BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF018N09

Length=594
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009616044.1|  PREDICTED: zinc finger protein 622                 209   7e-62   Nicotiana tomentosiformis
ref|XP_009800477.1|  PREDICTED: zinc finger protein 622-like            209   7e-62   Nicotiana sylvestris
ref|XP_004253056.1|  PREDICTED: zinc finger protein 622                 207   5e-61   Solanum lycopersicum
ref|XP_006342459.1|  PREDICTED: zinc finger protein 622-like            206   6e-61   Solanum tuberosum [potatoes]
gb|KJB55203.1|  hypothetical protein B456_009G068400                    195   1e-58   Gossypium raimondii
ref|XP_011082078.1|  PREDICTED: zinc finger protein 622                 198   7e-58   Sesamum indicum [beniseed]
gb|KJB55202.1|  hypothetical protein B456_009G068400                    195   1e-57   Gossypium raimondii
gb|KJB55201.1|  hypothetical protein B456_009G068400                    197   3e-57   Gossypium raimondii
gb|KHN31608.1|  Zinc finger protein                                     195   2e-56   Glycine soja [wild soybean]
ref|XP_003550140.1|  PREDICTED: zinc finger protein 622-like isof...    195   2e-56   Glycine max [soybeans]
ref|XP_010049815.1|  PREDICTED: zinc finger protein 622                 194   3e-56   Eucalyptus grandis [rose gum]
gb|KHG19598.1|  Zinc finger protein                                     194   3e-56   Gossypium arboreum [tree cotton]
gb|KHN13054.1|  Zinc finger protein                                     194   5e-56   Glycine soja [wild soybean]
ref|XP_003550141.1|  PREDICTED: zinc finger protein 622-like            193   6e-56   Glycine max [soybeans]
ref|XP_007011584.1|  Zinc finger protein 622 isoform 3                  190   8e-56   
ref|XP_003538077.1|  PREDICTED: zinc finger protein 622-like isof...    193   9e-56   Glycine max [soybeans]
ref|XP_009769243.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    192   1e-55   Nicotiana sylvestris
emb|CDP12462.1|  unnamed protein product                                192   1e-55   Coffea canephora [robusta coffee]
emb|CDP12454.1|  unnamed protein product                                192   2e-55   Coffea canephora [robusta coffee]
ref|XP_007011582.1|  Zinc finger protein 622 isoform 1                  190   8e-55   
ref|XP_010102859.1|  Zinc finger protein                                189   2e-54   Morus notabilis
ref|XP_010265409.1|  PREDICTED: zinc finger protein 622                 188   6e-54   Nelumbo nucifera [Indian lotus]
ref|XP_007161307.1|  hypothetical protein PHAVU_001G058800g             188   9e-54   Phaseolus vulgaris [French bean]
ref|XP_002527963.1|  transcription factor, putative                     187   1e-53   Ricinus communis
ref|XP_003538078.1|  PREDICTED: zinc finger protein 622-like            186   4e-53   Glycine max [soybeans]
ref|XP_010668047.1|  PREDICTED: zinc finger protein 622                 186   4e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP33442.1|  hypothetical protein JCGZ_07013                         186   6e-53   Jatropha curcas
ref|XP_008219929.1|  PREDICTED: zinc finger protein 622                 184   2e-52   Prunus mume [ume]
ref|XP_007222754.1|  hypothetical protein PRUPE_ppa006521mg             184   3e-52   Prunus persica
gb|KHG15736.1|  Zinc finger protein                                     181   1e-51   Gossypium arboreum [tree cotton]
gb|KHG15735.1|  Zinc finger protein                                     181   2e-51   Gossypium arboreum [tree cotton]
ref|XP_009363611.1|  PREDICTED: zinc finger protein 622-like            182   2e-51   Pyrus x bretschneideri [bai li]
ref|XP_009368013.1|  PREDICTED: zinc finger protein 622-like            181   2e-51   Pyrus x bretschneideri [bai li]
ref|XP_009338830.1|  PREDICTED: zinc finger protein 622-like            181   2e-51   Pyrus x bretschneideri [bai li]
ref|XP_011031356.1|  PREDICTED: zinc finger protein 622-like            181   3e-51   Populus euphratica
ref|XP_006382168.1|  zinc finger family protein                         181   3e-51   Populus trichocarpa [western balsam poplar]
ref|NP_001280881.1|  zinc finger protein 622                            181   3e-51   Malus domestica [apple tree]
gb|KJB06568.1|  hypothetical protein B456_001G001500                    180   5e-51   Gossypium raimondii
ref|XP_008352169.1|  PREDICTED: zinc finger protein 622-like            181   5e-51   
gb|KJB06566.1|  hypothetical protein B456_001G001500                    180   5e-51   Gossypium raimondii
ref|XP_004498584.1|  PREDICTED: zinc finger protein 622-like            179   1e-50   Cicer arietinum [garbanzo]
gb|EYU22071.1|  hypothetical protein MIMGU_mgv1a007393mg                179   2e-50   Erythranthe guttata [common monkey flower]
gb|KFK29727.1|  hypothetical protein AALP_AA7G170800                    179   2e-50   Arabis alpina [alpine rockcress]
ref|XP_008378248.1|  PREDICTED: zinc finger protein 622-like            179   2e-50   
gb|KHN13053.1|  Zinc finger protein 622                                 177   4e-50   Glycine soja [wild soybean]
gb|KDO67269.1|  hypothetical protein CISIN_1g015261mg                   173   4e-50   Citrus sinensis [apfelsine]
ref|XP_006404984.1|  hypothetical protein EUTSA_v10000189mg             178   4e-50   Eutrema salsugineum [saltwater cress]
ref|XP_002324955.2|  zinc finger family protein                         178   5e-50   
emb|CAN62771.1|  hypothetical protein VITISV_027109                     177   5e-50   Vitis vinifera
ref|XP_010914164.1|  PREDICTED: zinc finger protein 622-like            178   6e-50   Elaeis guineensis
ref|XP_002867303.1|  zinc finger family protein                         177   7e-50   
ref|XP_009618306.1|  PREDICTED: zinc finger protein 622-like            177   8e-50   Nicotiana tomentosiformis
