVKNQKDPRDSLHHGGWMMKIICWCLLVIFMFFLP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score =   100 bits (250),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  182  VSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            VSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP RE  + 
Sbjct  23   VSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPSREWFET  77



>ref|XP_006307669.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
 gb|EOA40567.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
Length=412

 Score =   123 bits (309),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FF+ILS+MMIG+KNQKDPRD +HHGGWMMK+I W +LVI MFF+P
Sbjct  75   FETDAVLRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKIISWCILVILMFFLP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   108 bits (271),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>gb|KJB67006.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67007.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67008.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67009.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67010.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67011.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67013.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
Length=412

 Score =   126 bits (317),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTILS +MIG+KNQ+DPRD LHHG WMMK++CWF+LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILSFLMIGVKNQRDPRDGLHHGRWMMKIVCWFILVILMFFVP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   106 bits (264),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSL VSWILREVAAPLME +PWINHFHKTP+RE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLFVSWILREVAAPLMEQLPWINHFHKTPNREWFET  77



>ref|XP_006493450.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
Length=413

 Score =   131 bits (330),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTILSI+M+G+KNQKDPRD+LHHGGWMMK+ICW LLVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILSILMVGVKNQKDPRDSLHHGGWMMKIICWCLLVIFMFFLP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score =   100 bits (250),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  182  VSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            VSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP RE  + 
Sbjct  23   VSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPSREWFET  77



>ref|XP_011073234.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073235.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073236.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   125 bits (314),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I MIG+KNQKDPRD++HHGGWMMK+ICW +LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILAIFMIGVKNQKDPRDSIHHGGWMMKIICWCILVILMFFVP  134

Query  517  NELISFYE  540
            N +ISFYE
Sbjct  135  NGIISFYE  142


 Score =   106 bits (264),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSL+V+W+LREVAAPLME IPWINHFH+TPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVAWMLREVAAPLMEKIPWINHFHQTPDREWFET  77



>ref|XP_002304839.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
 gb|EEE79818.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
Length=364

 Score =   126 bits (316),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+ MM+G+KNQKDPRD+LHHGGWM KV+CW +LVI MFF+P
Sbjct  75   FETDAVLRVSLGNFMFFTILATMMVGVKNQKDPRDSLHHGGWMAKVVCWCILVILMFFLP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score =   105 bits (261),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  179  VVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            VVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE
Sbjct  22   VVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDRE  73



>ref|XP_011020548.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=415

 Score =   125 bits (314),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+ MM+G+KNQKDPRD+LHHGGWM KV+CW +LVI MFF+P
Sbjct  75   FETDAVLRVSLGNFMFFTILATMMVGVKNQKDPRDSLHHGGWMAKVVCWCILVILMFFLP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score =   105 bits (261),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  179  VVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            VVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  22   VVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>ref|XP_010459155.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   121 bits (303),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FF ILS+MMIG+K QKDPRD +HHGGWMMK+I W +LVI MFF+P
Sbjct  75   FETDAVLRVSLGNFLFFAILSVMMIGVKTQKDPRDGIHHGGWMMKIISWCILVILMFFLP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   108 bits (271),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>ref|XP_010476724.1| PREDICTED: serine incorporator 3 [Camelina sativa]
Length=412

 Score =   121 bits (303),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FF ILS+MMIG+K QKDPRD +HHGGWMMK+I W +LVI MFF+P
Sbjct  75   FETDAVLRVSLGNFLFFAILSVMMIGVKTQKDPRDGIHHGGWMMKIISWCILVILMFFLP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   108 bits (271),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>ref|XP_010497691.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497697.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497701.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497705.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   121 bits (303),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FF ILS+MMIG+K QKDPRD +HHGGWMMK+I W +LVI MFF+P
Sbjct  75   FETDAVLRVSLGNFLFFAILSVMMIGVKTQKDPRDGIHHGGWMMKIISWCILVILMFFLP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score =   108 bits (271),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFET  77



>ref|XP_010318692.1| PREDICTED: probable serine incorporator [Solanum lycopersicum]
Length=413

 Score =   127 bits (318),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLP  134

Query  517  NELISFYE  540
            N +ISFYE
Sbjct  135  NGIISFYE  142


 Score =   102 bits (255),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWIN FH TP+RE
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINSFHTTPNRE  73



>ref|XP_011082649.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   121 bits (304),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I MIG+KNQKD RD+LHHGGWMMK+ICW +LVI MFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAIFMIGVKNQKDSRDSLHHGGWMMKIICWCILVILMFFLP  134

Query  517  NELISFYE  540
            N +ISFYE
Sbjct  135  NGIISFYE  142


 Score =   108 bits (270),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSL+VSWILREVAAPLME IPWINHFH+TPDRE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVSWILREVAAPLMEKIPWINHFHQTPDREWFET  77



>ref|XP_009759114.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009759115.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
Length=413

 Score =   127 bits (318),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLP  134

Query  517  NELISFYE  540
            N +ISFYE
Sbjct  135  NGIISFYE  142


 Score =   102 bits (255),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWIN FH TP+RE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINSFHSTPNREWFET  77



>ref|XP_009759116.1| PREDICTED: probable serine incorporator isoform X2 [Nicotiana 
sylvestris]
Length=411

 Score =   127 bits (318),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLP  134

Query  517  NELISFYE  540
            N +ISFYE
Sbjct  135  NGIISFYE  142


 Score =   102 bits (255),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWIN FH TP+RE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINSFHSTPNREWFET  77



>ref|XP_004492298.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=410

 Score =   127 bits (319),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +1

Query  310  FPQNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFL  489
            F Q      FETDAVLRVSLGNF FFTIL+ +MIG+K QKDPRD LHHGGWMMK+ICW L
Sbjct  66   FKQTPSREWFETDAVLRVSLGNFLFFTILATLMIGVKTQKDPRDGLHHGGWMMKIICWCL  125

Query  490  LVIFMFFVPNELISFYE  540
            +VIFMFF+PNE+ISFYE
Sbjct  126  MVIFMFFLPNEIISFYE  142


 Score =   102 bits (253),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            RTVVSGISRRSARIAYCGLF LSL+V+WILREVAAPLME+IPWINHF +TP RE
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLVVAWILREVAAPLMESIPWINHFKQTPSRE  73



>ref|XP_006341429.1| PREDICTED: probable serine incorporator-like isoform X1 [Solanum 
tuberosum]
Length=413

 Score =   127 bits (318),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLP  134

Query  517  NELISFYE  540
            N +ISFYE
Sbjct  135  NGIISFYE  142


 Score =   102 bits (254),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILRE+AAPLME IPWIN FH TP+RE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREIAAPLMEKIPWINSFHTTPNREWFET  77



>ref|XP_006341430.1| PREDICTED: probable serine incorporator-like isoform X2 [Solanum 
tuberosum]
Length=411

 Score =   127 bits (318),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLP  134

Query  517  NELISFYE  540
            N +ISFYE
Sbjct  135  NGIISFYE  142


 Score =   102 bits (254),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILRE+AAPLME IPWIN FH TP+RE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREIAAPLMEKIPWINSFHTTPNREWFET  77



>ref|XP_010107188.1| putative serine incorporator [Morus notabilis]
 gb|EXC14084.1| putative serine incorporator [Morus notabilis]
Length=413

 Score =   127 bits (320),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I+M+G+KNQ+DPRD LHHGGWMMK+ICW LLVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAILMVGVKNQRDPRDGLHHGGWMMKIICWCLLVIFMFFLP  134

Query  517  NELISFYE  540
            NE+I+FYE
Sbjct  135  NEIINFYE  142


 Score =   101 bits (251),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWIN+FH TP RE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINNFHHTPSREWFET  77



>ref|XP_010914044.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=415

 Score =   126 bits (316),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL++MM+GIK+QKDPRD LHHGGWM K++CWF+LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILALMMVGIKDQKDPRDRLHHGGWMAKIVCWFVLVILMFFVP  134

Query  517  NELISFYE  540
            N L+SFYE
Sbjct  135  NGLVSFYE  142


 Score =   102 bits (255),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            R+VV GISRRS+RIAYCGLF  SLIVSWILREVAAPLME +PWINHFH+TPDRE  +
Sbjct  20   RSVVGGISRRSSRIAYCGLFAFSLIVSWILREVAAPLMEKLPWINHFHRTPDREWFE  76



>ref|XP_009615679.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   127 bits (319),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLP  134

Query  517  NELISFYE  540
            N +ISFYE
Sbjct  135  NGIISFYE  142


 Score =   101 bits (252),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH TP+RE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINSFHSTPNREWFET  77



>ref|XP_009615680.1| PREDICTED: serine incorporator 3 isoform X2 [Nicotiana tomentosiformis]
Length=413

 Score =   127 bits (319),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLP  134

Query  517  NELISFYE  540
            N +ISFYE
Sbjct  135  NGIISFYE  142


 Score =   101 bits (251),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH TP+RE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINSFHSTPNREWFET  77



>ref|XP_009615681.1| PREDICTED: probable serine incorporator isoform X3 [Nicotiana 
tomentosiformis]
Length=411

 Score =   127 bits (319),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I+MIG+KNQKDPRD++HHGGWMMK+ICW L+VIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAILMIGVKNQKDPRDSMHHGGWMMKIICWCLMVIFMFFLP  134

Query  517  NELISFYE  540
            N +ISFYE
Sbjct  135  NGIISFYE  142


 Score =   101 bits (252),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH TP+RE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINSFHSTPNREWFET  77



>gb|KDO46126.1| hypothetical protein CISIN_1g032312mg [Citrus sinensis]
 gb|KDO46127.1| hypothetical protein CISIN_1g032312mg [Citrus sinensis]
Length=143

 Score =   127 bits (320),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTILSI+M+G+KNQKDPRD+LHHGGWMMK+ICW LLVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILSILMVGVKNQKDPRDSLHHGGWMMKIICWCLLVIFMFFLP  134

Query  517  NELISFY  537
            NE++SFY
Sbjct  135  NEIVSFY  141


 Score =   100 bits (248),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  182  VSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            VSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTP RE
Sbjct  23   VSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPSRE  73



>ref|XP_008342757.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   134 bits (336),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTILS+MM+G+KNQKDPRD+LHHGGWMMKVICW LLVIFMFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score = 93.6 bits (231),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN F++T +RE
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINQFNETHNRE  73



>ref|XP_003532291.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN07179.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   128 bits (322),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+++M+G+K Q+DPRD++HHGGWMMK+ICW LLVIFMFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILAVLMVGVKTQRDPRDSMHHGGWMMKIICWCLLVIFMFFVP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score = 99.4 bits (246),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF  SL+V+WILREVAAPLME++PWINHF  TP RE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFAFSLVVAWILREVAAPLMESLPWINHFKHTPSREWFET  77



>ref|XP_009354238.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009354239.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370970.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370971.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   134 bits (336),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTILS+MM+G+KNQKDPRD+LHHGGWMMKVICW LLVIFMFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score = 93.6 bits (231),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN F++T +RE
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINQFNETHNRE  73



>ref|XP_007140603.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
 gb|ESW12597.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
Length=410

 Score =   127 bits (320),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+++M G+K Q+DPRD +HHGGWMMK+ICWFLLVIFMFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILAVLMTGVKTQRDPRDGMHHGGWMMKIICWFLLVIFMFFVP  134

Query  517  NELISFYE  540
            NE+I FYE
Sbjct  135  NEIIGFYE  142


 Score = 99.8 bits (247),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF  SLIV+WILREVAAPLME++PWINHF  TP RE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFAFSLIVAWILREVAAPLMESLPWINHFSHTPSREWFET  77



>ref|XP_004158797.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
 gb|KGN45209.1| hypothetical protein Csa_7G431410 [Cucumis sativus]
Length=411

 Score =   129 bits (324),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+TDAVLRVSLGNF FFTILS+MM+G+K+Q+DPRDN+HHGGWM+KVICWFLLV+ MFFVP
Sbjct  75   FQTDAVLRVSLGNFLFFTILSVMMVGVKSQRDPRDNIHHGGWMVKVICWFLLVVLMFFVP  134

Query  517  NELISFYE  540
            NE+I+FYE
Sbjct  135  NEIITFYE  142


 Score = 97.8 bits (242),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH+TP R+  + 
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINTFHETPSRDWFQT  77



>gb|EPS57849.1| hypothetical protein M569_16968, partial [Genlisea aurea]
Length=239

 Score =   122 bits (307),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +1

Query  310  FPQNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFL  489
            F Q      FETDAVLRVSLGNF FFTIL+I+M+GIKNQ+DPRD +HHGGWMMK+ CWF+
Sbjct  66   FHQTPDKEWFETDAVLRVSLGNFLFFTILAILMVGIKNQRDPRDTVHHGGWMMKIFCWFV  125

Query  490  LVIFMFFVPNELISFYE  540
            LVI MFF+PN ++SFYE
Sbjct  126  LVILMFFIPNGIVSFYE  142


 Score =   103 bits (258),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  182  VSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            +SGISRRSARIAYCGLFGLSLIVSWILREVAAPLME IPWINHFH+TPD+E
Sbjct  23   ISGISRRSARIAYCGLFGLSLIVSWILREVAAPLMEKIPWINHFHQTPDKE  73



>ref|XP_010929190.1| PREDICTED: probable serine incorporator isoform X1 [Elaeis guineensis]
Length=423

 Score =   121 bits (304),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+++M+GIK+QKDPRD LHHGGWM K++CW +LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILAVLMVGIKDQKDPRDRLHHGGWMAKIVCWCVLVILMFFVP  134

Query  517  NELISFYE  540
            N L+SFYE
Sbjct  135  NGLVSFYE  142


 Score =   104 bits (260),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            R+VV GISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFH+TPDRE
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHQTPDRE  73



>ref|XP_009365247.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009365248.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   134 bits (336),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTILS+MM+G+KNQKDPRD+LHHGGWMMKVICW LLVIFMFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score = 91.7 bits (226),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWI+ F++T +RE
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWISQFNETHNRE  73



>ref|XP_008794380.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=415

 Score =   120 bits (302),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+++M GIK+QKDPRD LHHGGWM KV+CW +LVI MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILALLMAGIKDQKDPRDRLHHGGWMAKVVCWCVLVILMFFVP  134

Query  517  NELISFYE  540
            N L+SFYE
Sbjct  135  NGLVSFYE  142


 Score =   104 bits (260),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            R+VV GISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFH+TPDRE  +
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHRTPDREWFE  76



>ref|XP_004135884.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
Length=422

 Score =   127 bits (318),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+TDAVLRVSLGNF FFTILS+MM+G+K+Q+DPRDN+HHGGWM+KVICWFLLV+ MFFVP
Sbjct  75   FQTDAVLRVSLGNFLFFTILSVMMVGVKSQRDPRDNIHHGGWMVKVICWFLLVVLMFFVP  134

Query  517  NELISFY  537
            NE+I+FY
Sbjct  135  NEIITFY  141


 Score = 97.8 bits (242),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH+TP R+  + 
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINTFHETPSRDWFQT  77



>ref|XP_008461193.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Cucumis melo]
Length=416

 Score =   127 bits (319),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+TDAVLRVSLGNF FFTILS+MM+G+K Q+DPRDN+HHGGWM+KVICWFLLV+ MFF+P
Sbjct  75   FQTDAVLRVSLGNFLFFTILSVMMVGVKTQRDPRDNIHHGGWMVKVICWFLLVVLMFFIP  134

Query  517  NELISFYE  540
            NE+I+FYE
Sbjct  135  NEIITFYE  142


 Score = 97.4 bits (241),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWIN FH+TP R+  + 
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWINTFHETPSRDWFQT  77



>ref|XP_003552131.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN15373.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   125 bits (314),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I+M+G+K Q+DPRD++HHGGWMMK+ICW LLVI MFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAILMVGVKTQRDPRDSMHHGGWMMKIICWCLLVISMFFIP  134

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  135  NEIISFYE  142


 Score = 99.0 bits (245),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVSGISRRSARIAYCGLF  SL+V+WILREVAAPLME++PWINHF  TP RE  + 
Sbjct  20   RTVVSGISRRSARIAYCGLFAFSLVVAWILREVAAPLMESLPWINHFKHTPSREWFET  77



>ref|XP_008381162.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   134 bits (337),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTILS+MM+G+KNQKDPRD+LHHGGWMMKVICW LLVIFMFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILSVMMVGVKNQKDPRDSLHHGGWMMKVICWCLLVIFMFFVP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score = 87.0 bits (214),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            RTVVS ISRRSARIAYCGLF LSLIVS ILREVAAPL+E IPWI+ F++T +RE
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSXILREVAAPLLEKIPWISQFNETHNRE  73