emb|CBI20772.3|  unnamed protein product                                175   3e-49   Vitis vinifera
ref|XP_002282746.1|  PREDICTED: zinc finger protein 622                 176   4e-49   Vitis vinifera
gb|KDO67268.1|  hypothetical protein CISIN_1g015261mg                   173   6e-49   Citrus sinensis [apfelsine]
ref|XP_006412594.1|  hypothetical protein EUTSA_v10025366mg             175   7e-49   Eutrema salsugineum [saltwater cress]
ref|XP_010525877.1|  PREDICTED: zinc finger protein 622                 175   7e-49   Tarenaya hassleriana [spider flower]
ref|XP_006283853.1|  hypothetical protein CARUB_v10004960mg             175   8e-49   Capsella rubella
ref|XP_004291236.1|  PREDICTED: zinc finger protein 622                 174   1e-48   Fragaria vesca subsp. vesca
ref|XP_006450152.1|  hypothetical protein CICLE_v10008476mg             174   1e-48   Citrus clementina [clementine]
emb|CAA16545.1|  putative zinc finger protein                           174   2e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AFK41799.1|  unknown                                                 174   2e-48   Lotus japonicus
gb|AFK42392.1|  unknown                                                 174   2e-48   Lotus japonicus
ref|XP_004171115.1|  PREDICTED: zinc finger protein 622-like            166   4e-48   
emb|CDX68744.1|  BnaC01g07090D                                          172   6e-48   
ref|XP_011045006.1|  PREDICTED: zinc finger protein 622-like            172   6e-48   Populus euphratica
gb|AAK44084.1|AF370269_1  putative zinc finger protein                  172   8e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567875.1|  protein REI1-LIKE 1                                   172   8e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974652.1|  protein REI1-LIKE 1                                   172   8e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008794317.1|  PREDICTED: zinc finger protein 622-like            172   2e-47   Phoenix dactylifera
ref|XP_010429428.1|  PREDICTED: zinc finger protein 622-like            171   2e-47   Camelina sativa [gold-of-pleasure]
emb|CDY28267.1|  BnaA01g05820D                                          171   2e-47   Brassica napus [oilseed rape]
ref|XP_009126994.1|  PREDICTED: zinc finger protein 622                 171   2e-47   Brassica rapa
ref|XP_010472458.1|  PREDICTED: zinc finger protein 622-like            171   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010438043.1|  PREDICTED: zinc finger protein 622-like            170   5e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009140559.1|  PREDICTED: zinc finger protein 622                 170   6e-47   Brassica rapa
ref|XP_010417208.1|  PREDICTED: zinc finger protein 622-like            170   6e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010447561.1|  PREDICTED: zinc finger protein 622-like            169   7e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010432868.1|  PREDICTED: zinc finger protein 622-like            169   8e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006293479.1|  hypothetical protein CARUB_v10023355mg             169   8e-47   Capsella rubella
ref|NP_180026.1|  zinc finger domain protein REI1-LIKE 2                169   8e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006656412.1|  PREDICTED: zinc finger protein 622-like            169   1e-46   Oryza brachyantha
ref|XP_002437507.1|  hypothetical protein SORBIDRAFT_10g028300          169   1e-46   Sorghum bicolor [broomcorn]
ref|NP_001151247.1|  LOC100284880                                       169   2e-46   Zea mays [maize]
emb|CDY46155.1|  BnaA04g14430D                                          168   2e-46   Brassica napus [oilseed rape]
gb|EPS72142.1|  hypothetical protein M569_02614                         167   3e-46   Genlisea aurea
ref|XP_009117121.1|  PREDICTED: zinc finger protein 622-like            168   3e-46   Brassica rapa
emb|CDY20320.1|  BnaC04g36360D                                          168   3e-46   Brassica napus [oilseed rape]
emb|CDY34766.1|  BnaA09g41330D                                          168   3e-46   Brassica napus [oilseed rape]
gb|KEH39759.1|  C2H2-type zinc finger protein                           168   3e-46   Medicago truncatula
ref|XP_006483736.1|  PREDICTED: zinc finger protein 622-like            168   3e-46   
ref|XP_002880589.1|  hypothetical protein ARALYDRAFT_481305             167   3e-46   
gb|KFK32629.1|  hypothetical protein AALP_AA6G268300                    167   4e-46   Arabis alpina [alpine rockcress]
ref|XP_004966161.1|  PREDICTED: zinc finger protein 622-like            167   8e-46   Setaria italica
ref|XP_004136315.1|  PREDICTED: zinc finger protein 622-like            166   1e-45   Cucumis sativus [cucumbers]
gb|EEC81236.1|  hypothetical protein OsI_24290                          164   3e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_009406616.1|  PREDICTED: zinc finger protein 622-like            166   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008466318.1|  PREDICTED: zinc finger protein 622                 165   4e-45   Cucumis melo [Oriental melon]
ref|NP_001058435.1|  Os06g0693500                                       165   4e-45   
ref|XP_006845651.1|  hypothetical protein AMTR_s00019p00227240          164   5e-45   Amborella trichopoda
dbj|BAK05098.1|  predicted protein                                      159   5e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563458.1|  PREDICTED: zinc finger protein 622                 155   1e-41   Brachypodium distachyon [annual false brome]
gb|ABK25050.1|  unknown                                                 155   2e-41   Picea sitchensis
emb|CDX76808.1|  BnaC08g33940D                                          150   3e-40   
ref|XP_004966160.1|  PREDICTED: zinc finger protein 622-like            137   5e-35   Setaria italica
ref|XP_010929264.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    137   2e-34   
ref|XP_004244493.1|  PREDICTED: zinc finger protein 622                 134   4e-34   Solanum lycopersicum
ref|XP_002437508.1|  hypothetical protein SORBIDRAFT_10g028310          128   6e-33   
emb|CDX80697.1|  BnaC08g05310D                                          125   4e-32   
emb|CDX73317.1|  BnaC05g27890D                                          126   4e-32   
ref|XP_001753134.1|  predicted protein                                  121   4e-29   
ref|XP_008347704.1|  PREDICTED: zinc finger protein 622-like            113   4e-26   
ref|XP_002985761.1|  hypothetical protein SELMODRAFT_234873             112   6e-26   Selaginella moellendorffii
gb|KJB06567.1|  hypothetical protein B456_001G001500                    111   1e-25   Gossypium raimondii
ref|XP_002974456.1|  hypothetical protein SELMODRAFT_101058             110   4e-25   
gb|KDO67270.1|  hypothetical protein CISIN_1g015261mg                   103   1e-22   Citrus sinensis [apfelsine]
gb|KEH41235.1|  C2H2-type zinc finger protein                           101   1e-21   Medicago truncatula
gb|KDO38064.1|  hypothetical protein CISIN_1g042126mg                   100   1e-21   Citrus sinensis [apfelsine]
gb|EMT04737.1|  Zinc finger protein 622                               99.4    3e-21   
ref|XP_008794318.1|  PREDICTED: zinc finger protein 622-like          95.5    1e-19   Phoenix dactylifera
ref|XP_010059081.1|  PREDICTED: cytoplasmic 60S subunit biogenesi...  94.7    3e-19   
gb|AES97876.2|  hypothetical protein MTR_5g061270                     90.9    7e-19   Medicago truncatula
emb|CDX95734.1|  BnaC03g26150D                                        89.7    1e-18   
ref|XP_001779994.1|  predicted protein                                91.7    2e-18   
ref|XP_009961992.1|  PREDICTED: zinc finger protein 622               89.7    2e-18   Tyto alba [Schleiereule]
ref|XP_010149978.1|  PREDICTED: zinc finger protein 622               90.9    2e-18   Eurypyga helias
gb|KFV39278.1|  Zinc finger protein 622                               89.4    2e-18   Tyto alba [Schleiereule]
ref|XP_003614918.1|  C2H2 zinc finger protein FZF                     89.4    4e-18   
ref|XP_005010777.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  90.1    6e-18   
ref|XP_008496309.1|  PREDICTED: zinc finger protein 622               89.0    9e-18   Calypte anna
ref|XP_009955918.1|  PREDICTED: zinc finger protein 622               90.5    1e-17   Leptosomus discolor
gb|EOB07815.1|  Zinc finger protein 622                               90.1    1e-17   Anas platyrhynchos [duck]
gb|AAK97212.1|AF299386_1  putative Zn-finger protein C47L             88.6    2e-17   Gallus gallus [bantam]
sp|Q90Y35.1|ZN622_CHICK  RecName: Full=Zinc finger protein 622; A...  89.0    2e-17   Gallus gallus [bantam]
ref|XP_009882040.1|  PREDICTED: zinc finger protein 622               89.4    2e-17   Charadrius vociferus
ref|XP_010122778.1|  PREDICTED: zinc finger protein 622               89.4    2e-17   Chlamydotis macqueenii
ref|XP_003204860.1|  PREDICTED: zinc finger protein 622               89.4    3e-17   Meleagris gallopavo [common turkey]
ref|XP_010175401.1|  PREDICTED: zinc finger protein 622               89.4    3e-17   Antrostomus carolinensis
ref|XP_005484357.1|  PREDICTED: zinc finger protein 622               89.4    3e-17   Zonotrichia albicollis
ref|XP_005041707.1|  PREDICTED: zinc finger protein 622 isoform X1    89.4    3e-17   Ficedula albicollis
gb|KFO61817.1|  Zinc finger protein 622                               89.4    3e-17   Corvus brachyrhynchos
ref|NP_989461.2|  zinc finger protein 622                             89.4    3e-17   Gallus gallus [bantam]
ref|XP_009907485.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Picoides pubescens
ref|XP_009980421.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Tauraco erythrolophus
ref|XP_010193686.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Colius striatus
ref|XP_008635410.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Corvus brachyrhynchos
gb|KFR13904.1|  Zinc finger protein 622                               89.4    3e-17   Opisthocomus hoazin [hoatzin]
ref|XP_009323268.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Pygoscelis adeliae
ref|XP_008920936.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Manacus vitellinus
ref|XP_009875577.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Apaloderma vittatum
ref|XP_005530939.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_010129714.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Buceros rhinoceros silvestris
ref|XP_009679581.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Struthio camelus australis
ref|XP_009470313.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Nipponia nippon
ref|XP_009476736.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Pelecanus crispus
ref|XP_010298371.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Balearica regulorum gibbericeps
ref|XP_009572955.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Fulmarus glacialis
gb|KFP54392.1|  Zinc finger protein 622                               89.0    3e-17   Cathartes aura
ref|XP_005422625.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   
ref|XP_010185136.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Mesitornis unicolor
ref|XP_010225595.1|  PREDICTED: zinc finger protein 622 isoform X2    89.0    3e-17   Tinamus guttatus
ref|XP_009820658.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Gavia stellata
ref|XP_010225587.1|  PREDICTED: zinc finger protein 622 isoform X1    89.0    3e-17   Tinamus guttatus