>ref|XP_009399576.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   121 bits (303),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+++MIGIK+QKDPRD LHHGGWM K++CWF++V  MFFVP
Sbjct  75   FETDAVLRVSLGNFVFFTILAVVMIGIKDQKDPRDQLHHGGWMAKIVCWFIVVFLMFFVP  134

Query  517  NELISFYE  540
            N ++SFYE
Sbjct  135  NGIVSFYE  142


 Score = 99.0 bits (245),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            R+V   ISRRSARIAYCGLF LSL+VSW LREVAAPLME++PWINHFHKTPDRE  +
Sbjct  20   RSVAGSISRRSARIAYCGLFALSLVVSWGLREVAAPLMESLPWINHFHKTPDREWFE  76



>ref|XP_009383181.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   116 bits (291),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFT+L+++MIGIK+QKDPRD LHHGGWM K++CW ++V  MFFVP
Sbjct  75   FETDAVLRVSLGNFFFFTLLAVLMIGIKDQKDPRDRLHHGGWMAKIVCWCIVVFLMFFVP  134

Query  517  NELISFYE  540
            N ++SFYE
Sbjct  135  NGIVSFYE  142


 Score =   101 bits (252),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            R+VV GISRRSARIAYCGLF LSL+VSW+LREVAAPLME++PWINHF KTPDRE  + 
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLVVSWVLREVAAPLMESLPWINHFRKTPDREWFET  77



>ref|XP_008228861.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228862.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228863.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228864.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=413

 Score =   126 bits (316),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL++MM+G+K+QKDPRD+LHHGGWMMK+I W LLVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAVMMVGVKSQKDPRDSLHHGGWMMKIISWCLLVIFMFFIP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score = 91.7 bits (226),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWI  F++T +RE  +
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWITQFNQTHNREWFE  76



>ref|XP_007215457.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 ref|XP_007215458.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16656.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16657.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=413

 Score =   126 bits (316),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL++MM+G+K+QKDPRD+LHHGGWMMK+I W LLVIFMFF+P
Sbjct  75   FETDAVLRVSLGNFLFFTILAVMMVGVKSQKDPRDSLHHGGWMMKIISWCLLVIFMFFIP  134

Query  517  NELISFYE  540
            NE++SFYE
Sbjct  135  NEIVSFYE  142


 Score = 91.7 bits (226),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IPWI  F++T +RE  +
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPWITQFNQTHNREWFE  76



>emb|CDY52849.1| BnaA09g56410D [Brassica napus]
Length=400

 Score =   111 bits (277),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FF+ILS+MMIG+K QKDPRD +HHGGWMMKVICWF+LVI MF  P
Sbjct  75   FETDAVLRVSLGNFVFFSILSVMMIGVKTQKDPRDGIHHGGWMMKVICWFILVILMFSFP  134

Query  517  NELISF  534
             +  +F
Sbjct  135  MKSSAF  140


 Score =   105 bits (262),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHK+PDRE  + 
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKSPDREWFET  77



>gb|EAZ24909.1| hypothetical protein OsJ_08689 [Oryza sativa Japonica Group]
Length=414

 Score =   115 bits (288),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I+M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVP
Sbjct  75   FETDAVLRVSLGNFVFFTILAIIMAGIKDQKDPRDKIHHGGWMAKIFCWVVIVFLMFFVP  134

Query  517  NELISFYE  540
            N ++SFYE
Sbjct  135  NGVVSFYE  142


 Score = 96.3 bits (238),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RT V  I RRSARIAYCGLF LSL+ SW LREVAAPL+++IPWINHFHKTPDRE  + 
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLLASWALREVAAPLLQSIPWINHFHKTPDREWFET  77



>ref|NP_001048364.1| Os02g0792900 [Oryza sativa Japonica Group]
 dbj|BAD19186.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAD19654.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAF10278.1| Os02g0792900 [Oryza sativa Japonica Group]
 gb|EAY87831.1| hypothetical protein OsI_09251 [Oryza sativa Indica Group]
 dbj|BAG96913.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97616.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99574.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   115 bits (288),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I+M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVP
Sbjct  75   FETDAVLRVSLGNFVFFTILAIIMAGIKDQKDPRDKIHHGGWMAKIFCWVVIVFLMFFVP  134

Query  517  NELISFYE  540
            N ++SFYE
Sbjct  135  NGVVSFYE  142


 Score = 95.9 bits (237),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDRE  + 
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFET  77



>ref|XP_006845424.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
 gb|ERN07099.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
Length=415

 Score =   109 bits (273),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+TDAVLRVSLGNF FFT+L+++MIG+KNQKDPRD+LHHGGWM+K++ W ++VI MFF+ 
Sbjct  75   FQTDAVLRVSLGNFLFFTLLAVIMIGVKNQKDPRDSLHHGGWMVKIVTWCIVVILMFFLS  134

Query  517  NELISFYE  540
            N ++ FYE
Sbjct  135  NGIVEFYE  142


 Score =   100 bits (250),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            R+VV GISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHF  TPDRE  +
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFAHTPDREWFQ  76



>ref|NP_001130490.1| hypothetical protein precursor [Zea mays]
 gb|ACF78724.1| unknown [Zea mays]
 gb|ACN28943.1| unknown [Zea mays]
 gb|AFW73836.1| hypothetical protein ZEAMMB73_916907 [Zea mays]
Length=413

 Score =   114 bits (285),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+++M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWVIIVFLMFFVP  134

Query  517  NELISFYE  540
            N ++SFYE
Sbjct  135  NGVVSFYE  142


 Score = 95.5 bits (236),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDRE  +
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFE  76



>ref|XP_002454688.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
 gb|EES07664.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
Length=413

 Score =   114 bits (284),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+++M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWAVIVFLMFFVP  134

Query  517  NELISFYE  540
            N ++SFYE
Sbjct  135  NGVVSFYE  142


 Score = 95.9 bits (237),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDRE  +
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFE  76



>ref|XP_004954190.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=413

 Score =   114 bits (285),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+++M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWAIIVFLMFFVP  134

Query  517  NELISFYE  540
            N ++SFYE
Sbjct  135  NGVVSFYE  142


 Score = 95.5 bits (236),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDRE  +
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFE  76



>gb|KEH22798.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=410

 Score =   127 bits (318),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +1

Query  310  FPQNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFL  489
            F Q      FETDAVLRVS GNF FFTIL+ MM+G+K QKDPRD LHHGGWMMK+ICW L
Sbjct  66   FKQTPSREWFETDAVLRVSFGNFLFFTILAAMMVGVKTQKDPRDGLHHGGWMMKIICWCL  125

Query  490  LVIFMFFVPNELISFYE  540
            LVIFMFF+PNE+ISFYE
Sbjct  126  LVIFMFFLPNEIISFYE  142


 Score = 81.6 bits (200),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            ARIAYCGLF LSL+V+W+LREVAAPLME+IPWINHF +TP RE
Sbjct  31   ARIAYCGLFALSLVVAWMLREVAAPLMESIPWINHFKQTPSRE  73



>gb|ACL54492.1| unknown [Zea mays]
Length=413

 Score =   113 bits (282),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+++M GIK+QKDPRD +HHGGWM K+ CW ++   MFFVP
Sbjct  75   FETDAVLRVSLGNFLFFTILAVIMAGIKDQKDPRDKIHHGGWMAKIFCWVIIAFLMFFVP  134

Query  517  NELISFYE  540
            N ++SFYE
Sbjct  135  NGVVSFYE  142


 Score = 95.5 bits (236),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDRE  +
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFE  76



>emb|CAN80335.1| hypothetical protein VITISV_009414 [Vitis vinifera]
Length=382

 Score =   126 bits (317),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVS GNF FFTIL+I+MIG+KNQKDPRD +HHGGWMMK+ICW +LVIF FF+P
Sbjct  121  FETDAVLRVSFGNFLFFTILAILMIGVKNQKDPRDGMHHGGWMMKIICWCILVIFTFFLP  180

Query  517  NELISFYE  540
            NELISFYE
Sbjct  181  NELISFYE  188


 Score = 82.0 bits (201),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 52/100 (52%), Gaps = 46/100 (46%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPW-----------------  301
            RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +P+                 
Sbjct  20   RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPYFGCSFIFLRNLLRFLLS  79

Query  302  -----------------------------INHFHKTPDRE  334
                                         INHFHKTP+RE
Sbjct  80   LLGLKLSLKIKPARVAQLVRANTRKCGPRINHFHKTPNRE  119



>ref|XP_003570284.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=414

 Score =   110 bits (274),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+ +M GIK+QKDPRD +HHGGWM K+ CW ++V  MF VP
Sbjct  75   FETDAVLRVSLGNFLFFTILAGIMAGIKDQKDPRDKIHHGGWMAKIFCWAVIVFLMFLVP  134

Query  517  NELISFYE  540
            N ++SFYE
Sbjct  135  NGVVSFYE  142


 Score = 98.2 bits (243),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            RT V  I RRSARIAYCGLF LSL+ SW+LREVAAPL+++IPWINHFHKTPDRE  +
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLLTSWVLREVAAPLLQSIPWINHFHKTPDREWFE  76



>ref|XP_006649122.1| PREDICTED: probable serine incorporator-like, partial [Oryza 
brachyantha]
Length=384

 Score =   115 bits (289),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+I+M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVP
Sbjct  45   FETDAVLRVSLGNFVFFTILAIIMAGIKDQKDPRDKIHHGGWMAKIFCWVVIVFLMFFVP  104

Query  517  NELISFYE  540
            N ++SFYE
Sbjct  105  NGVVSFYE  112


 Score = 83.6 bits (205),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            ARIAYCGLF LSL  SW LREVAAPL+++IPWINHFHKTPDRE  +
Sbjct  1    ARIAYCGLFALSLFASWALREVAAPLLQSIPWINHFHKTPDREWFE  46



>gb|EMT13726.1| Putative serine incorporator [Aegilops tauschii]
Length=414

 Score =   113 bits (282),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+ +M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVP
Sbjct  76   FETDAVLRVSLGNFLFFTILAAIMAGIKDQKDPRDKVHHGGWMAKIFCWVVIVFLMFFVP  135

Query  517  NELISFYE  540
            N ++SFYE
Sbjct  136  NGVVSFYE  143


 Score = 85.1 bits (209),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPW-INHFHKTPDRECLK  343
            RT V  I RRSARIAYCGLF LSL+ SW+LREVAAPL+++ P  INHFHKTPDRE  +
Sbjct  20   RTAVGSIGRRSARIAYCGLFALSLLASWVLREVAAPLLQSHPHRINHFHKTPDREWFE  77



>gb|KEH22799.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=427

 Score =   127 bits (319),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +1

Query  310  FPQNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFL  489
            F Q      FETDAVLRVS GNF FFTIL+ MM+G+K QKDPRD LHHGGWMMK+ICW L
Sbjct  83   FKQTPSREWFETDAVLRVSFGNFLFFTILAAMMVGVKTQKDPRDGLHHGGWMMKIICWCL  142

Query  490  LVIFMFFVPNELISFYE  540
            LVIFMFF+PNE+ISFYE
Sbjct  143  LVIFMFFLPNEIISFYE  159


 Score = 70.9 bits (172),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 40/60 (67%), Gaps = 17/60 (28%)
 Frame = +2

Query  206  ARIAYCGLFGLSLIVSWILREVAAPLMENIP-----------------WINHFHKTPDRE  334
            ARIAYCGLF LSL+V+W+LREVAAPLME+IP                 WINHF +TP RE
Sbjct  31   ARIAYCGLFALSLVVAWMLREVAAPLMESIPCIGAVWIELLELIGVSSWINHFKQTPSRE  90



>ref|XP_007215456.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16655.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=397

 Score =   117 bits (294),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  528
            AVLRVSLGNF FFTIL++MM+G+K+QKDPRD+LHHGGWMMK+I W LLVIFMFF+PNE++
Sbjct  63   AVLRVSLGNFLFFTILAVMMVGVKSQKDPRDSLHHGGWMMKIISWCLLVIFMFFIPNEIV  122

Query  529  SFYE  540
            SFYE
Sbjct  123  SFYE  126


 Score = 77.0 bits (188),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPW  301
            RTVVS ISRRSARIAYCGLF LSLIVSWILREVAAPL+E IP+
Sbjct  20   RTVVSSISRRSARIAYCGLFALSLIVSWILREVAAPLLEKIPY  62



>ref|XP_011466994.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466995.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466996.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466997.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
Length=414

 Score =   102 bits (254),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 63/69 (91%), Gaps = 1/69 (1%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICW-FLLVIFMFFV  513
            FET+AVLRVSLGNF FFTILS++MIG+K+QKDPRD++HHGGWMMKVICW  L++  +FFV
Sbjct  75   FETEAVLRVSLGNFLFFTILSVVMIGVKSQKDPRDSIHHGGWMMKVICWFLLVLFSLFFV  134

Query  514  PNELISFYE  540
            PN +ISFYE
Sbjct  135  PNGVISFYE  143


 Score = 89.0 bits (219),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            ++ VS ISRRSARIAYC LF  SLI SWILR+VA PL+E IPWINHFH+ PDRE
Sbjct  20   QSAVSSISRRSARIAYCFLFAFSLIASWILRDVAPPLLEKIPWINHFHQIPDRE  73



>ref|XP_010255869.1| PREDICTED: probable serine incorporator [Nelumbo nucifera]
Length=416

 Score =   100 bits (248),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+T+AVLRVSLGNF FF + +++MIG+K+Q D RD+ HHGGW++K++ W LL+I MFFVP
Sbjct  72   FQTNAVLRVSLGNFLFFVVFALVMIGVKDQNDKRDSWHHGGWILKIVVWVLLIILMFFVP  131

Query  517  NELISFYE  540
            N +I+ YE
Sbjct  132  NAIITIYE  139


 Score = 90.5 bits (223),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
             +V SGISRRSAR+AYCGLFG SLIVSWILREVAAPLME IPWIN +  TP +E
Sbjct  17   SSVASGISRRSARLAYCGLFGASLIVSWILREVAAPLMEKIPWINTYAHTPSKE  70



>gb|ABR16232.1| unknown [Picea sitchensis]
Length=407

 Score =   106 bits (264),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+T AVLRVSLGNF FFTI ++ MIGIK QKD RD  HHGGW++K+ICW LLV+ MFF+P
Sbjct  66   FQTSAVLRVSLGNFLFFTIFAVTMIGIKTQKDIRDGWHHGGWIVKIICWALLVVLMFFLP  125

Query  517  NELISFYE  540
            N +IS YE
Sbjct  126  NSVISVYE  133


 Score = 84.0 bits (206),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  191  ISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            ++RRSAR+AYCGLFG SLI++WILREVAAPLME IPWIN F  TP +E  +
Sbjct  17   VTRRSARLAYCGLFGFSLIIAWILREVAAPLMEKIPWINDFVHTPTKEWFQ  67



>gb|ABR17762.1| unknown [Picea sitchensis]
 gb|ABR17907.1| unknown [Picea sitchensis]
Length=417

 Score = 99.8 bits (247),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+TDAVLRVSLG+F FF + +++MIG+K+Q+D RD+ HHGGWM K++ W  LV+ MFFVP
Sbjct  75   FQTDAVLRVSLGSFLFFAVFALIMIGVKDQRDARDSWHHGGWMAKIMTWCTLVVLMFFVP  134

Query  517  NELISFYE  540
            N LI  YE
Sbjct  135  NGLIGIYE  142


 Score = 89.4 bits (220),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            ++V  GISRRSARIAYCGLF LSL V+WI RE+A PLME IPWIN+F +TP RE  + 
Sbjct  20   KSVAGGISRRSARIAYCGLFALSLFVAWIFREIAPPLMEKIPWINYFAETPSREWFQT  77



>ref|XP_008799134.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=416

 Score = 96.3 bits (238),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+TDAVLRVSLGNF FF I ++MMIG+K+Q D R + HHGGW+ K++ W +L+I MFF+P
Sbjct  75   FQTDAVLRVSLGNFLFFAIFALMMIGVKDQNDKRYSWHHGGWIAKIVVWAVLIILMFFLP  134

Query  517  NELISFYE  540
            N +I+ YE
Sbjct  135  NIVITIYE  142


 Score = 86.3 bits (212),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            +V S +SRRSAR+AYCGLF LSLI+SWILREVAAPL+E IPWIN F  TP +E
Sbjct  21   SVASSMSRRSARLAYCGLFALSLILSWILREVAAPLLEKIPWINTFSHTPSKE  73



>ref|XP_009391591.1| PREDICTED: serine incorporator 3 [Musa acuminata subsp. malaccensis]
Length=417

 Score = 97.8 bits (242),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+T+AVLRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW++K+I W LL++ MFF+P
Sbjct  75   FQTNAVLRVSLGNFLFFAIFALLMIGVKDQNDKRDSWHHGGWIVKIIIWALLIVLMFFLP  134

Query  517  NELISFYE  540
            N +I+ YE
Sbjct  135  NIVITIYE  142


 Score = 84.3 bits (207),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            +V +GISRRSAR+ YCGLF LSL++SWILREVAAPL+E IPWIN F   P +E  + 
Sbjct  21   SVAAGISRRSARLGYCGLFALSLVISWILREVAAPLLEKIPWINTFTHAPPKEWFQT  77



>gb|KJB28193.1| hypothetical protein B456_005G040500 [Gossypium raimondii]
Length=410

 Score = 94.7 bits (234),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LLVI MFF+P
Sbjct  70   YQEQAVLRVSLGNFLFFAILALIMIGVKDQNDRRDSWHHGGWTAKMVIWILLVILMFFLP  129

Query  517  NELISFYE  540
            N +I+ YE
Sbjct  130  NVVITVYE  137


 Score = 79.3 bits (194),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKT  322
            TV SGISR+SAR+AYCGLFGLSLIVSWILREV APL+E +PWI    +T
Sbjct  18   TVASGISRKSARLAYCGLFGLSLIVSWILREVGAPLLEKLPWIKSSTQT  66



>ref|XP_006419802.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
 ref|XP_006489289.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
 gb|ESR33042.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
Length=414

 Score = 97.1 bits (240),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVSLGNF FF ILS++MIGIK+Q D RD+ HHGGW  K+I W LLV+ MFF+P
Sbjct  73   YQIQAVLRVSLGNFLFFGILSLIMIGIKDQNDKRDSWHHGGWCAKIIIWALLVVLMFFLP  132

Query  517  NELISFYE  540
            N +IS YE
Sbjct  133  NVVISIYE  140


 Score = 76.6 bits (187),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
             +V SGIS++SAR+AYCGLFGLSLIVSWILREV  PL+E  PWIN
Sbjct  17   SSVASGISKKSARLAYCGLFGLSLIVSWILREVGTPLLEKFPWIN  61



>gb|KDO74827.1| hypothetical protein CISIN_1g039061mg [Citrus sinensis]
Length=399

 Score = 97.1 bits (240),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVSLGNF FF ILS++MIGIK+Q D RD+ HHGGW  K+I W LLV+ MFF+P
Sbjct  73   YQIQAVLRVSLGNFLFFGILSLIMIGIKDQNDKRDSWHHGGWCAKIIIWALLVVLMFFLP  132

Query  517  NELISFYE  540
            N +IS YE
Sbjct  133  NVVISIYE  140


 Score = 76.6 bits (187),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
             +V SGIS++SAR+AYCGLFGLSLIVSWILREV  PL+E  PWIN
Sbjct  17   SSVASGISKKSARLAYCGLFGLSLIVSWILREVGTPLLEKFPWIN  61



>ref|XP_001765634.1| predicted protein [Physcomitrella patens]
 gb|EDQ69473.1| predicted protein [Physcomitrella patens]
Length=415

 Score = 91.7 bits (226),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F T AVLRVSLGNF FF   +I+MIG+K+Q++ RD+ HHGGWM+K+I W + +I MFF+P
Sbjct  75   FATQAVLRVSLGNFLFFLAFAILMIGVKDQREQRDSWHHGGWMVKLILWCITIILMFFLP  134

Query  517  NELISFY  537
            N L+S Y
Sbjct  135  NGLVSAY  141


 Score = 81.6 bits (200),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            + V SGISRRSARIAYCGLF LSLIVSW+LR+ A PL+  IPWIN F  TP  E
Sbjct  20   QGVASGISRRSARIAYCGLFALSLIVSWLLRDFAGPLLAKIPWINTFTDTPSPE  73



>gb|KJB28194.1| hypothetical protein B456_005G040500 [Gossypium raimondii]
Length=291

 Score = 94.0 bits (232),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LLVI MFF+P
Sbjct  70   YQEQAVLRVSLGNFLFFAILALIMIGVKDQNDRRDSWHHGGWTAKMVIWILLVILMFFLP  129

Query  517  NELISFYE  540
            N +I+ YE
Sbjct  130  NVVITVYE  137


 Score = 78.6 bits (192),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKT  322
            TV SGISR+SAR+AYCGLFGLSLIVSWILREV APL+E +PWI    +T
Sbjct  18   TVASGISRKSARLAYCGLFGLSLIVSWILREVGAPLLEKLPWIKSSTQT  66



>ref|XP_009129653.1| PREDICTED: probable serine incorporator [Brassica rapa]
Length=408

 Score = 97.1 bits (240),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVP
Sbjct  71   YQQQAVLRVSFGNFLFFAIYALVMIGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVP  130

Query  517  NELISFY  537
            NE+IS Y
Sbjct  131  NEIISIY  137


 Score = 74.7 bits (182),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGISR+SARIAYCGLFG SL+VSWILRE AAPL+E + WIN
Sbjct  18   SVASGISRKSARIAYCGLFGASLVVSWILRETAAPLLEKLSWIN  61



>emb|CDY24707.1| BnaA05g31060D [Brassica napus]
Length=408

 Score = 97.1 bits (240),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVP
Sbjct  71   YQQQAVLRVSFGNFLFFAIYALVMIGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVP  130

Query  517  NELISFY  537
            NE+IS Y
Sbjct  131  NEIISIY  137


 Score = 74.7 bits (182),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGISR+SARIAYCGLFG SL+VSWILRE AAPL+E + WIN
Sbjct  18   SVASGISRKSARIAYCGLFGASLVVSWILRETAAPLLEKLSWIN  61



>ref|XP_008223013.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=411

 Score = 92.8 bits (229),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  307  SFPQNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWF  486
            S  Q    G ++ DAVLRVSLGNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W 
Sbjct  61   SSSQTHTKGWYQIDAVLRVSLGNFLFFVTFALLMIGVKDQNDRRDSWHHGGWIAKMVVWL  120

Query  487  LLVIFMFFVPNELISFY  537
            LLVI MFF+P+ +I+ Y
Sbjct  121  LLVILMFFLPDIVITIY  137


 Score = 78.6 bits (192),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGISR+SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+
Sbjct  18   SVASGISRKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWIS  61



>ref|XP_007034589.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
 gb|EOY05515.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
Length=410

 Score = 91.7 bits (226),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGN  FF IL+++MIG+K+Q D RD+ HHGGW+ K++ W LLVI MFF+P
Sbjct  70   FQQQAVLRVSLGNCLFFAILALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLVILMFFLP  129

Query  517  NELISFY  537
            N +I+ Y
Sbjct  130  NVVITVY  136


 Score = 79.3 bits (194),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
             +V SGIS++SAR+AYCGLFGLSL+VSWILREVAAPL+E +PWIN
Sbjct  17   SSVASGISKKSARLAYCGLFGLSLVVSWILREVAAPLLEKLPWIN  61



>emb|CDY05246.1| BnaC05g45570D [Brassica napus]
Length=408

 Score = 93.6 bits (231),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVP
Sbjct  71   YQQQAVLRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVP  130

Query  517  NELISFY  537
            N +IS Y
Sbjct  131  NVIISVY  137


 Score = 77.4 bits (189),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGISR+SARIAYCGLFG SL+VSWILRE AAPL+E  PWIN
Sbjct  18   SVASGISRKSARIAYCGLFGASLVVSWILRETAAPLLEKFPWIN  61



>emb|CDO98987.1| unnamed protein product [Coffea canephora]
Length=410

 Score = 93.2 bits (230),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGW +K++ W LLVI MFF+P
Sbjct  71   FQIQAVLRVSLGNFLFFGVLALLMIGVKDQNDRRDSWHHGGWTVKMVIWALLVILMFFIP  130

Query  517  NELISFY  537
            N +I+ Y
Sbjct  131  NVVITIY  137


 Score = 77.8 bits (190),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 4/59 (7%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQMQ  352
            +V SGIS++SAR+AYCGLFGLSLI+SWILREV APL+E  PWIN    T D +  +  Q
Sbjct  18   SVASGISKKSARLAYCGLFGLSLIISWILREVGAPLLEKFPWIN----TSDDQSKEWFQ  72



>ref|NP_187268.2| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAZ23918.1| At3g06170 [Arabidopsis thaliana]
 gb|AEE74356.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=409

 Score = 94.0 bits (232),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVP
Sbjct  72   YQQQAVLRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVP  131

Query  517  NELISFY  537
            N ++S Y
Sbjct  132  NVIVSLY  138


 Score = 76.3 bits (186),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
             +V SGISR+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN
Sbjct  18   SSVASGISRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWIN  62



>ref|XP_006297798.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
 gb|EOA30696.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
Length=410

 Score = 93.6 bits (231),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVP
Sbjct  72   YQQQAVLRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVP  131

Query  517  NELISFY  537
            N ++S Y
Sbjct  132  NVIVSIY  138


 Score = 76.3 bits (186),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
             +V SGISR+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN
Sbjct  18   SSVASGISRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWIN  62



>ref|XP_002882452.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58711.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score = 94.4 bits (233),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVP
Sbjct  72   YQQQAVLRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIAWFLLVVLMFFVP  131

Query  517  NELISFY  537
            N ++S Y
Sbjct  132  NVIVSIY  138


 Score = 75.5 bits (184),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
             +V SGI+R+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN
Sbjct  18   SSVASGITRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWIN  62



>ref|XP_002280143.1| PREDICTED: serine incorporator 3 [Vitis vinifera]
 emb|CBI26177.3| unnamed protein product [Vitis vinifera]
Length=411

 Score = 93.6 bits (231),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++ +AVLRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW+ K++ W LL+I MFFVP
Sbjct  71   YQQEAVLRVSLGNFLFFAIFALIMIGVKDQNDRRDSWHHGGWVAKMVIWVLLIILMFFVP  130

Query  517  NELISFY  537
            N +IS Y
Sbjct  131  NVVISIY  137


 Score = 76.3 bits (186),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
             +V SGIS+RSAR+AYCGLFG SLIVSWILREVAAPL++ IPWI+   +T   E  +Q
Sbjct  17   SSVASGISKRSARLAYCGLFGGSLIVSWILREVAAPLLKKIPWIST-SQTHSTEWYQQ  73



>ref|XP_010693925.1| PREDICTED: serine incorporator 3 [Beta vulgaris subsp. vulgaris]
Length=410

 Score = 93.6 bits (231),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++T  VLRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGWM+K+I W LL++ MFF+P
Sbjct  70   YQTSTVLRVSLGNFLFFAVLALIMIGVKDQNDKRDSWHHGGWMVKMIIWILLIVLMFFMP  129

Query  517  NELISFY  537
            N ++  Y
Sbjct  130  NVVVDIY  136


 Score = 76.3 bits (186),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPD  328
            +V SGI+ +SARIAYCGLFG SL+VSWILREVA+PL+E  PWIN+   T +
Sbjct  18   SVASGITNKSARIAYCGLFGASLVVSWILREVASPLLEKFPWINNADHTKE  68



>ref|XP_002979274.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
 gb|EFJ19682.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
Length=376

 Score = 90.9 bits (224),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +1

Query  307  SFPQNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWF  486
            SF        F T AVLRVSLGNF FF   +I+MIG+KNQ D RD+ HHGGWM K+I W 
Sbjct  65   SFAHTPNKEWFGTQAVLRVSLGNFLFFLAFAIVMIGVKNQSDQRDSWHHGGWMAKLILWL  124

Query  487  LLVIFMFFVPNELISFY  537
             +++ MFF+PN L+  Y
Sbjct  125  TVMVLMFFLPNGLVDAY  141


 Score = 79.0 bits (193),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            + V  GISRRSARIAYCGLF LSL+++WILR+   P++E IPWIN F  TP++E
Sbjct  20   KGVAGGISRRSARIAYCGLFTLSLLLAWILRDFGYPVLEKIPWINSFAHTPNKE  73



>ref|XP_002988580.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
 gb|EFJ10376.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
Length=371

 Score = 90.9 bits (224),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +1

Query  307  SFPQNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWF  486
            SF        F T AVLRVSLGNF FF   +I+MIG+KNQ D RD+ HHGGWM K+I W 
Sbjct  65   SFAHTPNKEWFGTQAVLRVSLGNFLFFLAFAIVMIGVKNQSDQRDSWHHGGWMAKLILWL  124

Query  487  LLVIFMFFVPNELISFY  537
             +++ MFF+PN L+  Y
Sbjct  125  TVMVLMFFLPNGLVDAY  141


 Score = 78.6 bits (192),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            + V  GISRRSARIAYCGLF LSL+++WILR+   P++E IPWIN F  TP++E
Sbjct  20   KGVAGGISRRSARIAYCGLFTLSLLLAWILRDFGYPVLEKIPWINSFAHTPNKE  73



>ref|XP_006407970.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49423.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=406

 Score = 92.4 bits (228),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVS GNF FF I +++M+G+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVP
Sbjct  71   YQQQAVLRVSFGNFLFFAIYALIMVGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVP  130

Query  517  NELISFY  537
            N ++S Y
Sbjct  131  NVVVSIY  137


 Score = 76.6 bits (187),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            +V SGISR+SARIAYCGLFG SL+VSWILRE  APL+E  PWIN    T  +E  +Q
Sbjct  18   SVASGISRKSARIAYCGLFGASLVVSWILRETGAPLLEKFPWINT-SDTYTKEWYQQ  73



>gb|KDP40096.1| hypothetical protein JCGZ_02094 [Jatropha curcas]
Length=401

 Score = 93.2 bits (230),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P
Sbjct  61   FQIQAVLRVSLGNFLFFAIFALIMIGVKDQNDKRDSWHHGGWIAKMVIWLLLVVLMFFMP  120

Query  517  NELISFY  537
            N +IS Y
Sbjct  121  NVIISIY  127


 Score = 75.9 bits (185),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
             +V SGIS++SAR+ YCGLFGLSLIVSWILREV APL++ +PWIN
Sbjct  7    SSVASGISKKSARLGYCGLFGLSLIVSWILREVGAPLLKKLPWIN  51



>ref|XP_010103434.1| putative serine incorporator [Morus notabilis]
 gb|EXB95837.1| putative serine incorporator [Morus notabilis]
Length=409

 Score = 93.2 bits (230),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW+ K++ W +LV+ MFF+P
Sbjct  71   YQIQAVLRVSLGNFLFFAIFALIMIGVKDQNDRRDSWHHGGWIAKMVIWLVLVVLMFFIP  130

Query  517  NELISFY  537
            + +ISFY
Sbjct  131  DAVISFY  137


 Score = 75.1 bits (183),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGIS++SARIAYCGLFG+SL+VSWILREV APL+E  PWI+
Sbjct  18   SVASGISKKSARIAYCGLFGVSLVVSWILREVGAPLLEKFPWIS  61



>gb|AFK46909.1| unknown [Lotus japonicus]
Length=353

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            FETDAVLRVSLGNF FFTIL+++M+G+KNQKDPRD LHHGGWMMK+ICWFLLVIFMFF+P
Sbjct  19   FETDAVLRVSLGNFLFFTILAVLMVGVKNQKDPRDGLHHGGWMMKIICWFLLVIFMFFLP  78

Query  517  NELISFYE  540
            NE+ISFYE
Sbjct  79   NEIISFYE  86



>ref|XP_008340909.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=409

 Score = 90.9 bits (224),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++T AVLRVS+GNF FFT  +++MIG+K+Q D RD+ HHGGW+ K++ W LLVI MFF+P
Sbjct  71   YQTQAVLRVSMGNFLFFTAFALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLVILMFFMP  130

Query  517  NELISFY  537
            + +I+ Y
Sbjct  131  DIVITIY  137


 Score = 77.4 bits (189),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGIS RSAR+AYCGLFGLSLIVSWILREVAAPL++ IPWI+
Sbjct  18   SVASGISNRSARLAYCGLFGLSLIVSWILREVAAPLLKKIPWIS  61



>ref|XP_010464184.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=409

 Score = 92.4 bits (228),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV  MFFVP
Sbjct  72   YQQQAVLRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVALMFFVP  131

Query  517  NELISFY  537
            N ++S Y
Sbjct  132  NVIVSIY  138


 Score = 75.5 bits (184),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGI+R+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN
Sbjct  19   SVASGITRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWIN  62