ref|XP_009936853.1|  PREDICTED: zinc finger protein 622               89.0    3e-17   Opisthocomus hoazin [hoatzin]
ref|XP_009911754.1|  PREDICTED: zinc finger protein 622               89.0    4e-17   Haliaeetus albicilla
ref|XP_009286281.1|  PREDICTED: zinc finger protein 622               89.0    4e-17   Aptenodytes forsteri
gb|KFO09709.1|  Zinc finger protein 622                               89.0    4e-17   Balearica regulorum gibbericeps
ref|XP_010014921.1|  PREDICTED: zinc finger protein 622               89.0    4e-17   Nestor notabilis
gb|KFQ84619.1|  Zinc finger protein 622                               89.0    4e-17   Phoenicopterus ruber ruber
ref|XP_009505834.1|  PREDICTED: zinc finger protein 622               88.6    4e-17   Phalacrocorax carbo [common cormorant]
gb|KFO96100.1|  Zinc finger protein 622                               88.6    4e-17   Calypte anna
ref|XP_008937252.1|  PREDICTED: zinc finger protein 622               88.6    4e-17   Merops nubicus
ref|XP_010291352.1|  PREDICTED: zinc finger protein 622               88.6    4e-17   Phaethon lepturus
gb|KFZ65667.1|  Zinc finger protein 622                               88.6    5e-17   Podiceps cristatus
ref|XP_010003388.1|  PREDICTED: zinc finger protein 622               88.6    5e-17   Chaetura pelagica
ref|XP_010084783.1|  PREDICTED: zinc finger protein 622               88.2    5e-17   Pterocles gutturalis
ref|XP_009568575.1|  PREDICTED: zinc finger protein 622               88.2    6e-17   Cuculus canorus
ref|XP_005498025.1|  PREDICTED: zinc finger protein 622 isoform X1    88.2    6e-17   Columba livia [carrier pigeon]
ref|XP_005153414.1|  PREDICTED: zinc finger protein 622               88.2    7e-17   Melopsittacus undulatus
ref|XP_005235847.1|  PREDICTED: zinc finger protein 622               88.2    7e-17   Falco peregrinus [peregrine]
ref|XP_008166808.1|  PREDICTED: zinc finger protein 622 isoform X3    87.4    9e-17   
ref|XP_004175197.1|  PREDICTED: zinc finger protein 622               87.4    1e-16   Taeniopygia guttata
ref|XP_009702614.1|  PREDICTED: zinc finger protein 622               87.4    1e-16   Cariama cristata
ref|XP_009636175.1|  PREDICTED: zinc finger protein 622               87.4    1e-16   Egretta garzetta
ref|XP_005290262.1|  PREDICTED: zinc finger protein 622 isoform X2    87.4    1e-16   Chrysemys picta bellii
ref|XP_006027689.1|  PREDICTED: zinc finger protein 622 isoform X1    87.4    1e-16   Alligator sinensis
ref|XP_006027690.1|  PREDICTED: zinc finger protein 622 isoform X2    87.4    1e-16   Alligator sinensis
ref|XP_006261028.1|  PREDICTED: zinc finger protein 622 isoform X2    87.4    1e-16   
ref|XP_006261027.1|  PREDICTED: zinc finger protein 622 isoform X1    87.0    1e-16   
ref|XP_009076748.1|  PREDICTED: zinc finger protein 622               87.0    2e-16   Acanthisitta chloris
ref|XP_005290261.1|  PREDICTED: zinc finger protein 622 isoform X1    87.0    2e-16   Chrysemys picta bellii
emb|CAJ83907.1|  zinc finger protein 622                              84.3    2e-16   Xenopus tropicalis [western clawed frog]
gb|KIJ18836.1|  hypothetical protein PAXINDRAFT_127953                86.3    3e-16   Paxillus involutus ATCC 200175
gb|EMP28578.1|  hypothetical protein UY3_14325                        85.5    3e-16   Chelonia mydas [green seaturtle]
ref|XP_009094102.1|  PREDICTED: zinc finger protein 622               86.3    3e-16   Serinus canaria [canary]
ref|XP_008611697.1|  hypothetical protein SDRG_07629                  85.1    4e-16   Saprolegnia diclina VS20
ref|XP_006126163.1|  PREDICTED: zinc finger protein 622-like isof...  85.9    4e-16   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006126162.1|  PREDICTED: zinc finger protein 622-like isof...  85.5    5e-16   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_007067500.1|  PREDICTED: zinc finger protein 622               85.1    1e-15   
ref|XP_003466756.1|  PREDICTED: zinc finger protein 622 isoform X1    84.3    1e-15   
gb|KFO24852.1|  Zinc finger protein 622                               84.3    1e-15   Fukomys damarensis [Damara mole rat]
ref|XP_005002366.1|  PREDICTED: zinc finger protein 622 isoform X2    84.3    1e-15   Cavia porcellus [guinea pig]
ref|XP_010642309.1|  PREDICTED: zinc finger protein 622               84.3    1e-15   Fukomys damarensis [Damara mole rat]
ref|XP_003759684.1|  PREDICTED: zinc finger protein 622               84.0    2e-15   
ref|XP_003340644.1|  PREDICTED: zinc finger protein 622               84.3    2e-15   Monodelphis domestica
ref|XP_005002367.1|  PREDICTED: zinc finger protein 622 isoform X3    84.0    2e-15   
ref|XP_010398489.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  84.0    2e-15   
ref|XP_001200563.1|  PREDICTED: zinc finger protein 622-like          83.6    2e-15   Strongylocentrotus purpuratus [purple urchin]
ref|XP_004583683.1|  PREDICTED: zinc finger protein 622               83.6    3e-15   Ochotona princeps [southern American pika]
ref|XP_004078799.1|  PREDICTED: zinc finger protein 622               83.2    3e-15   Oryzias latipes [Japanese rice fish]
ref|XP_007577180.1|  PREDICTED: zinc finger protein 622               83.2    3e-15   Poecilia formosa
ref|NP_001011460.1|  zinc finger protein 622                          83.2    4e-15   Xenopus tropicalis [western clawed frog]
ref|XP_008819991.1|  PREDICTED: zinc finger protein 622 isoform X2    82.8    4e-15   
ref|XP_005796649.1|  PREDICTED: zinc finger protein 622-like          82.8    4e-15   Xiphophorus maculatus
ref|XP_008433012.1|  PREDICTED: zinc finger protein 622               82.8    5e-15   Poecilia reticulata
gb|KDO30833.1|  hypothetical protein SPRG_04734                       82.0    5e-15   Saprolegnia parasitica CBS 223.65