>ref|XP_010436570.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score = 92.4 bits (228),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV  MFFVP
Sbjct  72   YQQQAVLRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVALMFFVP  131

Query  517  NELISFY  537
            N ++S Y
Sbjct  132  NVIVSIY  138


 Score = 75.5 bits (184),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGI+R+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN
Sbjct  19   SVASGITRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWIN  62



>ref|XP_010486107.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score = 92.4 bits (228),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  +VLRVS GNF FF I +++MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVP
Sbjct  72   YQQQSVLRVSFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVP  131

Query  517  NELISFY  537
            N ++S Y
Sbjct  132  NVIVSIY  138


 Score = 75.5 bits (184),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGI+R+SARIAYCGLFG SL+VSWILRE  APL+E +PWIN
Sbjct  19   SVASGITRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWIN  62



>ref|XP_010546829.1| PREDICTED: serine incorporator 3 isoform X1 [Tarenaya hassleriana]
Length=410

 Score = 92.4 bits (228),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVS GNF FF + +++MIG+K+Q D RD+ HHGGW++K+I WFLLV  MFFVP
Sbjct  71   YQQQAVLRVSFGNFLFFALFALIMIGVKDQNDRRDSWHHGGWVVKMIVWFLLVTLMFFVP  130

Query  517  NELISFY  537
            N ++S Y
Sbjct  131  NVIVSIY  137


 Score = 74.7 bits (182),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGISR+SAR+AYCGLFG SL+VSWILRE AAPL++  PWIN
Sbjct  18   SVASGISRKSARLAYCGLFGASLVVSWILREFAAPLLKKFPWIN  61



>ref|XP_010546830.1| PREDICTED: serine incorporator 3 isoform X2 [Tarenaya hassleriana]
Length=409

 Score = 92.4 bits (228),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVS GNF FF + +++MIG+K+Q D RD+ HHGGW++K+I WFLLV  MFFVP
Sbjct  71   YQQQAVLRVSFGNFLFFALFALIMIGVKDQNDRRDSWHHGGWVVKMIVWFLLVTLMFFVP  130

Query  517  NELISFY  537
            N ++S Y
Sbjct  131  NVIVSIY  137


 Score = 74.7 bits (182),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGISR+SAR+AYCGLFG SL+VSWILRE AAPL++  PWIN
Sbjct  18   SVASGISRKSARLAYCGLFGASLVVSWILREFAAPLLKKFPWIN  61



>ref|XP_010938752.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=416

 Score = 97.4 bits (241),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+TDAVLRVSLG+F FF I ++MMIG+K+Q D RD+ HHGGW+ K++ W +L++ MFF+P
Sbjct  75   FQTDAVLRVSLGSFLFFAIFALMMIGVKDQNDKRDSWHHGGWIAKIVIWVVLIVLMFFLP  134

Query  517  NELISFYE  540
            N +I+ YE
Sbjct  135  NIVITIYE  142


 Score = 69.3 bits (168),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  212  IAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            +AYCG F LSLI++WILREVAAPL+E IPWIN F  TP +E  +
Sbjct  33   LAYCGFFALSLILAWILREVAAPLLEKIPWINTFTHTPSKEWFQ  76



>ref|XP_010322266.1| PREDICTED: serine incorporator 3 [Solanum lycopersicum]
Length=411

 Score = 93.6 bits (231),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGNF FF +L+++MIGIK+Q D RD LHHGGW+ K++ W LLV  MFF+P
Sbjct  71   FQAQAVLRVSLGNFLFFGVLALIMIGIKDQNDRRDCLHHGGWVAKLVIWVLLVALMFFLP  130

Query  517  NELISFY  537
            N +I+ Y
Sbjct  131  NGVITIY  137


 Score = 71.6 bits (174),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SG++R SAR+AYCGLFG+SLIVSW++REVA+PL++N  WIN
Sbjct  18   SVASGVTRSSARLAYCGLFGVSLIVSWVIREVASPLLKNFSWIN  61



>ref|XP_006356686.1| PREDICTED: serine incorporator 3-like [Solanum tuberosum]
Length=409

 Score = 92.4 bits (228),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGNF FF +L+++MIGIK+Q D RD+ HHGGW+ K++ W LLV  MFF+P
Sbjct  71   FQAQAVLRVSLGNFLFFGVLALIMIGIKDQNDRRDSWHHGGWVAKLVIWVLLVALMFFLP  130

Query  517  NELISFY  537
            N +I+ Y
Sbjct  131  NGVITIY  137


 Score = 72.8 bits (177),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SG++R SAR+AYCGLFG+SLIVSW+LREVA+PL++N  WIN
Sbjct  18   SVASGVTRSSARLAYCGLFGVSLIVSWVLREVASPLLKNFSWIN  61



>ref|XP_007222705.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
 gb|EMJ23904.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
Length=411

 Score = 88.6 bits (218),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++ +AVLRVSLGNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLVI MFF+P
Sbjct  71   YQIEAVLRVSLGNFLFFVTFALIMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVILMFFLP  130

Query  517  NELISFY  537
            + +I+ Y
Sbjct  131  DIVITIY  137


 Score = 75.9 bits (185),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            +V +GISR+SAR+AYCGLFGLSLIVSWILREV APL++ IPWI+   +T  +E
Sbjct  18   SVAAGISRKSARLAYCGLFGLSLIVSWILREVGAPLLKKIPWISS-SQTHTKE  69



>ref|XP_004150322.1| PREDICTED: serine incorporator 3-like [Cucumis sativus]
 gb|KGN47263.1| hypothetical protein Csa_6G238640 [Cucumis sativus]
Length=411

 Score = 92.8 bits (229),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGNF FF IL+++MIG+K+Q D RD  HHGGWM K++ W LLV+ MFF+P
Sbjct  70   FQMQAVLRVSLGNFLFFAILALIMIGVKDQNDRRDAWHHGGWMAKMVIWILLVVLMFFLP  129

Query  517  NELISFY  537
            N + S Y
Sbjct  130  NVIFSIY  136


 Score = 71.6 bits (174),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
             +V +GISR SAR+AYCGLFG+SL+VSWILRE  AP+ME +PWI 
Sbjct  17   SSVAAGISRSSARLAYCGLFGVSLVVSWILREFGAPIMEKMPWIK  61



>ref|XP_010237604.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
 ref|XP_010237605.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=418

 Score = 90.5 bits (223),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+ + VLRVSLGNF FF I ++MMIG+K+Q D RD  HHGGW+ K+  W +L++ MFFVP
Sbjct  75   FQMNVVLRVSLGNFLFFGIFALMMIGVKDQNDRRDAWHHGGWIAKIAVWVVLIVLMFFVP  134

Query  517  NELISFYE  540
            N +I+ YE
Sbjct  135  NIVITVYE  142


 Score = 73.6 bits (179),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            +  S I+RRSAR+AYCGLF  SLI+S++LR+ AAPL+++IPWIN F +TP  E  + 
Sbjct  21   SAASSITRRSARLAYCGLFAASLILSFLLRQFAAPLLQHIPWINTFDETPPEEWFQM  77



>ref|XP_004169518.1| PREDICTED: LOW QUALITY PROTEIN: serine incorporator 3-like [Cucumis 
sativus]
Length=411

 Score = 92.4 bits (228),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGNF FF IL+++MIG+K+Q D RD  HHGGWM K++ W LLV+ MFF P
Sbjct  70   FQMQAVLRVSLGNFLFFAILALIMIGVKDQNDRRDAWHHGGWMAKMVIWILLVVLMFFXP  129

Query  517  NELISFY  537
            N + S Y
Sbjct  130  NVIFSIY  136


 Score = 71.6 bits (174),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
             +V +GISR SAR+AYCGLFG+SL+VSWILRE  AP+ME +PWI 
Sbjct  17   SSVAAGISRSSARLAYCGLFGVSLVVSWILREFGAPIMEKMPWIK  61



>ref|XP_008458551.1| PREDICTED: serine incorporator 3 [Cucumis melo]
Length=411

 Score = 90.9 bits (224),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGNF FF IL+++MIG+K+Q D RD  HHGGWM K++ W L V+ MFF+P
Sbjct  70   FQMQAVLRVSLGNFLFFAILALIMIGVKDQNDRRDAWHHGGWMAKMVIWILFVVLMFFLP  129

Query  517  NELISFY  537
            N + S Y
Sbjct  130  NVIFSIY  136


 Score = 72.8 bits (177),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
             +V +GISR SAR+AYCGLFG+SL+VSWILRE  APLME +PWI 
Sbjct  17   SSVAAGISRSSARLAYCGLFGVSLVVSWILREFGAPLMEKMPWIE  61



>ref|XP_011090806.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=411

 Score = 88.6 bits (218),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGNF FF IL+++MIG+K+Q D RD+ HH GW+ K++ W LL+I MFF+P
Sbjct  71   FQIQAVLRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHDGWIAKMLIWALLIILMFFLP  130

Query  517  NELISFY  537
            N +I+ Y
Sbjct  131  NVIITVY  137


 Score = 74.7 bits (182),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGI++RSARIAYCGLFG+SLIVSWILREVAAPL+++  WIN
Sbjct  18   SVASGITKRSARIAYCGLFGVSLIVSWILREVAAPLLKHFSWIN  61



>ref|XP_010687311.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687312.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
Length=413

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  310  FPQNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFL  489
            F Q      F+TDAVLRVSLGNF FFTIL+++MIG+KNQKDPRDNLHHGGWMMK+ICW L
Sbjct  66   FQQTPDKEWFQTDAVLRVSLGNFLFFTILAVLMIGVKNQKDPRDNLHHGGWMMKIICWCL  125

Query  490  LVIFMFFVPNELISFYE  540
            LVI MFF+PNE+IS YE
Sbjct  126  LVILMFFLPNEMISLYE  142


 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            RTVVSGISR+SARIAYCGLF LSLIV+WILREVAAPLME IPWIN+F +TPD+E  +
Sbjct  20   RTVVSGISRKSARIAYCGLFALSLIVAWILREVAAPLMEKIPWINYFQQTPDKEWFQ  76



>ref|XP_009623079.1| PREDICTED: probable serine incorporator [Nicotiana tomentosiformis]
Length=408

 Score = 92.4 bits (228),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGW+ K++ W LLV  MFF+P
Sbjct  71   FQAQAVLRVSLGNFLFFGLLALIMIGVKDQNDKRDSWHHGGWVAKLVIWMLLVALMFFLP  130

Query  517  NELISFYE  540
            N +I+ Y 
Sbjct  131  NGVITVYS  138


 Score = 70.5 bits (171),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SG++R SAR+AYC LFG+SLIVSW+LREVA+PL++N  WIN
Sbjct  18   SVASGVTRSSARLAYCALFGVSLIVSWVLREVASPLLKNFSWIN  61



>ref|XP_009799680.1| PREDICTED: probable serine incorporator [Nicotiana sylvestris]
Length=408

 Score = 92.0 bits (227),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGW+ K++ W LLV  MFF+P
Sbjct  71   FQAQAVLRVSLGNFLFFGLLALIMIGVKDQNDKRDSWHHGGWVAKLVIWVLLVALMFFLP  130

Query  517  NELISFYE  540
            N +I+ Y 
Sbjct  131  NGVITVYS  138


 Score = 70.5 bits (171),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SG++R SAR+AYC LFG+SLIVSW+LREVA+PL++N  WIN
Sbjct  18   SVASGVTRSSARLAYCALFGVSLIVSWVLREVASPLLKNFSWIN  61



>ref|XP_004982576.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=415

 Score = 90.5 bits (223),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+ +AVLRVSLGNF FF I +IMMIGIK+Q D RD  HHGGW+ K+  W +L++ MF VP
Sbjct  75   FQMNAVLRVSLGNFLFFAIFAIMMIGIKDQNDRRDAWHHGGWVAKIAVWAVLIVLMFCVP  134

Query  517  NELISFYE  540
            N + + YE
Sbjct  135  NIVTTIYE  142


 Score = 70.9 bits (172),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            +  S +SRRSAR+AYCGLF  SLI+S++LR+ A PL+++IPWIN F  TP  E  + 
Sbjct  21   SAASAVSRRSARLAYCGLFAASLILSFLLRQFATPLLKHIPWINAFEHTPPDEWFQM  77



>ref|XP_010024424.1| PREDICTED: serine incorporator 3 [Eucalyptus grandis]
 gb|KCW60868.1| hypothetical protein EUGRSUZ_H03603 [Eucalyptus grandis]
Length=416

 Score = 83.2 bits (204),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGNF FF IL+++MIG+K+Q D RD++ HGGW+ K+I W LLV+ MFF+P
Sbjct  70   FQMQAVLRVSLGNFLFFGILALIMIGVKDQNDKRDSMQHGGWIAKMIIWLLLVVLMFFLP  129

Query  517  NELISFYE  540
            NE+I+ YE
Sbjct  130  NEVITIYE  137


 Score = 77.0 bits (188),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
             +V  GIS+RSAR+AYCGLFGLSLIVSW+LREVAAPL+E I WIN
Sbjct  17   SSVAGGISKRSARLAYCGLFGLSLIVSWVLREVAAPLLEKISWIN  61



>gb|KCW60869.1| hypothetical protein EUGRSUZ_H03603 [Eucalyptus grandis]
Length=383

 Score = 82.8 bits (203),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGNF FF IL+++MIG+K+Q D RD++ HGGW+ K+I W LLV+ MFF+P
Sbjct  70   FQMQAVLRVSLGNFLFFGILALIMIGVKDQNDKRDSMQHGGWIAKMIIWLLLVVLMFFLP  129

Query  517  NELISFYE  540
            NE+I+ YE
Sbjct  130  NEVITIYE  137


 Score = 76.6 bits (187),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
             +V  GIS+RSAR+AYCGLFGLSLIVSW+LREVAAPL+E I WIN
Sbjct  17   SSVAGGISKRSARLAYCGLFGLSLIVSWVLREVAAPLLEKISWIN  61



>ref|XP_002516786.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF45400.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=414

 Score = 84.0 bits (206),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGNF FF I +++MIG+K+Q D RD+ HHGGW+ K++ W LL++ MFF+P
Sbjct  74   FQIQAVLRVSLGNFLFFAIFALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLLVLMFFMP  133

Query  517  NELISFY  537
            N +I+ Y
Sbjct  134  NVVIAIY  140


 Score = 73.9 bits (180),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGIS++SAR+AYCGLFGLSLIVSWILRE  APL+E +PWI 
Sbjct  21   SVASGISKKSARLAYCGLFGLSLIVSWILREFGAPLIEKLPWIK  64



>gb|EYU43840.1| hypothetical protein MIMGU_mgv1a006662mg [Erythranthe guttata]
Length=436

 Score = 87.8 bits (216),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVSLGNF FF IL+++MIGIK Q D RD  HH GW++K++ W  L+I MFF+P
Sbjct  96   YQMQAVLRVSLGNFLFFAILAVIMIGIKYQNDKRDFFHHEGWIVKIVIWTTLIILMFFLP  155

Query  517  NELISFY  537
            N +IS Y
Sbjct  156  NAVISVY  162


 Score = 69.3 bits (168),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGI++RSARI YCGLFG+SLIVSWILRE A P+++++ WIN
Sbjct  43   SVASGITKRSARIGYCGLFGVSLIVSWILREFAQPVLKHLSWIN  86



>gb|EPS68630.1| hypothetical protein M569_06136 [Genlisea aurea]
Length=410

 Score = 89.4 bits (220),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+  AVLRVSLGNF FF +L++ MIG+K+Q D RD+LH GGW+ K + W LL++ MFFVP
Sbjct  71   FQVQAVLRVSLGNFLFFAVLALTMIGVKHQNDKRDSLHRGGWIAKFLIWALLIVLMFFVP  130

Query  517  NELISFY  537
            N + + Y
Sbjct  131  NAVTNIY  137


 Score = 67.0 bits (162),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDR  331
            +V SGI+ RSARI YCGLFG SLIVSW+LREV  P++ ++ WIN     P  
Sbjct  18   SVASGITNRSARIGYCGLFGASLIVSWVLREVGEPILRHLSWINTSDHLPKE  69



>ref|XP_006650244.1| PREDICTED: probable serine incorporator-like [Oryza brachyantha]
Length=417

 Score = 91.7 bits (226),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+ +AVLRVSLGNF FF I ++MMIG+K+Q D RD  HHGGW+ K++ W +L + MF VP
Sbjct  75   FQMNAVLRVSLGNFLFFAIFALMMIGVKDQNDQRDAWHHGGWIAKIVVWAVLTVLMFCVP  134

Query  517  NELISFYE  540
            N +I+ YE
Sbjct  135  NIVITIYE  142


 Score = 64.3 bits (155),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHF-HKTPDR  331
            +  S ISRRSAR+AYCGLF  SL++S++ R+ A PL++ IPWIN F +  PD 
Sbjct  21   SAASAISRRSARLAYCGLFAASLVLSFLTRQFATPLLKQIPWINTFDYVQPDE  73



>ref|XP_004486156.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=409

 Score = 85.5 bits (210),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVSLGNF FF +L+++MIG+K+Q D RD+ HHGGW +K + W LL++  FF+P
Sbjct  71   YQVQAVLRVSLGNFLFFVVLALIMIGVKDQNDRRDSWHHGGWTVKTVIWLLLIVLAFFIP  130

Query  517  NELISFY  537
            + +   Y
Sbjct  131  DAVTLAY  137


 Score = 70.1 bits (170),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGIS++SARI YC LFG SLI+SWILREV APL+E +PWI+
Sbjct  18   SVASGISQKSARIGYCFLFGASLIISWILREVGAPLLEKLPWID  61



>ref|XP_010929191.1| PREDICTED: probable serine incorporator isoform X2 [Elaeis guineensis]
Length=415

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +1

Query  310  FPQNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFL  489
            F Q      FETDAVLRVSLGNF FFTIL+++M+GIK+QKDPRD LHHGGWM K++CW +
Sbjct  66   FHQTPDREWFETDAVLRVSLGNFLFFTILAVLMVGIKDQKDPRDRLHHGGWMAKIVCWCV  125

Query  490  LVIFMFFVPNELISFYE  540
            LVI MFFVPN L+SFYE
Sbjct  126  LVILMFFVPNGLVSFYE  142


 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            R+VV GISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFH+TPDRE  +
Sbjct  20   RSVVGGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHQTPDREWFE  76



>gb|ACJ84561.1| unknown [Medicago truncatula]
 gb|AFK35204.1| unknown [Medicago truncatula]
 gb|KEH36756.1| TMS membrane protein/tumor differentially protein [Medicago truncatula]
Length=409

 Score = 82.4 bits (202),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVL VSLGN  FF +L+++MIG+K+Q D RD+ HHGGW +K++ W LL++  FF+P
Sbjct  71   YQVQAVLHVSLGNCLFFVVLALIMIGVKDQNDKRDSWHHGGWTVKIVIWLLLIVLAFFIP  130

Query  517  NELISFY  537
            + ++  Y
Sbjct  131  DSIMLAY  137


 Score = 71.2 bits (173),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGIS++SARI YC LFG SLIVSWILREV APL+E IPWI+
Sbjct  18   SVASGISQKSARIGYCFLFGASLIVSWILREVGAPLLEKIPWID  61



>ref|XP_002312742.1| TMS membrane family protein [Populus trichocarpa]
 gb|EEE90109.1| TMS membrane family protein [Populus trichocarpa]
Length=417

 Score = 76.6 bits (187),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVS+GNF FF +L+++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P
Sbjct  75   YQIQAVLRVSMGNFLFFAVLALIMIGVKDQNDRRDSWHHGGWIAKMVIWLLLVVLMFFLP  134

Query  517  NELISFY  537
            + +IS Y
Sbjct  135  DSVISVY  141


 Score = 75.9 bits (185),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDR  331
            +V SGIS RSAR+AYCGLFG SLI+SWILREVAAPL+E IPWI      P  
Sbjct  22   SVASGISNRSARLAYCGLFGTSLILSWILREVAAPLLEKIPWIKSSGTHPKE  73



>ref|XP_009365799.1| PREDICTED: probable serine incorporator isoform X1 [Pyrus x bretschneideri]
Length=411

 Score = 76.6 bits (187),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGIS +SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+
Sbjct  18   SVASGISSKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWIS  61


 Score = 75.5 bits (184),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++T+AVLRVS+GNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P
Sbjct  71   YQTEAVLRVSMGNFLFFAAFALVMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMP  130

Query  517  NELISFY  537
            + +I+ Y
Sbjct  131  DIVITIY  137



>ref|XP_008790112.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
 ref|XP_008778863.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
Length=415

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 80/122 (66%), Gaps = 4/122 (3%)
 Frame = +1

Query  178  GGVRDQPPLRSYCILWSFWAVADCFMDSSRSCCSSHGE-YPMD*SFPQNTR*GMFETDAV  354
            GG+  +    +YC L++F  +    +   R   +   E  P    F Q      FETDAV
Sbjct  24   GGISRRSSRIAYCGLFAFSLIVSWIL---REVAAPFMEKLPWINHFHQTPDREWFETDAV  80

Query  355  LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF  534
            LRVSLGNF FFTIL+++M+GIK+QKDPRD LHHGGWM K++ WF+LVI MFFVPN L+S 
Sbjct  81   LRVSLGNFLFFTILALVMVGIKDQKDPRDRLHHGGWMAKIVGWFVLVILMFFVPNGLVSS  140

Query  535  YE  540
            YE
Sbjct  141  YE  142


 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLK  343
            R+VV GISRRS+RIAYCGLF  SLIVSWILREVAAP ME +PWINHFH+TPDRE  +
Sbjct  20   RSVVGGISRRSSRIAYCGLFAFSLIVSWILREVAAPFMEKLPWINHFHQTPDREWFE  76



>ref|XP_009342179.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=411

 Score = 76.6 bits (187),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGIS +SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+
Sbjct  18   SVASGISSKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWIS  61


 Score = 75.5 bits (184),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++T+AVLRVS+GNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P
Sbjct  71   YQTEAVLRVSMGNFLFFAAFALVMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMP  130

Query  517  NELISFY  537
            + +I+ Y
Sbjct  131  DIVITIY  137



>ref|XP_009365800.1| PREDICTED: probable serine incorporator isoform X2 [Pyrus x bretschneideri]
Length=409

 Score = 76.6 bits (187),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGIS +SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+
Sbjct  18   SVASGISSKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWIS  61


 Score = 75.5 bits (184),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++T+AVLRVS+GNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P
Sbjct  71   YQTEAVLRVSMGNFLFFAAFALVMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMP  130

Query  517  NELISFY  537
            + +I+ Y
Sbjct  131  DIVITIY  137



>ref|XP_008390818.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=411

 Score = 76.3 bits (186),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGIS +SAR+AYCGLFGLSLIVSWILREV APL+E IPWI+
Sbjct  18   SVASGISSKSARLAYCGLFGLSLIVSWILREVGAPLLEKIPWIS  61


 Score = 75.5 bits (184),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++T+AVLRVS+GNF FF   +++MIG+K+Q D RD+ HHGGW+ K++ W LLV+ MFF+P
Sbjct  71   YQTEAVLRVSMGNFLFFAAFALIMIGVKDQNDRRDSWHHGGWIAKMVVWLLLVVLMFFMP  130

Query  517  NELISFY  537
            + +I+ Y
Sbjct  131  DIVITIY  137



>ref|XP_011010290.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=417

 Score = 75.5 bits (184),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDR  331
            +V SGIS RSAR+AYCGLFG SLI+SWILREVAAPL+E IPWI      P  
Sbjct  22   SVASGISNRSARLAYCGLFGASLILSWILREVAAPLLEKIPWIKSSGTHPKE  73


 Score = 75.5 bits (184),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVS+GNF FF IL+++MIG+K++ D RD+ HHGGW+ K++ W LLV+ MFF+P
Sbjct  75   YQIQAVLRVSMGNFLFFAILALIMIGVKDKNDRRDSWHHGGWIAKMVIWLLLVVLMFFLP  134

Query  517  NELISFY  537
            + +IS Y
Sbjct  135  DSVISVY  141



>ref|XP_004296950.1| PREDICTED: probable serine incorporator [Fragaria vesca subsp. 
vesca]
Length=409

 Score = 75.5 bits (184),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++T AVLRVS+GNF FF IL+++MIG+K++ D RD  HHGGW+ K++ W LL+I MFF+P
Sbjct  71   YQTQAVLRVSMGNFLFFAILALIMIGVKDRNDRRDGWHHGGWIAKMVIWLLLIILMFFLP  130

Query  517  NELISFY  537
            + +I+ Y
Sbjct  131  DIVITIY  137


 Score = 73.6 bits (179),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGIS +SAR+ YCGLFGLSL+V+WILREV APL+E IPWI+
Sbjct  18   SVASGISSKSARLGYCGLFGLSLVVTWILREVGAPLLEKIPWIS  61



>ref|XP_010268463.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=414

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +1

Query  310  FPQNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFL  489
            F Q      FETDAVLRVSLGNF FFTIL+I+MIG+K+QKDPRD LHHGGWM K++CW +
Sbjct  66   FHQTPNREWFETDAVLRVSLGNFLFFTILAILMIGVKDQKDPRDRLHHGGWMTKIVCWCI  125

Query  490  LVIFMFFVPNELISFYE  540
            LV  MFF+PN ++S YE
Sbjct  126  LVFIMFFLPNAIVSSYE  142


 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  173  RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            R+V S ISRRSARIAYCGLF LSLIVSWILREVAAPLME IPWINHFH+TP+RE  + 
Sbjct  20   RSVASSISRRSARIAYCGLFALSLIVSWILREVAAPLMEKIPWINHFHQTPNREWFET  77



>ref|NP_001050476.1| Os03g0454100 [Oryza sativa Japonica Group]
 gb|AAO73245.1| putative membrane protein [Oryza sativa Japonica Group]
 gb|ABF97019.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12390.1| Os03g0454100 [Oryza sativa Japonica Group]
 dbj|BAG90227.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75563.1| hypothetical protein OsI_12232 [Oryza sativa Indica Group]
 gb|EEE59340.1| hypothetical protein OsJ_11423 [Oryza sativa Japonica Group]
Length=417

 Score = 80.1 bits (196),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+ +AVLRVSLGNF FF I ++MMIG+K+Q D RD  HHGGW+ K++ W +L++ MF VP
Sbjct  75   FQMNAVLRVSLGNFLFFAIFALMMIGVKDQNDRRDAWHHGGWIAKIVVWVVLIVLMFCVP  134

Query  517  NELISFYE  540
            N +I+ YE
Sbjct  135  NVVITIYE  142


 Score = 68.2 bits (165),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKT-PDR  331
            + +S ISRRSAR+AYCGLF  SLI+S+++R+ A PL++ IPWIN F  T PD 
Sbjct  21   SALSAISRRSARLAYCGLFAASLILSFLMRQFATPLLKQIPWINTFDYTQPDE  73



>gb|ABF97020.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=372

 Score = 80.1 bits (196),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+ +AVLRVSLGNF FF I ++MMIG+K+Q D RD  HHGGW+ K++ W +L++ MF VP
Sbjct  75   FQMNAVLRVSLGNFLFFAIFALMMIGVKDQNDRRDAWHHGGWIAKIVVWVVLIVLMFCVP  134

Query  517  NELISFYE  540
            N +I+ YE
Sbjct  135  NVVITIYE  142


 Score = 67.8 bits (164),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKT-PDR  331
            + +S ISRRSAR+AYCGLF  SLI+S+++R+ A PL++ IPWIN F  T PD 
Sbjct  21   SALSAISRRSARLAYCGLFAASLILSFLMRQFATPLLKQIPWINTFDYTQPDE  73



>ref|XP_006595390.1| PREDICTED: probable serine incorporator-like [Glycine max]
Length=375

 Score = 75.9 bits (185),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LLV+  FF+P
Sbjct  72   YQAQAVLRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHGGWTAKIVIWLLLVVLAFFLP  131

Query  517  NELISFY  537
            + +I  Y
Sbjct  132  DAIILVY  138


 Score = 70.1 bits (170),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            +  S IS++SARI YCGLFG+SL+VSWILREV APL+E  PWI     T   E
Sbjct  18   STASCISQKSARIGYCGLFGVSLVVSWILREVGAPLLEKFPWIGGTSDTNTTE  70



>dbj|BAJ86142.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99044.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score = 74.7 bits (182),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F+ +AVLR+SLGNF FF I ++ MIG+K+Q D RD  HHGGW+ K   W +LV+ MFFVP
Sbjct  75   FQMNAVLRLSLGNFLFFAIFALTMIGVKDQNDRRDAWHHGGWIAKFAIWVVLVVLMFFVP  134

Query  517  NELISFYE  540
            N ++S YE
Sbjct  135  NIVVSVYE  142


 Score = 71.2 bits (173),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            +  + ++RRSAR+AYCGLF  SLI+S++LR+ AAPL+++IPWIN F  TP  E  + 
Sbjct  21   SAAASVTRRSARLAYCGLFAASLILSFLLRQFAAPLLQHIPWINTFDHTPPEEWFQM  77



>gb|KHN37564.1| Putative serine incorporator [Glycine soja]
Length=407

 Score = 75.9 bits (185),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LLV+  FF+P
Sbjct  72   YQAQAVLRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHGGWTAKIVIWLLLVVLAFFLP  131

Query  517  NELISFYE  540
            + +I  Y 
Sbjct  132  DAIILVYA  139


 Score = 70.1 bits (170),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            +  S IS++SARI YCGLFG+SL+VSWILREV APL+E  PWI     T   E
Sbjct  18   STASCISQKSARIGYCGLFGVSLVVSWILREVGAPLLEKFPWIGGTSDTNTTE  70



>ref|XP_007147778.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
 gb|ESW19772.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
Length=409

 Score = 73.2 bits (178),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            ++  AVLRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW  K++ W LL++  FF+P
Sbjct  71   YQVQAVLRVSLGNFLFFGILALLMIGVKDQNDRRDSWHHGGWPAKLVVWLLLLVLAFFLP  130

Query  517  NELISFY  537
            + +I  Y
Sbjct  131  DAIILVY  137


 Score = 69.7 bits (169),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            + VS IS++SARI YCGLFG SLIVSWILREV APL+E  PWI 
Sbjct  18   STVSCISQKSARIGYCGLFGASLIVSWILREVGAPLLEKFPWIG  61



>gb|AFK34472.1| unknown [Lotus japonicus]
Length=256

 Score = 69.3 bits (168),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +V SGIS++SARI YC LFG SL+VSWI RE+ APL+E IPWI+
Sbjct  18   SVASGISQKSARIGYCFLFGASLVVSWIFREIGAPLLEKIPWID  61


 Score = 65.9 bits (159),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGW  462
            ++  AVLRVSLGNF FF IL+++MIG+K+Q D RD+ HHGGW
Sbjct  71   YQVQAVLRVSLGNFLFFGILALIMIGVKDQNDRRDSWHHGGW  112



>ref|XP_010246591.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=409

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +1

Query  298  MD*SFPQNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVI  477
            +D +F Q      FETDAVLRV+LGNF FFTIL+++MIGIK++ D RD LHHGG M K++
Sbjct  58   IDHNFQQTPNKEWFETDAVLRVNLGNFLFFTILAVLMIGIKDE-DSRDRLHHGGXMTKIV  116

Query  478  CWFLLVIFMFFVPNELISFYE  540
             W L+VIFMFF+PN + SFYE
Sbjct  117  SWCLVVIFMFFLPNGIASFYE  137


 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +2

Query  197  RRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINH-FHKTPDRECLKQ  346
            R SARIAYCGLF LSLIVSWIL EVAAP MEN PWI+H F +TP++E  + 
Sbjct  23   RLSARIAYCGLFALSLIVSWILGEVAAPPMENHPWIDHNFQQTPNKEWFET  73



>gb|KCW70853.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=316

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +1

Query  403  MMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYE  540
            MMIG+KNQ+DPRD +HHGGWMMK+ICW LLVIFMFF+PNE+ISFYE
Sbjct  1    MMIGVKNQRDPRDGIHHGGWMMKIICWCLLVIFMFFLPNEIISFYE  46



>ref|XP_006366267.1| PREDICTED: cell wall integrity and stress response component 
4-like isoform X2 [Solanum tuberosum]
Length=122

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 49/64 (77%), Gaps = 8/64 (13%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV--------ICWFLL  492
            FETDAVL+VSLGNF FFTIL+I+MIG+K+QKDPRD +HHGGWMMK          CW L 
Sbjct  26   FETDAVLQVSLGNFLFFTILAILMIGVKSQKDPRDGVHHGGWMMKSFVGASWLYCCWILC  85