ref|XP_004641912.1|  PREDICTED: zinc finger protein 622-like          82.8    5e-15   
ref|XP_004644793.1|  PREDICTED: zinc finger protein 622               82.8    5e-15   Octodon degus
ref|XP_005386190.1|  PREDICTED: zinc finger protein 622 isoform X1    82.8    6e-15   Chinchilla lanigera
ref|XP_005386191.1|  PREDICTED: zinc finger protein 622 isoform X2    82.4    6e-15   
emb|CDQ00177.1|  Protein Bm13985, isoform a                           81.6    6e-15   
ref|XP_008819990.1|  PREDICTED: zinc finger protein 622 isoform X1    82.4    7e-15   Nannospalax galili
ref|XP_001899722.1|  Zinc finger, C2H2 type family protein            81.6    7e-15   Brugia malayi [agent of lymphatic filariasis]
ref|XP_004845257.1|  PREDICTED: zinc finger protein 622               81.6    1e-14   Heterocephalus glaber [naked mole rat]
ref|XP_004884669.1|  PREDICTED: zinc finger protein 622               81.6    1e-14   
ref|XP_789492.3|  PREDICTED: zinc finger protein 622-like             81.6    1e-14   Strongylocentrotus purpuratus [purple urchin]
gb|AAO13531.1|  zinc finger protein Yan                               81.6    1e-14   Bufo gargarizans [Chusan Island toad]
ref|XP_005319724.1|  PREDICTED: zinc finger protein 622               81.6    1e-14   Ictidomys tridecemlineatus
ref|XP_003287650.1|  hypothetical protein DICPUDRAFT_91955            78.2    1e-14   Dictyostelium purpureum
sp|Q7TM96.2|ZN622_RAT  RecName: Full=Zinc finger protein 622; Alt...  80.5    2e-14   Rattus norvegicus [brown rat]
ref|XP_001830498.1|  cytoplasmic protein                              81.3    2e-14   Coprinopsis cinerea okayama7#130
ref|XP_010742488.1|  PREDICTED: zinc finger protein 622               81.3    2e-14   
gb|EPY72545.1|  zinc finger protein 622                               80.5    2e-14   Camelus ferus
ref|XP_006804666.1|  PREDICTED: zinc finger protein 622-like          80.5    2e-14   Neolamprologus brichardi [lyretail cichlid]
gb|EDL82619.1|  zinc finger protein 622, isoform CRA_a                80.1    2e-14   Rattus norvegicus [brown rat]
gb|EJD75085.1|  hypothetical protein LOAG_17697                       79.7    3e-14   Loa loa
ref|XP_635923.1|  C2H2-type zinc finger-containing protein            80.1    3e-14   Dictyostelium discoideum AX4
ref|NP_001009652.1|  zinc finger protein 622                          80.5    3e-14   Rattus norvegicus [brown rat]
ref|XP_006591049.1|  PREDICTED: zinc finger protein 622-like isof...  79.3    3e-14   Glycine max [soybeans]
ref|XP_008260303.1|  PREDICTED: zinc finger protein 622               80.5    3e-14   
ref|XP_007959442.1|  PREDICTED: zinc finger protein 622               80.5    3e-14   Chlorocebus sabaeus
ref|XP_003310680.1|  PREDICTED: zinc finger protein 622               80.5    3e-14   Pan troglodytes
ref|XP_002815490.1|  PREDICTED: zinc finger protein 622               80.5    3e-14   
ref|XP_010354635.1|  PREDICTED: zinc finger protein 622               80.5    3e-14   Rhinopithecus roxellana
ref|XP_003821988.1|  PREDICTED: zinc finger protein 622               80.5    3e-14   Pan paniscus [bonobo]
ref|NP_219482.1|  zinc finger protein 622                             80.5    3e-14   Homo sapiens [man]
ref|XP_003263222.1|  PREDICTED: zinc finger protein 622               80.1    3e-14   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_003899566.1|  PREDICTED: zinc finger protein 622 isoform X2    80.1    4e-14   Papio anubis [baboon]
ref|XP_004059066.1|  PREDICTED: zinc finger protein 622               80.1    4e-14   
ref|XP_005356713.1|  PREDICTED: zinc finger protein 622               80.1    4e-14   Microtus ochrogaster [prairie voles]
ref|XP_006165305.1|  PREDICTED: zinc finger protein 622               80.1    4e-14   Tupaia chinensis
ref|NP_001247620.1|  zinc finger protein 622                          80.1    4e-14   Macaca mulatta [rhesus macaque]
ref|XP_005556671.1|  PREDICTED: zinc finger protein 622               80.1    4e-14   Macaca fascicularis [crab eating macaque]
ref|XP_009206444.1|  PREDICTED: zinc finger protein 622 isoform X1    80.1    4e-14   Papio anubis [baboon]
gb|AAP78750.1|  Ac1133                                                80.9    4e-14   Rattus norvegicus [brown rat]
gb|EPY75340.1|  zinc finger protein 622                               79.0    5e-14   Camelus ferus
gb|ELU13958.1|  hypothetical protein CAPTEDRAFT_174182                79.3    5e-14   Capitella teleta
ref|XP_007950095.1|  PREDICTED: zinc finger protein 622               79.3    5e-14   Orycteropus afer afer
ref|XP_006928161.1|  PREDICTED: zinc finger protein 622               79.7    5e-14   Felis catus [cat]
ref|XP_006192295.1|  PREDICTED: zinc finger protein 622               79.3    5e-14   
ref|XP_004453979.1|  PREDICTED: zinc finger protein 622               79.7    5e-14   Dasypus novemcinctus
ref|NP_001079501.1|  zinc finger protein 622                          79.7    5e-14   Xenopus laevis [clawed frog]
gb|ETL81695.1|  hypothetical protein L917_18045                       79.3    5e-14   Phytophthora parasitica
ref|XP_007092986.1|  PREDICTED: zinc finger protein 622               79.7    5e-14   Panthera tigris altaica
ref|XP_005081365.1|  PREDICTED: zinc finger protein 622               79.7    6e-14   Mesocricetus auratus [Syrian golden hamster]
ref|XP_005993558.1|  PREDICTED: zinc finger protein 622               79.7    6e-14   
ref|XP_001917283.1|  PREDICTED: zinc finger protein 622               79.7    6e-14   Equus caballus [domestic horse]
ref|XP_006895073.1|  PREDICTED: zinc finger protein 622               79.7    6e-14   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_002924578.1|  PREDICTED: zinc finger protein 622               79.7    6e-14   Ailuropoda melanoleuca