Query  493  VIFM  504
            ++ M
Sbjct  86   IVGM  89



>tpg|DAA49274.1| TPA: hypothetical protein ZEAMMB73_017777 [Zea mays]
Length=359

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  307  SFPQNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWF  486
            +F Q      F+ +AVLRVSLGNF FF I S++MIG+K+Q D RD  HHGGW+ K+  W 
Sbjct  9    AFDQTPPEEWFQMNAVLRVSLGNFLFFAIFSLVMIGVKDQNDRRDAWHHGGWIAKIAVWA  68

Query  487  LLVIFMFFVPNELISFYE  540
            +L++ MF VPN +I+ YE
Sbjct  69   VLIVLMFCVPNIVITIYE  86



>ref|NP_001130812.1| uncharacterized protein LOC100191916 [Zea mays]
 gb|ACF79174.1| unknown [Zea mays]
 gb|ACF82535.1| unknown [Zea mays]
 gb|ACF85768.1| unknown [Zea mays]
 gb|ACG39558.1| serine incorporator 3 [Zea mays]
 tpg|DAA49275.1| TPA: Serine incorporator 3 isoform 1 [Zea mays]
 tpg|DAA49276.1| TPA: Serine incorporator 3 isoform 2 [Zea mays]
Length=415

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  307  SFPQNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWF  486
            +F Q      F+ +AVLRVSLGNF FF I S++MIG+K+Q D RD  HHGGW+ K+  W 
Sbjct  65   AFDQTPPEEWFQMNAVLRVSLGNFLFFAIFSLVMIGVKDQNDRRDAWHHGGWIAKIAVWA  124

Query  487  LLVIFMFFVPNELISFYE  540
            +L++ MF VPN +I+ YE
Sbjct  125  VLIVLMFCVPNIVITIYE  142


 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            +  S +SRRSAR+AYCGLF  SLI+S++LR+ AAPL+++IPWIN F +TP  E  + 
Sbjct  21   SAASAVSRRSARLAYCGLFAASLILSFLLRQFAAPLLKHIPWINAFDQTPPEEWFQM  77



>ref|XP_006850791.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
 gb|ERN12372.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
Length=339

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  528
            AVLRVSLGNF FFTI +++MIG+K+Q D RD+ HHGGW+ K+I W LLVI MFF+PN + 
Sbjct  3    AVLRVSLGNFLFFTIFALIMIGVKDQNDRRDSWHHGGWITKIIVWSLLVILMFFLPNAVF  62

Query  529  SFYE  540
            + Y 
Sbjct  63   NMYA  66



>ref|XP_002466928.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
 gb|EER93926.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
Length=415

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  307  SFPQNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWF  486
            +F Q      F+ +AVLRVSLGNF FF   ++MMIG+K+Q D RD  HHGGW+ KV  W 
Sbjct  65   AFDQTPPEEWFQMNAVLRVSLGNFLFFATFALMMIGVKDQNDRRDAWHHGGWIAKVAVWA  124

Query  487  LLVIFMFFVPNELISFYE  540
            +L++ MF VPN +I+ YE
Sbjct  125  VLIVLMFCVPNIVITIYE  142


 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRECLKQ  346
            +  S +SRRSAR+AYCGLF  SLI+S++LR+ AAPL+++IPWIN F +TP  E  + 
Sbjct  21   SAASAVSRRSARLAYCGLFAASLILSFLLRQFAAPLLKHIPWINAFDQTPPEEWFQM  77



>ref|XP_008673654.1| PREDICTED: uncharacterized protein LOC100191916 isoform X1 [Zea 
mays]
Length=339

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +1

Query  346  DAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNEL  525
            +AVLRVSLGNF FF I S++MIG+K+Q D RD  HHGGW+ K+  W +L++ MF VPN +
Sbjct  2    NAVLRVSLGNFLFFAIFSLVMIGVKDQNDRRDAWHHGGWIAKIAVWAVLIVLMFCVPNIV  61

Query  526  ISFYE  540
            I+ YE
Sbjct  62   ITIYE  66



>ref|XP_011397622.1| putative serine incorporator [Auxenochlorella protothecoides]
 gb|KFM24734.1| putative serine incorporator [Auxenochlorella protothecoides]
Length=435

 Score = 62.8 bits (151),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRD-NLHHGGWMMKVICWFLLVIFMFFV  513
            F   AV R+SLGN   F  L+++M+G+K   D RD  LHHG W++K   W + ++  F +
Sbjct  82   FGAQAVYRISLGNLLLFGSLALVMMGVKRTSDRRDTQLHHGSWLIKAALWTVCILLPFLL  141

Query  514  PNELISFYE  540
            P  +I+ Y 
Sbjct  142  PPSVINAYS  150


 Score = 47.8 bits (112),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +2

Query  200  RSARIAYCGLFGLSLIVSWILREVAAPLMENIPWI-NHFHK  319
            RSAR+A+  LF LS+I++WILR+ A PL+  IPWI   F+K
Sbjct  33   RSARLAWSFLFTLSMILAWILRDFAKPLLMKIPWIVKSFNK  73



>ref|XP_004302121.1| PREDICTED: serine incorporator 3-like [Fragaria vesca subsp. 
vesca]
Length=246

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = +1

Query  406  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIF-MFFVPNELISFYE  540
            MIG+K QKDPRD++HHGGWMMKV CWFLLV+F ++FVPN  ISFYE
Sbjct  1    MIGVKRQKDPRDSIHHGGWMMKVTCWFLLVLFSLYFVPNGFISFYE  46



>ref|XP_002506090.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67348.1| predicted protein [Micromonas sp. RCC299]
Length=433

 Score = 70.1 bits (170),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRD-NLHHGGWMMKVICWFLLVIFMFFV  513
            F   AV RVSLGNF FF  LS M++  K + DPRD ++HHG W +K+  W L VI  F +
Sbjct  78   FGQSAVYRVSLGNFMFFGGLSAMLVDCKTRSDPRDRHIHHGSWTLKLAAWALCVIVPFLL  137

Query  514  PNELISFYE  540
            P+  I  Y 
Sbjct  138  PDGFIDAYA  146


 Score = 38.1 bits (87),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +2

Query  191  ISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWIN  307
            +S  SAR  Y  +FGL + ++ ++R+ A P+M  IPWI 
Sbjct  28   VSSISARAVYTVIFGLGMGIAVVMRDYAKPMMMEIPWIG  66



>gb|KIZ05916.1| putative serine incorporator [Monoraphidium neglectum]
Length=447

 Score = 58.9 bits (141),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDN-LHHGGWMMKVICWFLLVIFMFFV  513
            F   AV R+S+G+F FF  +S+ ++G++ + D R   LH G W  K+  W + +   FF 
Sbjct  81   FGQQAVYRISMGSFLFFGTMSLALLGVRTKGDKRGAYLHQGNWAAKLAAWLVFIALPFFF  140

Query  514  PNELISFY  537
            PN L+  Y
Sbjct  141  PNGLVVAY  148


 Score = 48.9 bits (115),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  176  TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWI  304
            TV     RRSAR+AY  LF L++++SW  R++A PL+E IPWI
Sbjct  25   TVTRETMRRSARLAYSFLFFLAILISWAGRDLAKPLIEKIPWI  67



>ref|XP_001696805.1| hypothetical protein CHLREDRAFT_192111 [Chlamydomonas reinhardtii]
 gb|EDP00913.1| predicted protein [Chlamydomonas reinhardtii]
Length=211

 Score = 60.1 bits (144),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDN-LHHGGWMMKVICWFLLVIFMFFV  513
            F   AV RVS+GNF FF  +S+ ++G+K + D RD  LHHG  + K+  W L     F  
Sbjct  80   FGQQAVYRVSMGNFLFFGCMSLALLGVKQRGDKRDAYLHHGHPLAKLGLWLLFTCLPFLF  139

Query  514  PNELISFYE  540
            PNE+++ Y 
Sbjct  140  PNEVLNVYS  148


 Score = 47.4 bits (111),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  191  ISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWI  304
            + R SAR+A+  LF L++I++W+LR+ A P++E IPWI
Sbjct  30   VLRHSARVAWSVLFFLAMILAWVLRDFATPILEKIPWI  67



>gb|EMS53525.1| putative serine incorporator [Triticum urartu]
Length=316

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYE  540
            M GIK+QKDPRD +HHGGWM K+ CW ++V  MFFVPN ++SFYE
Sbjct  1    MAGIKDQKDPRDKVHHGGWMAKIFCWVVIVFLMFFVPNGVVSFYE  45



>ref|XP_003062471.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53290.1| predicted protein [Micromonas pusilla CCMP1545]
Length=442

 Score = 64.3 bits (155),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRD-NLHHGGWMMKVICWFLLVIFMFFVPNEL  525
            AV R+SLGNF FF  ++  ++G+K + D RD +LHHG W++K   W L  +  FF  N +
Sbjct  71   AVYRISLGNFIFFGAMACALVGVKRRSDARDVHLHHGSWVLKFTAWALCNVLPFFASNGV  130

Query  526  ISFY  537
            +  Y
Sbjct  131  VGAY  134


 Score = 37.0 bits (84),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +2

Query  179  VVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWI  304
            V   +++ SAR  Y  +F +S  +++++R+ A PL++ IPWI
Sbjct  21   VGDAVAKTSARALYVVMFAISTALAFVMRDCAQPLLKRIPWI  62



>ref|XP_005850950.1| hypothetical protein CHLNCDRAFT_48549 [Chlorella variabilis]
 gb|EFN58848.1| hypothetical protein CHLNCDRAFT_48549 [Chlorella variabilis]
Length=367

 Score = 56.2 bits (134),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 47/89 (53%), Gaps = 13/89 (15%)
 Frame = +1

Query  286  GEYPMD*SFPQNTR*GMFETDAVLRVSLGNFT---FFTILSIMMIGIKNQKDPRD-NLHH  453
            GE P D  F Q          AV R+SLGNF     F  L+++M G++++ D RD +LHH
Sbjct  71   GEMPSDAWFGQQ---------AVYRISLGNFVSGVLFGALAVVMAGVQHKSDRRDRSLHH  121

Query  454  GGWMMKVICWFLLVIFMFFVPNELISFYE  540
            G W++K   W L     FF+P  ++  Y 
Sbjct  122  GHWLLKAGLWALCNALPFFLPVGVVGAYS  150


 Score = 37.7 bits (86),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  197  RRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWI-NHF  313
            R SAR A+  LF  SL+ +WI R+  + L++ +PWI  HF
Sbjct  29   RSSARAAWSILFTFSLVGAWIARDFGSALLKKLPWILRHF  68



>ref|XP_002956760.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
 gb|EFJ42217.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
Length=415

 Score = 47.8 bits (112),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  197  RRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWI  304
            R SAR+A+  LF L++IV+WILR+ A P+++ IPWI
Sbjct  32   RHSARVAWSVLFFLAMIVAWILRDFATPILQKIPWI  67


 Score = 45.4 bits (106),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 1/69 (1%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDN-LHHGGWMMKVICWFLLVIFMFFV  513
            F   AV RVS+GNF FF  +S+  IG+K + D RD  LHH   ++K+  W L     F  
Sbjct  80   FGQQAVYRVSMGNFLFFACMSLATIGVKFRGDKRDRYLHHAHPLLKLALWLLFTALPFLF  139

Query  514  PNELISFYE  540
            PN +++ Y 
Sbjct  140  PNGVLNAYS  148



>gb|AAF30310.1|AC018907_10 hypothetical protein [Arabidopsis thaliana]
Length=315

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  406  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  537
            MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S Y
Sbjct  1    MIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVSLY  44



>ref|XP_006407969.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49422.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=313

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  406  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  537
            M+G+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S Y
Sbjct  1    MVGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNVVVSIY  44



>ref|XP_005651318.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
 gb|EIE26774.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
Length=429

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDN-LHHGGWMMKVICWFLLVIFMFFV  513
            +   AV RVS+GNF FF ++S+ M+G+K + D RD  L HGGW +KV  W L  I  FF 
Sbjct  57   YGQQAVYRVSMGNFIFFGLMSLAMVGVKYKSDKRDQYLQHGGWFLKVALWLLFNILPFFF  116

Query  514  PNELISFY  537
            P   ++ Y
Sbjct  117  PVSFVNGY  124


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = +2

Query  197  RRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHF--HKTPDRECLKQMQYFELA  367
            R+SAR+AYC LF L+++++WILR+ A P+++ +PWI H   H  P  +   Q   + ++
Sbjct  8    RKSARLAYCILFTLAMVLAWILRDFAKPIIDKLPWIIHAMGHGEPSAKWYGQQAVYRVS  66



>emb|CAN71158.1| hypothetical protein VITISV_036762 [Vitis vinifera]
Length=309

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  406  MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY  537
            MIG+K+Q D RD+ HHGGW+ K++ W LL+I MFFVPN +IS Y
Sbjct  1    MIGVKDQNDRRDSWHHGGWVAKMVIWVLLIILMFFVPNVVISIY  44



>ref|XP_002515588.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47037.1| conserved hypothetical protein [Ricinus communis]
Length=398

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLRVSLG F FF I+ +  +G     DPRD+ H G W  K++ W  L I  F VP+ 
Sbjct  78   AEGVLRVSLGCFVFFMIMFLSTVGTSKFHDPRDSWHSGWWGPKIVLWIALTIMTFLVPSA  137

Query  523  LISFY  537
             I  Y
Sbjct  138  FIRLY  142



>gb|KDP32305.1| hypothetical protein JCGZ_13230 [Jatropha curcas]
Length=400

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLRVSLG F FF I+ +  +G     DPRD  H G W  K++ W  L +  F +P+ 
Sbjct  80   AEGVLRVSLGCFIFFIIMFVSTVGTSKFYDPRDAWHSGWWSAKIVMWIALTVLTFLIPSA  139

Query  523  LISFY  537
             I  Y
Sbjct  140  FIQLY  144



>ref|XP_001753882.1| predicted protein [Physcomitrella patens]
 gb|EDQ81204.1| predicted protein [Physcomitrella patens]
Length=361

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            +D VLR+S G F FF+ + +  +G  + KDPRD+ H G W +K + W  L++  F +P  
Sbjct  47   SDGVLRLSFGCFMFFSFMFLTTVGTSSTKDPRDSWHSGWWPIKTLGWAALMVMPFLIPPH  106

Query  523  LISFY  537
             I+ Y
Sbjct  107  YIAIY  111



>ref|XP_010249828.1| PREDICTED: probable serine incorporator [Nelumbo nucifera]
Length=397

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+  + +   G +   +  D+ H G W  K++ W  L++  FFVPN 
Sbjct  77   TEGVLRVSLGCFIFYFTMFLSTAGTRKLNERSDSWHSGWWSAKILVWIALLVLPFFVPNA  136

Query  523  LISFY  537
            LI FY
Sbjct  137  LIQFY  141



>ref|XP_002965853.1| hypothetical protein SELMODRAFT_83891 [Selaginella moellendorffii]
 ref|XP_002983103.1| hypothetical protein SELMODRAFT_117651 [Selaginella moellendorffii]
 gb|EFJ15912.1| hypothetical protein SELMODRAFT_117651 [Selaginella moellendorffii]
 gb|EFJ33273.1| hypothetical protein SELMODRAFT_83891 [Selaginella moellendorffii]
Length=365

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            ++ VLRVSLG F FF  + +  +G     DPRD  H G W +K + W ++++  FF+P+ 
Sbjct  47   SEGVLRVSLGCFVFFFTMYLTTVGTSKPDDPRDAWHSGWWPIKSLFWIIVMVLPFFIPSA  106

Query  523  LISFY  537
             I  Y
Sbjct  107  FIQMY  111



>gb|KHN33071.1| hypothetical protein glysoja_010062 [Glycine soja]
Length=119

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  221  CGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE  334
            CGLFG+SL+VSWILREV APL+E  PWI     T   E
Sbjct  20   CGLFGVSLVVSWILREVGAPLLEKFPWIGGTSDTYTTE  57



>ref|XP_010435285.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=394

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVS G F F+ I+ +  +G       RD  H G W  K+  W  LVIF F +P+ 
Sbjct  77   TEGVLRVSFGCFLFYFIMFLSTVGTSKMHSSRDKWHSGWWFAKLFMWLGLVIFPFLLPSS  136

Query  523  LISFY  537
            +I FY
Sbjct  137  IIQFY  141



>ref|XP_003620496.1| Serine incorporator [Medicago truncatula]
 gb|AES76714.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=402

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  528
             VLRVS+G F FF ++           +PRD  H G W  K++ W +L IF F +P+ELI
Sbjct  84   GVLRVSMGCFLFFMMMFWSTTRTSKLNEPRDRWHSGWWATKIVLWIILTIFTFLLPSELI  143