ref|XP_008688114.1|  PREDICTED: zinc finger protein 622               79.3    7e-14   Ursus maritimus [white bear]
ref|XP_008515981.1|  PREDICTED: zinc finger protein 622               79.3    7e-14   Equus przewalskii [Przewalski horse]
ref|XP_003452821.1|  PREDICTED: zinc finger protein 622-like          79.3    7e-14   Oreochromis niloticus
ref|XP_005746379.1|  PREDICTED: zinc finger protein 622-like isof...  79.3    7e-14   Pundamilia nyererei
ref|XP_004569509.1|  PREDICTED: zinc finger protein 622-like          79.3    7e-14   Maylandia zebra
ref|XP_005934147.1|  PREDICTED: zinc finger protein 622-like isof...  79.3    7e-14   Haplochromis burtoni
ref|XP_005934148.1|  PREDICTED: zinc finger protein 622-like isof...  79.3    8e-14   Haplochromis burtoni
ref|XP_004408395.1|  PREDICTED: zinc finger protein 622               79.3    8e-14   Odobenus rosmarus divergens
gb|ERE84924.1|  zinc finger protein                                   79.3    8e-14   Cricetulus griseus [Chinese hamsters]
ref|XP_003504730.1|  PREDICTED: zinc finger protein 622               79.3    8e-14   Cricetulus griseus [Chinese hamsters]
ref|XP_006981814.1|  PREDICTED: zinc finger protein 622-like          78.2    8e-14   
ref|XP_006751222.1|  PREDICTED: zinc finger protein 622               79.0    9e-14   
ref|XP_010980281.1|  PREDICTED: zinc finger protein 622               79.0    9e-14   
ref|XP_010955570.1|  PREDICTED: zinc finger protein 622               79.0    9e-14   
ref|XP_007623607.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  79.0    9e-14   
ref|XP_006190394.1|  PREDICTED: zinc finger protein 622-like          79.0    9e-14   
ref|XP_006081639.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  78.6    1e-13   
gb|ERE84923.1|  zinc finger protein                                   79.0    1e-13   
gb|KDR13107.1|  hypothetical protein L798_13036                       78.2    1e-13   
ref|XP_005874550.1|  PREDICTED: zinc finger protein 622               79.0    1e-13   
gb|KIO10058.1|  hypothetical protein M404DRAFT_231026                 78.2    1e-13   
ref|XP_002161600.1|  PREDICTED: zinc finger protein 622-like          78.2    1e-13   
ref|XP_008864373.1|  hypothetical protein H310_02589                  78.2    1e-13   
ref|XP_005694911.1|  PREDICTED: zinc finger protein 622               78.6    1e-13   
ref|NP_001029623.1|  zinc finger protein 622                          78.6    2e-13   
ref|XP_005898604.1|  PREDICTED: zinc finger protein 622               78.2    2e-13   
ref|XP_006981815.1|  PREDICTED: zinc finger protein 622-like          78.2    2e-13   
ref|XP_006073019.1|  PREDICTED: zinc finger protein 622               78.2    2e-13   
ref|XP_004017190.1|  PREDICTED: zinc finger protein 622               78.2    2e-13   
dbj|GAN09385.1|  zinc finger protein 622-like isoform 1               77.8    2e-13   
ref|XP_003219852.1|  PREDICTED: zinc finger protein 622               78.2    2e-13   
ref|XP_010857102.1|  PREDICTED: zinc finger protein 622               78.6    2e-13   
ref|XP_006769510.1|  PREDICTED: zinc finger protein 622               78.2    2e-13   
ref|XP_005968236.1|  PREDICTED: zinc finger protein 622               78.6    2e-13   
ref|XP_001019296.2|  Zinc finger, C2H2 type family protein            78.2    2e-13   
ref|XP_002174832.1|  ribosome biogenesis protein                      78.2    2e-13   
ref|XP_008896708.1|  hypothetical protein PPTG_05012                  78.2    2e-13   
ref|XP_004422744.1|  PREDICTED: zinc finger protein 622               78.2    2e-13   
gb|KJB55204.1|  hypothetical protein B456_009G068400                  77.0    2e-13   
ref|XP_003408198.1|  PREDICTED: zinc finger protein 622               78.2    2e-13   
ref|XP_008333285.1|  PREDICTED: zinc finger protein 622               77.8    2e-13   
ref|XP_006907186.1|  PREDICTED: zinc finger protein 622               77.8    2e-13   
gb|EFA84046.1|  C2H2-type zinc finger-containing protein              77.0    2e-13   
ref|NP_001080550.1|  zinc finger protein 622                          77.8    2e-13   
ref|XP_008577870.1|  PREDICTED: zinc finger protein 622               77.8    3e-13   
emb|CEP14792.1|  hypothetical protein                                 77.0    3e-13   
ref|XP_002121361.2|  PREDICTED: zinc finger protein 622 isoform X2    77.4    3e-13   
ref|XP_009858925.1|  PREDICTED: zinc finger protein 622 isoform X1    77.4    3e-13   
ref|XP_002391275.1|  hypothetical protein MPER_09320                  74.7    3e-13   
ref|XP_004761265.1|  PREDICTED: zinc finger protein 622               77.4    3e-13   
ref|NP_001274046.1|  zinc finger protein 622                          77.4    3e-13   
ref|NP_001279303.1|  zinc finger protein 622                          77.4    3e-13   
ref|NP_001133295.1|  Zinc finger protein 622                          77.4    3e-13   
ref|XP_002745142.1|  PREDICTED: zinc finger protein 622               77.4    3e-13   
ref|XP_008046880.1|  PREDICTED: zinc finger protein 622               77.4    4e-13   
ref|XP_007188302.1|  PREDICTED: zinc finger protein 622               77.4    4e-13   
ref|XP_004274525.1|  PREDICTED: zinc finger protein 622               77.0    4e-13   
ref|XP_002907194.1|  conserved hypothetical protein                   77.0    4e-13   
ref|XP_007520611.1|  PREDICTED: zinc finger protein 622               77.0    4e-13   
ref|XP_007448952.1|  PREDICTED: zinc finger protein 622               77.0    4e-13   
ref|XP_006874501.1|  PREDICTED: zinc finger protein 622               77.0    4e-13   
gb|EPB86158.1|  hypothetical protein HMPREF1544_07060                 76.6    4e-13   
ref|XP_004314109.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  77.0    5e-13   
gb|KIK41514.1|  hypothetical protein CY34DRAFT_200753                 76.6    5e-13   
ref|XP_008149889.1|  PREDICTED: zinc finger protein 622               76.6    5e-13   
ref|XP_007102404.1|  PREDICTED: zinc finger protein 622               76.6    6e-13   
ref|XP_007426935.1|  PREDICTED: zinc finger protein 622               76.6    6e-13   
gb|KIH45555.1|  zinc finger, C2H2 type                                76.3    6e-13   
ref|XP_011211994.1|  PREDICTED: zinc finger protein 622               76.3    6e-13   
ref|XP_004678120.1|  PREDICTED: zinc finger protein 622               76.6    6e-13   
ref|XP_010955569.1|  PREDICTED: zinc finger protein 622-like          76.6    6e-13   
ref|XP_010980280.1|  PREDICTED: zinc finger protein 622-like          76.6    6e-13   
emb|CDQ66047.1|  unnamed protein product                              76.6    7e-13   
ref|XP_694322.6|  PREDICTED: zinc finger protein 622                  76.3    8e-13   
ref|XP_001877316.1|  predicted protein                                76.3    8e-13   
gb|EHK44731.1|  hypothetical protein TRIATDRAFT_318333                76.3    8e-13   
gb|KFH73074.1|  hypothetical protein MVEG_00299                       75.9    8e-13   
ref|XP_007863917.1|  hypothetical protein GLOTRDRAFT_38020            76.3    9e-13   
gb|KDQ57570.1|  hypothetical protein JAAARDRAFT_130649                76.3    9e-13   
gb|EHK26903.1|  hypothetical protein TRIVIDRAFT_79452                 76.3    9e-13   
ref|XP_007317838.1|  hypothetical protein SERLADRAFT_466249           73.2    9e-13   
dbj|BAE41831.1|  unnamed protein product                              74.7    9e-13   
gb|EYB86217.1|  hypothetical protein Y032_0283g1324                   75.9    9e-13   
gb|EYB86221.1|  hypothetical protein Y032_0283g1324                   75.9    1e-12   
gb|EYB86218.1|  hypothetical protein Y032_0283g1324                   75.9    1e-12   
gb|EGO00154.1|  hypothetical protein SERLA73DRAFT_53506               73.2    1e-12   
gb|EYB86219.1|  hypothetical protein Y032_0283g1324                   75.9    1e-12   
gb|EYB86220.1|  hypothetical protein Y032_0283g1324                   75.9    1e-12   
ref|XP_009854425.1|  hypothetical protein NEUTE1DRAFT_87820           76.3    1e-12   
ref|XP_957637.1|  C2H2 finger domain-containing protein               76.3    1e-12   
gb|KIK67107.1|  hypothetical protein GYMLUDRAFT_850880                75.5    1e-12   
gb|ETE73362.1|  Zinc finger protein                                   75.9    1e-12   
gb|KIK03531.1|  hypothetical protein K443DRAFT_94942                  75.5    1e-12   
ref|NP_588107.1|  ribosome biogenesis protein (predicted)             75.5    1e-12   
ref|XP_006968714.1|  predicted protein                                75.9    1e-12   
ref|XP_002108682.1|  hypothetical protein TRIADDRAFT_18203            75.1    1e-12   
ref|XP_008302898.1|  PREDICTED: zinc finger protein 622               76.6    1e-12   
gb|KIK27094.1|  hypothetical protein PISMIDRAFT_221233                75.5    1e-12   
ref|XP_003976225.1|  PREDICTED: zinc finger protein 622-like          75.5    1e-12   
gb|KIJ49659.1|  hypothetical protein M422DRAFT_74674                  75.5    1e-12   
ref|XP_005090744.1|  PREDICTED: zinc finger protein 622-like isof...  75.1    1e-12   
ref|XP_005090745.1|  PREDICTED: zinc finger protein 622-like isof...  74.7    2e-12   
ref|XP_001742523.1|  hypothetical protein                             75.1    2e-12   
emb|CEF64072.1|  Zinc finger protein 622                              74.7    2e-12   
ref|XP_008556264.1|  PREDICTED: zinc finger protein 622               74.7    2e-12   
ref|XP_004384106.1|  PREDICTED: zinc finger protein 622               75.1    2e-12   
ref|XP_005344971.1|  PREDICTED: zinc finger protein 622-like          74.7    2e-12   
dbj|GAM22238.1|  hypothetical protein SAMD00019534_054130             73.9    2e-12   
ref|XP_003942957.1|  PREDICTED: zinc finger protein 622               74.7    2e-12   
gb|AAH68406.1|  Znf622 protein                                        74.7    3e-12   
ref|XP_009844345.1|  hypothetical protein H257_17308                  74.3    3e-12   
ref|XP_007361755.1|  hypothetical protein DICSQDRAFT_51405            74.7    3e-12   
ref|XP_007847745.1|  zinc finger protein 622-like protein             74.3    3e-12   
ref|XP_010891189.1|  PREDICTED: zinc finger protein 622               74.7    3e-12   
dbj|BAE32946.1|  unnamed protein product                              74.3    3e-12   
ref|NP_653106.1|  zinc finger protein 622                             74.3    3e-12   
emb|CDO76715.1|  hypothetical protein BN946_scf184796.g9              74.7    3e-12   
gb|AAH55386.1|  Znf622 protein                                        74.3    4e-12   
gb|ENH80071.1|  C2H2 type zinc finger containing protein              74.3    4e-12   
ref|XP_008718725.1|  hypothetical protein HMPREF1541_06167            74.3    4e-12   
ref|XP_002591925.1|  hypothetical protein BRAFLDRAFT_122363           73.6    5e-12   
emb|CDH48403.1|  cytoplasmic protein                                  73.6    5e-12   
emb|CCU82627.1|  hypothetical protein BGHDH14_bgh03899                73.9    6e-12   
gb|KEZ39501.1|  Uncharacterized protein SAPIO_CDS9367                 73.9    6e-12   
ref|XP_001991278.1|  GH12142                                          73.2    6e-12   
emb|CDS03646.1|  hypothetical protein LRAMOSA01048                    73.2    6e-12   
gb|KIJ67668.1|  hypothetical protein HYDPIDRAFT_25147                 73.6    7e-12   
ref|XP_009047384.1|  hypothetical protein LOTGIDRAFT_238085           73.2    7e-12   
ref|XP_003029938.1|  hypothetical protein SCHCODRAFT_258113           73.6    7e-12   
gb|EXX52426.1|  Reh1p                                                 72.8    7e-12   