Query  529  SFY  537
              Y
Sbjct  144  DLY  146



>ref|XP_002863245.1| hypothetical protein ARALYDRAFT_497050 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39504.1| hypothetical protein ARALYDRAFT_497050 [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ I+ +  +G    +  RD  H G W  K+  W  L IF F +P+ 
Sbjct  77   TEGVLRVSLGCFLFYFIMFLSTVGTSKTQSSRDKWHSGWWFAKLFMWLGLTIFPFLLPSS  136

Query  523  LISFY  537
            +I  Y
Sbjct  137  IIQLY  141



>ref|XP_010527190.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010527191.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010527192.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010527194.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
Length=405

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLRVSLG F F+ I+ +  +G K     RD  H G W  K++ WF L I  F +P+ 
Sbjct  83   AEGVLRVSLGCFMFYFIMFLSTVGTKKMHSSRDRWHSGWWSAKLVMWFGLTIIPFLMPSS  142

Query  523  LISFY  537
            +I  Y
Sbjct  143  IIQLY  147



>ref|XP_010488550.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010488551.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010488552.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010488553.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=413

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ 
Sbjct  84   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWFAKLILWPALTIIPFLLPSS  143

Query  523  LISFY  537
            +I+FY
Sbjct  144  IINFY  148



>gb|AET05293.2| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=409

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLRVSLG FTF+ I+ +   G    K  R+  H G W++K+  W ++ +  FF+P+ 
Sbjct  78   AEGVLRVSLGCFTFYIIMFLSTTGTSKLKQKRNTWHSGWWLVKIALWIVMTVIPFFLPSG  137

Query  523  LISFY  537
             I  Y
Sbjct  138  FIQIY  142



>ref|XP_003630817.1| Serine incorporator [Medicago truncatula]
Length=418

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLRVSLG FTF+ I+ +   G    K  R+  H G W++K+  W ++ +  FF+P+ 
Sbjct  78   AEGVLRVSLGCFTFYIIMFLSTTGTSKLKQKRNTWHSGWWLVKIALWIVMTVIPFFLPSG  137

Query  523  LISFY  537
             I  Y
Sbjct  138  FIQIY  142



>ref|XP_006414928.1| hypothetical protein EUTSA_v10025402mg [Eutrema salsugineum]
 gb|ESQ56381.1| hypothetical protein EUTSA_v10025402mg [Eutrema salsugineum]
Length=394

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ I+ +  +G       RD  H G W+ K++ W  L IF F +P+ 
Sbjct  77   TEGVLRVSLGCFLFYFIMFLSTVGTSKTHSSRDKWHSGWWVAKLLMWPGLTIFPFLLPSS  136

Query  523  LISFY  537
            +I  Y
Sbjct  137  IIELY  141



>emb|CDY39551.1| BnaC07g07190D [Brassica napus]
Length=411

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G      PRD  H G W  K+I W  L I  F +P+ 
Sbjct  83   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSPRDKWHSGWWSAKLIMWPALTIIPFLLPST  142

Query  523  LISFY  537
            +I  Y
Sbjct  143  IILLY  147



>gb|EGC49614.1| DNA mismatch repair protein [Histoplasma capsulatum H88]
Length=1515

 Score = 54.3 bits (129),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            AV R++     F  IL+++++G+++ KD R  L +G W  K+I W LLV+  FF+P
Sbjct  96   AVHRINFALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIP  151


 Score = 21.9 bits (45),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 9/23 (39%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = +2

Query  194  SRRSARIAYCGLFGLSLIVSWIL  262
            S  + RIAY  +   + I+SWI+
Sbjct  43   SSMATRIAYAVILLFNSILSWIM  65



>gb|EER41787.1| DNA mismatch repair protein [Histoplasma capsulatum H143]
Length=1515

 Score = 54.3 bits (129),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            AV R++     F  IL+++++G+++ KD R  L +G W  K+I W LLV+  FF+P
Sbjct  96   AVHRINFALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIP  151


 Score = 21.9 bits (45),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 9/23 (39%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = +2

Query  194  SRRSARIAYCGLFGLSLIVSWIL  262
            S  + RIAY  +   + I+SWI+
Sbjct  43   SSMATRIAYAVILLFNSILSWIM  65



>gb|EEH05886.1| DNA mismatch repair protein pms1 [Histoplasma capsulatum G186AR]
Length=1515

 Score = 54.3 bits (129),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            AV R++     F  IL+++++G+++ KD R  L +G W  K+I W LLV+  FF+P
Sbjct  96   AVHRINFALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIP  151


 Score = 21.9 bits (45),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 9/23 (39%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = +2

Query  194  SRRSARIAYCGLFGLSLIVSWIL  262
            S  + RIAY  +   + I+SWI+
Sbjct  43   SSMATRIAYAVILLFNSILSWIM  65



>ref|XP_010450223.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010450225.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=394

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVS G F F+ I+ +  +G       RD  H G W  K+  W  LVIF F +P+ 
Sbjct  77   TEGVLRVSFGCFLFYFIMFLSTVGTSKMHSSRDKWHSGWWFAKLFMWLGLVIFPFLLPSS  136

Query  523  LISFY  537
            +I  Y
Sbjct  137  IIQLY  141



>ref|NP_189089.3| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAL36053.1| AT3g24470/MXP5_4 [Arabidopsis thaliana]
 gb|AAQ89613.1| At3g24470/MXP5_4 [Arabidopsis thaliana]
 gb|AEE76900.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=409

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            TD VLRVSLG F F+ ++ +  +G       RD  H G W +K+I W  L I  F +P+ 
Sbjct  84   TDGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWFVKLIMWPALTIIPFLLPSS  143

Query  523  LISFY  537
            +I  Y
Sbjct  144  IIHLY  148



>ref|XP_002885648.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61907.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=409

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            TD VLRVSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ 
Sbjct  84   TDGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWFAKLILWPALTIIPFLLPSS  143

Query  523  LISFY  537
            +I  Y
Sbjct  144  IIHLY  148



>ref|XP_002982341.1| hypothetical protein SELMODRAFT_179397 [Selaginella moellendorffii]
 gb|EFJ16586.1| hypothetical protein SELMODRAFT_179397 [Selaginella moellendorffii]
Length=382

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 53/125 (42%), Gaps = 14/125 (11%)
 Frame = +1

Query  178  GGVRDQPPLRSYCILWSF-----WAVADCFMDSSRSCCSSHGEYPMD*SFPQNTR*GMFE  342
             G    P    Y I++ F     W V D   ++ R+     G Y +              
Sbjct  10   AGANQMPTRYIYAIIFLFTNLIAWVVRDYSREAFRTLRHFQGCYGVH---------TCLA  60

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            ++ VLR+S G F FF I+ +  +G       RD  H G W +K + W LL+I  FFVP  
Sbjct  61   SEGVLRLSFGCFVFFAIMFVTTVGTSRIGGLRDGWHCGWWPLKFLLWILLMILPFFVPPA  120

Query  523  LISFY  537
            +I  Y
Sbjct  121  IIKVY  125



>ref|XP_010656351.1| PREDICTED: serine incorporator 3 isoform X3 [Vitis vinifera]
Length=311

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLRVSLG FTF+ I+ +   G      PR+  H G W  K+I W  L++  F VP+ 
Sbjct  77   AEGVLRVSLGCFTFYFIMFLSTAGTSKLHKPRELWHSGWWSAKIILWVALMMLPFLVPSA  136

Query  523  LISFY  537
             I  Y
Sbjct  137  FIQLY  141



>ref|XP_007152808.1| hypothetical protein PHAVU_004G161400g [Phaseolus vulgaris]
 gb|ESW24802.1| hypothetical protein PHAVU_004G161400g [Phaseolus vulgaris]
Length=400

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             D VLRVS+G F F+ I+     G    K+ RD  H G W++K +   L+ IF F +P++
Sbjct  80   ADGVLRVSMGCFLFYMIMFWSTAGTSKLKEGRDEWHSGWWLVKTVLLILVTIFPFLLPSK  139

Query  523  LISFY  537
            LI  Y
Sbjct  140  LIELY  144



>ref|XP_011043440.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011043441.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011043442.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=398

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 33/65 (51%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLRVSLG F F+ I+ +  +G     D RD  H G W  K++ W  L I  F VP+ 
Sbjct  78   AEGVLRVSLGCFIFYIIMFLSTVGTSKLHDRRDAWHSGWWTAKIVLWISLTIITFLVPSA  137

Query  523  LISFY  537
                Y
Sbjct  138  FFQIY  142



>ref|XP_010656344.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656345.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656346.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656347.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656348.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656349.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 emb|CBI28099.3| unnamed protein product [Vitis vinifera]
Length=397

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLRVSLG FTF+ I+ +   G      PR+  H G W  K+I W  L++  F VP+ 
Sbjct  77   AEGVLRVSLGCFTFYFIMFLSTAGTSKLHKPRELWHSGWWSAKIILWVALMMLPFLVPSA  136

Query  523  LISFY  537
             I  Y
Sbjct  137  FIQLY  141



>ref|XP_010656350.1| PREDICTED: probable serine incorporator isoform X2 [Vitis vinifera]
Length=353

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLRVSLG FTF+ I+ +   G      PR+  H G W  K+I W  L++  F VP+ 
Sbjct  33   AEGVLRVSLGCFTFYFIMFLSTAGTSKLHKPRELWHSGWWSAKIILWVALMMLPFLVPSA  92

Query  523  LISFY  537
             I  Y
Sbjct  93   FIQLY  97



>ref|XP_868873.1| hypothetical protein AN9491.2 [Aspergillus nidulans FGSC A4]
 gb|EAA66772.1| hypothetical protein AN9491.2 [Aspergillus nidulans FGSC A4]
Length=839

 Score = 52.8 bits (125),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  528
            AV R++ G   F  +L++ ++G+++ KD R  L +G W  K++ W L V+  FF+P    
Sbjct  459  AVHRINFGLGLFHLVLALFLLGVRSSKDGRAALQNGFWGPKIVLWLLFVVMSFFIPEAFF  518

Query  529  SFY  537
              Y
Sbjct  519  FVY  521


 Score = 22.7 bits (47),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 9/20 (45%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +2

Query  203  SARIAYCGLFGLSLIVSWIL  262
            + RIAY  +  ++ IVSWI+
Sbjct  409  ATRIAYAFILLINSIVSWIM  428



>ref|XP_010440600.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010440601.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=394

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVS G F F+ I+ +  +G       RD  H G W  K+  W  LVIF F +P+ 
Sbjct  77   TEGVLRVSFGCFLFYFIMFLSTVGTSKLHSSRDKWHSGWWFAKLFMWLGLVIFPFLLPSS  136

Query  523  LISFY  537
            +I  Y
Sbjct  137  IIQLY  141



>emb|CAN70494.1| hypothetical protein VITISV_041932 [Vitis vinifera]
Length=397

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLRVSLG FTF+ I+ +   G      PR+  H G W  K+I W  L++  F VP+ 
Sbjct  77   AEGVLRVSLGCFTFYFIMFLSTAGTSKLHKPRELWHSGWWSAKIILWVALMMLPFLVPSA  136

Query  523  LISFY  537
             I  Y
Sbjct  137  FIQLY  141



>ref|XP_002966499.1| hypothetical protein SELMODRAFT_85365 [Selaginella moellendorffii]
 gb|EFJ32526.1| hypothetical protein SELMODRAFT_85365 [Selaginella moellendorffii]
Length=414

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +1

Query  340  ETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN  519
             ++ VLR+S G F FF I+ +  +G       RD  H G W +K + W LL+I  FFVP 
Sbjct  60   ASEGVLRLSFGCFVFFAIMFVTTVGTSRIGGLRDGWHCGWWPLKFLLWILLMILPFFVPP  119

Query  520  ELISFY  537
             +I  Y
Sbjct  120  AIIKVY  125



>dbj|GAA56306.1| serine incorporator 1 [Clonorchis sinensis]
Length=1094

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (54%), Gaps = 7/78 (9%)
 Frame = +1

Query  307  SFPQNTR*GMFETDA------VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMM  468
            +F  N R G+ + DA      V R+      F+ + +++MI + + KDPR  + +G W  
Sbjct  446  TFETNVR-GVVDCDAITGFGAVYRLCFATTMFYLLFTLLMIRVTSSKDPRSKIQNGFWFF  504

Query  469  KVICWFLLVIFMFFVPNE  522
            K + WF LV+  FF+P E
Sbjct  505  KYLIWFGLVVGAFFIPVE  522



>ref|XP_010513493.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010513497.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010513501.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=411

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ 
Sbjct  84   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWFAKLILWPALTIIPFLLPSS  143

Query  523  LISFY  537
            +I+ Y
Sbjct  144  IINLY  148



>ref|XP_006285723.1| hypothetical protein CARUB_v10007195mg [Capsella rubella]
 gb|EOA18621.1| hypothetical protein CARUB_v10007195mg [Capsella rubella]
Length=395

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVS G F F+ I+ +  +G       RD  H G W  K+  W  L IF F +P+ 
Sbjct  78   TEGVLRVSFGCFLFYFIMFLSTVGTSKMHSSRDKWHSGWWFAKLFMWLGLAIFPFLLPSS  137

Query  523  LISFY  537
            +I  Y
Sbjct  138  IIQLY  142



>ref|XP_010466851.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010466852.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010466853.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=411

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ 
Sbjct  84   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWFAKLILWPALTIIPFLLPSS  143

Query  523  LISFY  537
            +I+ Y
Sbjct  144  IINLY  148



>gb|KIJ14234.1| hypothetical protein PAXINDRAFT_163421 [Paxillus involutus ATCC 
200175]
Length=491

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN  519
            AV RV      F  ILS+ +IG+K   D R  + +G W  KV+ WFLLV+  FF+PN
Sbjct  97   AVHRVCFALSLFHAILSVSLIGVKESMDKRAAIQNGWWGPKVLLWFLLVVITFFIPN  153



>ref|XP_007013229.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 2 [Theobroma cacao]
 gb|EOY30848.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 2 [Theobroma cacao]
Length=398

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 0/69 (0%)
 Frame = +1

Query  331  GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFF  510
            G    + VLRVSLG F F+ ++ +   G K + + RD+ H G W  K+  W  L +  F 
Sbjct  74   GCLGAEGVLRVSLGCFAFYFVMFLSTAGTKRKYNCRDSWHSGWWSAKIGLWIALTVTSFL  133

Query  511  VPNELISFY  537
            VP  +I  Y
Sbjct  134  VPTFIIQIY  142



>ref|XP_007013228.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY30847.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
Length=408

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 0/69 (0%)
 Frame = +1

Query  331  GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFF  510
            G    + VLRVSLG F F+ ++ +   G K + + RD+ H G W  K+  W  L +  F 
Sbjct  74   GCLGAEGVLRVSLGCFAFYFVMFLSTAGTKRKYNCRDSWHSGWWSAKIGLWIALTVTSFL  133

Query  511  VPNELISFY  537
            VP  +I  Y
Sbjct  134  VPTFIIQIY  142



>ref|XP_006297795.1| hypothetical protein CARUB_v10013830mg [Capsella rubella]
 gb|EOA30693.1| hypothetical protein CARUB_v10013830mg [Capsella rubella]
Length=412

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G       RD  H G W +K+I W  L I  F +P+ 
Sbjct  84   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWFVKLILWPALTIIPFLLPSS  143

Query  523  LISFY  537
            +I  Y
Sbjct  144  IIHLY  148



>ref|XP_001223754.1| hypothetical protein CHGG_04540 [Chaetomium globosum CBS 148.51]
 gb|EAQ87921.1| hypothetical protein CHGG_04540 [Chaetomium globosum CBS 148.51]
Length=593

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/63 (32%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  528
            AV R++     F  +L+ +M+G+ + K+PR  + +G W  K+I W  L++  FF+P+   
Sbjct  197  AVHRINFALGVFHLVLAGLMLGVHSSKNPRAAIQNGYWGPKIITWLALIVLTFFIPDTFF  256

Query  529  SFY  537
             F+
Sbjct  257  QFW  259



>ref|XP_009107689.1| PREDICTED: probable serine incorporator [Brassica rapa]
 ref|XP_009107690.1| PREDICTED: probable serine incorporator [Brassica rapa]
 ref|XP_009107691.1| PREDICTED: probable serine incorporator [Brassica rapa]
Length=394

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ I+ +  +        RD  H G W  K++ W  L+IF F +P+ 
Sbjct  77   TEGVLRVSLGCFLFYFIMFLSTVATSKTHSSRDKWHSGWWFAKLLMWPGLIIFPFLLPSS  136

Query  523  LISFY  537
            +I  Y
Sbjct  137  IIDLY  141



>ref|XP_009171257.1| hypothetical protein T265_07464 [Opisthorchis viverrini]
 gb|KER25013.1| hypothetical protein T265_07464 [Opisthorchis viverrini]
Length=819

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            AV R+      F+ + +++MI + + KDPR  + +G W  K + WF LV+  FF+P E
Sbjct  543  AVYRLCFATTMFYLLFTLLMIRVTSSKDPRSKIQNGFWFFKYLIWFGLVVGAFFIPVE  600



>emb|CDY43689.1| BnaC08g46960D [Brassica napus]
Length=400

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ I+ +  +        RD  H G W  K++ W  L+IF F +P+ 
Sbjct  77   TEGVLRVSLGCFLFYFIMFLSTVATSKTHSSRDKWHSGWWFAKLLMWPGLIIFPFLLPSS  136

Query  523  LISFY  537
            +I  Y
Sbjct  137  IIDLY  141



>ref|XP_010047746.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010047747.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010047748.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010047749.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
Length=412

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG FTF+ I+ +  +     ++PR+  H G W +K +    L+I  F VP+ 
Sbjct  92   TEGVLRVSLGCFTFYLIMFLSTVCTSKLQEPRNAWHSGWWSVKTVLLITLIIVPFLVPSA  151

Query  523  LISFY  537
             I  Y
Sbjct  152  FIRIY  156



>ref|XP_006418745.1| hypothetical protein EUTSA_v10002545mg [Eutrema salsugineum]
 ref|XP_006418746.1| hypothetical protein EUTSA_v10002545mg [Eutrema salsugineum]
 gb|ESQ37181.1| hypothetical protein EUTSA_v10002545mg [Eutrema salsugineum]
 gb|ESQ37182.1| hypothetical protein EUTSA_v10002545mg [Eutrema salsugineum]
Length=413

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ 
Sbjct  84   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWSAKLIMWPALTIIPFLLPST  143

Query  523  LISFY  537
            +I  Y
Sbjct  144  IIRLY  148



>ref|XP_001538371.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
 gb|EDN10173.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
Length=611

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            AV R++     F  IL+++++G+++ KD R  L +G W  K+I W LLV+  FF+P
Sbjct  226  AVHRINFALGLFHVILALLLLGVRSSKDGRAGLQNGFWGPKIIAWLLLVVMSFFIP  281



>emb|CDX94813.1| BnaC03g43750D [Brassica napus]
Length=410

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ 
Sbjct  84   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDKWHSGWWSAKLIMWPALTIIPFLLPST  143

Query  523  LISFY  537
            +I  Y
Sbjct  144  IIRLY  148



>ref|XP_008471585.1| PREDICTED: serine incorporator 1 [Diaphorina citri]
Length=691

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            AV R+  G   FF I+++MMIG+K+ +D R  + +G W MK +   L+VI  FF+P
Sbjct  100  AVYRICFGMGVFFLIMALMMIGVKSSRDNRAAIQNGMWGMKYVLVILIVIAAFFIP  155



>ref|XP_006418744.1| hypothetical protein EUTSA_v10002545mg [Eutrema salsugineum]
 gb|ESQ37180.1| hypothetical protein EUTSA_v10002545mg [Eutrema salsugineum]
Length=415

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ 
Sbjct  84   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWSAKLIMWPALTIIPFLLPST  143

Query  523  LISFY  537
            +I  Y
Sbjct  144  IIRLY  148



>gb|KIK77929.1| hypothetical protein PAXRUDRAFT_834805 [Paxillus rubicundulus 
Ve08.2h10]
Length=490

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  528
            AV RV      F  ILS+ +IG+K   D R  + +G W  KV+ WFLLV   FF+PN   
Sbjct  97   AVHRVCFALSLFHAILSVSLIGVKESGDKRAAIQNGWWGPKVLLWFLLVAITFFIPNGFF  156

Query  529  SFY  537
             F+
Sbjct  157  IFW  159



>gb|AGG38116.1| maternal effect embryo arrest 55-3 protein [Dimocarpus longan]
Length=152

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 33/65 (51%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLRVSLG F F+ ++     G     + RD+ H G W  K++ W  L +  F +P+ 
Sbjct  77   AEGVLRVSLGCFVFYFLMFFSTAGTSKLYESRDSWHSGWWSAKIVLWIALTVIPFLIPSS  136

Query  523  LISFY  537
             I  Y
Sbjct  137  FIQIY  141



>ref|XP_003660386.1| hypothetical protein MYCTH_2298645 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO55141.1| hypothetical protein MYCTH_2298645 [Myceliophthora thermophila 
ATCC 42464]
Length=487

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  528
            AV R++     F  +L+ +M+G+++ KDPR  + +G W  K+I W  L++  FF+P+   
Sbjct  96   AVHRINFALGVFHLVLAGLMLGVRSSKDPRAAIQNGFWGPKIIAWLALIVLTFFIPDTFF  155

Query  529  SFY  537
             F+
Sbjct  156  QFW  158



>emb|CDY71080.1| BnaAnng36040D, partial [Brassica napus]
Length=339

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ 
Sbjct  11   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWSAKLIMWPSLTIIPFLLPST  70

Query  523  LISFY  537
            +I  Y
Sbjct  71   IIRLY  75



>emb|CDX93013.1| BnaA03g37350D [Brassica napus]
Length=411

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ 
Sbjct  84   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWSAKLIMWPSLTIIPFLLPST  143

Query  523  LISFY  537
            +I  Y
Sbjct  144  IIRLY  148



>ref|XP_009135894.1| PREDICTED: probable serine incorporator isoform X1 [Brassica 
rapa]
 ref|XP_009135895.1| PREDICTED: probable serine incorporator isoform X1 [Brassica 
rapa]
 ref|XP_009135896.1| PREDICTED: probable serine incorporator isoform X1 [Brassica 
rapa]
Length=412

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ 
Sbjct  84   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWSAKLIMWPSLTIIPFLLPST  143

Query  523  LISFY  537
            +I  Y
Sbjct  144  IIRLY  148



>ref|XP_009135897.1| PREDICTED: probable serine incorporator isoform X2 [Brassica 
rapa]
Length=386

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ 
Sbjct  58   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWSAKLIMWPSLTIIPFLLPST  117

Query  523  LISFY  537
            +I  Y
Sbjct  118  IIRLY  122



>ref|XP_010915041.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=400

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLR+S G F+FF ++ +   G K   DPR++ H   W +K+I W   +   FF+P  
Sbjct  82   AEGVLRISFGCFSFFFVMFLSTAGTKKLDDPRNSWHSEWWPVKIIMWMGFMAVPFFIPTA  141

Query  523  LISFY  537
             I  Y
Sbjct  142  FIQLY  146



>ref|NP_001131274.1| uncharacterized protein LOC100192587 [Zea mays]
 gb|ACF79609.1| unknown [Zea mays]
Length=347

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 0/74 (0%)
 Frame = +1

Query  316  QNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLV  495
            Q  R      + VLRVSLG F FF ++ +  +  +   D R++ H   W  K++ W  L 
Sbjct  90   QGARRHCLGAEGVLRVSLGCFVFFVVMFLSTVHTRKLHDCRNSWHSDWWPAKIVLWLALT  149

Query  496  IFMFFVPNELISFY  537
               F  P+ L+  Y
Sbjct  150  AVAFLAPSPLVQLY  163



>gb|ACG28988.1| TMS membrane protein/tumor differentially expressed protein containing 
protein [Zea mays]
Length=423

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 0/74 (0%)
 Frame = +1

Query  316  QNTR*GMFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLV  495
            Q  R      + VLRVSLG F FF ++ +  +  +   D R++ H   W  K++ W  L 
Sbjct  90   QGARRHCLGAEGVLRVSLGCFVFFVVMFLSTVHTRKLHDCRNSWHSDWWPAKIVLWLALT  149

Query  496  IFMFFVPNELISFY  537
               F  P+ L+  Y
Sbjct  150  AVAFLAPSPLVQLY  163



>ref|XP_007709253.1| hypothetical protein COCCADRAFT_88158 [Bipolaris zeicola 26-R-13]
 gb|EUC36480.1| hypothetical protein COCCADRAFT_88158 [Bipolaris zeicola 26-R-13]
Length=488

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            AV R++     F  I+++M+IG++  KDPR  + +G W+ K+  W  +++  FFVPN 
Sbjct  97   AVQRINFALGFFHVIMALMLIGVQTSKDPRATIQNGFWLPKIFGWIGMIVLTFFVPNS  154



>ref|XP_010532841.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010532842.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010532843.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010532844.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
Length=402

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLR+SLG F F+  + +  +G K     RD  H G W  K++ WF L I  F +P+ 
Sbjct  81   AEGVLRMSLGCFLFYFSMYLSTVGTKKVHSSRDRWHSGWWSAKLVMWFGLTIIPFSMPSS  140

Query  523  LISFY  537
            +I  Y
Sbjct  141  IIQLY  145



>ref|XP_009102507.1| PREDICTED: probable serine incorporator isoform X1 [Brassica 
rapa]
Length=412

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ 
Sbjct  83   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDKWHSGWWSAKLIMWPALTIIPFLLPST  142

Query  523  LISFY  537
            +I  Y
Sbjct  143  IILLY  147



>ref|XP_002324973.1| TMS membrane family protein [Populus trichocarpa]
 gb|EEF03538.1| TMS membrane family protein [Populus trichocarpa]
Length=398

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 32/65 (49%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLRVSLG F F+ I+ +  +G       RD  H G W  K++ W  L I  F VP+ 
Sbjct  78   AEGVLRVSLGCFIFYIIMFLSTVGTSKLHGRRDAWHSGWWTAKIVLWISLTIITFLVPSA  137

Query  523  LISFY  537
                Y
Sbjct  138  FFQIY  142



>emb|CDX77425.1| BnaA07g05630D [Brassica napus]
Length=413

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ 
Sbjct  83   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDKWHSGWWSAKLIMWPALTIIPFLLPST  142

Query  523  LISFY  537
            +I  Y
Sbjct  143  IILLY  147



>ref|XP_009102508.1| PREDICTED: probable serine incorporator isoform X2 [Brassica 
rapa]
Length=370

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F F+ ++ +  +G       RD  H G W  K+I W  L I  F +P+ 
Sbjct  83   TEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDKWHSGWWSAKLIMWPALTIIPFLLPST  142

Query  523  LISFY  537
            +I  Y
Sbjct  143  IILLY  147



>ref|XP_010049922.1| PREDICTED: probable serine incorporator isoform X2 [Eucalyptus 
grandis]
Length=298

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 36/67 (54%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F T+ VLRVSLG FTFF I+ +  +G K     RD  H G W +K+I    L    F +P
Sbjct  80   FGTEGVLRVSLGCFTFFIIMFLSTMGTKKLHVARDLWHSGWWSIKIILLISLTAIPFLIP  139

Query  517  NELISFY  537
            +  I  Y
Sbjct  140  SSFILLY  146



>ref|XP_010049913.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049914.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049915.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049916.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049917.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049918.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049919.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049921.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 gb|KCW82744.1| hypothetical protein EUGRSUZ_C04122 [Eucalyptus grandis]
Length=402

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 36/67 (54%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
            F T+ VLRVSLG FTFF I+ +  +G K     RD  H G W +K+I    L    F +P
Sbjct  80   FGTEGVLRVSLGCFTFFIIMFLSTMGTKKLHVARDLWHSGWWSIKIILLISLTAIPFLIP  139

Query  517  NELISFY  537
            +  I  Y
Sbjct  140  SSFILLY  146



>ref|XP_006842248.1| hypothetical protein AMTR_s00078p00195500 [Amborella trichopoda]
 gb|ERN03923.1| hypothetical protein AMTR_s00078p00195500 [Amborella trichopoda]
Length=422

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            T+ VLRVSLG F FF ++ +  +G     + R+  H G W++K    F+L    F +PN 
Sbjct  102  TEGVLRVSLGGFIFFFVMFVSTVGTSKLSERRNTWHSGWWLVKTGAAFVLTPLPFLLPNV  161

Query  523  LISFY  537
            LI  Y
Sbjct  162  LIRAY  166



>ref|XP_009545469.1| hypothetical protein HETIRDRAFT_458668 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW83187.1| hypothetical protein HETIRDRAFT_458668 [Heterobasidion irregulare 
TC 32-1]
Length=493

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI  528
            AV R+      F  ILS+ +IG+K+ +D R  + +G W  KV+ WF+LV   F +PN+  
Sbjct  97   AVHRICFALSLFHAILSVGLIGVKDTRDTRAAIQNGWWGPKVLLWFVLVAISFLIPNDFF  156

Query  529  SFY  537
             F+
Sbjct  157  IFW  159



>gb|EUN26863.1| hypothetical protein COCVIDRAFT_99736 [Bipolaris victoriae FI3]
Length=488

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            AV R++     F  I+++M+IG++  KDPR  + +G W+ K+  W  +++  FF+PN 
Sbjct  97   AVQRINFALGFFHVIMALMLIGVQTSKDPRATIQNGFWLPKIFGWIGMIVLTFFIPNS  154



>ref|XP_008337449.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=398

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLRVSLG F F+  + +  +G     +PRD+   G W  K++ W   +I  F +P +
Sbjct  79   AEGVLRVSLGCFLFYFTMFLSTVGTSKLNEPRDSWQSGWWSAKIVMWVSFIIIPFVLPAK  138

Query  523  LISFY  537
            +I  Y
Sbjct  139  IIQLY  143



>gb|EMD93772.1| hypothetical protein COCHEDRAFT_1132482 [Bipolaris maydis C5]
 gb|ENH99934.1| hypothetical protein COCC4DRAFT_207119 [Bipolaris maydis ATCC 
48331]
Length=488

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            AV R++     F  I+++M+IG++  KDPR  + +G W+ K+  W  +++  FF+PN 
Sbjct  97   AVQRINFALGFFHVIMALMLIGVQTSKDPRATIQNGFWLPKIFGWIGMIVLTFFIPNS  154



>ref|XP_002841809.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ86000.1| unnamed protein product [Tuber melanosporum]
Length=481

 Score = 47.0 bits (110),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN  519
            AV R+      F  +L+ +++G+K+ K  R  + +G W  K+I W LL++  F VP 
Sbjct  96   AVHRIQFALGVFHAVLAAILVGVKSSKGGRAAIQNGYWGPKIIAWLLLIVLTFLVPE  152


 Score = 25.0 bits (53),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  194  SRRSARIAYCGLFGLSLIVSWIL  262
            S  + RIAY  LF L+ I+SWI+
Sbjct  43   SSTATRIAYALLFLLNSIISWIM  65



>ref|XP_007687418.1| hypothetical protein COCMIDRAFT_93798 [Bipolaris oryzae ATCC 
44560]
 gb|EUC46052.1| hypothetical protein COCMIDRAFT_93798 [Bipolaris oryzae ATCC 
44560]
Length=488

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +1

Query  349  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
            AV R++     F  I+++M+IG++  KDPR  + +G W+ K+  W  +++  FF+PN 
Sbjct  97   AVQRINFALGFFHVIMALMLIGVQTSKDPRATIQNGFWLPKIFGWIGMIVLTFFIPNS  154



>ref|XP_007160349.1| hypothetical protein PHAVU_002G314300g [Phaseolus vulgaris]
 ref|XP_007160350.1| hypothetical protein PHAVU_002G314300g [Phaseolus vulgaris]
 gb|ESW32343.1| hypothetical protein PHAVU_002G314300g [Phaseolus vulgaris]
 gb|ESW32344.1| hypothetical protein PHAVU_002G314300g [Phaseolus vulgaris]
Length=398

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 35/67 (52%), Gaps = 0/67 (0%)
 Frame = +1

Query  337  FETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP  516
             + + VLRVSLG F FF I+ +         + RD  H G W +K+  W ++ I  F +P
Sbjct  76   LDAEGVLRVSLGCFIFFIIMFLSTARTSKLNNVRDTWHSGWWSVKIALWVVMTIIPFLLP  135

Query  517  NELISFY  537
            +E I  Y
Sbjct  136  SEFIQIY  142



>ref|XP_009381145.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=410

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  343  TDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE  522
             + VLR+S G F FF ++ +  +G K  +D R+  H   W  K+I W   ++  FFVP+ 
Sbjct  90   AEGVLRISFGCFLFFFVMFLSTVGTKKLEDSRNFWHSEWWPAKIIIWIGFMVVPFFVPSA  149

Query  523  LISFY  537
             I FY
Sbjct  150  FIQFY  154



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645