ref|XP_011194146.1|  PREDICTED: zinc finger protein 622               73.2    8e-12   
ref|XP_003350193.1|  hypothetical protein SMAC_01085                  73.6    8e-12   
ref|XP_001634569.1|  predicted protein                                72.4    9e-12   
gb|EPZ32019.1|  Zinc finger, C2H2 domain-containing protein           72.4    1e-11   
gb|KDQ27858.1|  hypothetical protein PLEOSDRAFT_1040521               72.8    1e-11   
ref|XP_009650675.1|  zinc finger protein                              73.2    1e-11   
ref|XP_003001654.1|  zinc finger protein Yan                          73.2    1e-11   
gb|KHJ80273.1|  zinc finger, C2H2 type                                72.4    1e-11   
gb|EJW82200.1|  zinc finger protein                                   72.0    1e-11   
gb|KIY50188.1|  hypothetical protein FISHEDRAFT_39351                 72.4    1e-11   
emb|CEJ94662.1|  Putative Rei1p                                       72.8    1e-11   
emb|CDS05029.1|  hypothetical protein LRAMOSA07558                    72.0    1e-11   
ref|XP_006814072.1|  PREDICTED: zinc finger protein 622-like          72.4    2e-11   
gb|EPQ67856.1|  Cytoplasmic pre-60S factor                            72.8    2e-11   
ref|XP_009216083.1|  pre-60S factor REI1                              72.8    2e-11   
emb|CEP08407.1|  hypothetical protein                                 72.0    2e-11   
gb|KHJ32345.1|  putative c2h2 type zinc finger containing protein     72.4    2e-11   
gb|EIE80006.1|  hypothetical protein RO3G_04711                       72.8    2e-11   
dbj|GAK65063.1|  zinc finger protein 622-like protein                 72.4    2e-11   
ref|XP_008484842.1|  PREDICTED: zinc finger protein 622               71.6    2e-11   
gb|EFQ30316.1|  zinc finger protein Yan                               72.4    2e-11   
gb|KDN61525.1|  putative zinc finger protein Yan                      72.4    2e-11   
gb|EKC21927.1|  hypothetical protein CGI_10003071                     70.9    2e-11   
ref|XP_394767.2|  PREDICTED: zinc finger protein 622-like isoform 1   71.6    2e-11   
gb|EPB85511.1|  hypothetical protein HMPREF1544_07694                 71.6    2e-11   
emb|CEI89163.1|  hypothetical protein RMCBS344292_03531               71.6    2e-11   
emb|CEG80213.1|  hypothetical protein RMATCC62417_14582               71.6    2e-11   
gb|KDQ21695.1|  hypothetical protein BOTBODRAFT_211054                72.0    2e-11   
emb|CEG66819.1|  hypothetical protein RMATCC62417_03335               71.6    2e-11   
ref|XP_004605671.1|  PREDICTED: zinc finger protein 622               72.0    2e-11   
gb|EPY50605.1|  ribosome biogenesis protein                           71.6    2e-11   
dbj|GAA94204.1|  hypothetical protein E5Q_00852                       72.8    2e-11   
gb|EQK98526.1|  C2H2 type zinc finger containing protein              72.0    3e-11   
gb|ERG82798.1|  zinc finger protein                                   71.2    3e-11   
gb|KIM61601.1|  hypothetical protein SCLCIDRAFT_121644                71.6    3e-11   
ref|XP_003397931.1|  PREDICTED: zinc finger protein 622-like          71.2    3e-11   
emb|CAF97796.1|  unnamed protein product                              71.6    3e-11   
emb|CCF34110.1|  zinc finger protein Yan                              72.0    3e-11   
ref|XP_002835389.1|  hypothetical protein                             71.2    3e-11   
gb|EPX70960.1|  ribosome biogenesis protein                           71.6    3e-11   
ref|XP_007595933.1|  zinc finger protein Yan                          71.6    3e-11   
gb|KFA50954.1|  hypothetical protein S40293_02501                     71.6    3e-11   
ref|XP_011415469.1|  PREDICTED: zinc finger protein 622-like isof...  71.2    3e-11   
gb|KFY70311.1|  hypothetical protein V499_09274                       70.9    3e-11   
ref|XP_004995052.1|  zinc finger protein                              71.2    3e-11   
ref|XP_003690358.1|  PREDICTED: zinc finger protein 622-like          70.9    3e-11   
ref|XP_002426959.1|  conserved hypothetical protein                   70.9    3e-11   
emb|CCE35073.1|  related to YBR267w                                   71.6    3e-11   
emb|CCM73228.1|  CNB00600p                                            71.2    3e-11   
ref|XP_002022791.1|  GL14756                                          71.2    3e-11   
gb|EKC21925.1|  hypothetical protein CGI_10003069                     70.9    4e-11   
emb|CDH51532.1|  c2h2-type zinc finger-containing protein             70.9    4e-11   
ref|XP_006616919.1|  PREDICTED: zinc finger protein 622-like          70.9    4e-11   
dbj|GAN03081.1|  zinc finger protein 622-like protein                 70.9    4e-11   
gb|KIO31262.1|  hypothetical protein M407DRAFT_19641                  70.9    4e-11   
gb|ETS62591.1|  cytoplasmic protein                                   71.2    4e-11   
dbj|GAC74702.1|  C2H2-type Zn-finger protein                          71.2    4e-11   
emb|CCA66358.1|  hypothetical protein PIIN_00044                      70.9    4e-11   
gb|KIW59452.1|  hypothetical protein PV05_03900                       71.2    4e-11   
gb|KHN74226.1|  Zinc finger protein                                   71.2    5e-11   
ref|XP_002058088.1|  GJ15890                                          70.9    5e-11   
gb|ACZ81464.1|  CNB00600                                              70.9    5e-11   
gb|KDB10897.1|  C2H2 type zinc finger containing protein              71.6    5e-11   
gb|KFA64512.1|  hypothetical protein S40285_08920                     71.2    5e-11   
gb|EFX85155.1|  putative zinc finger protein                          70.5    5e-11   
emb|CBQ71182.1|  conserved hypothetical protein                       70.9    5e-11   
ref|XP_006634511.1|  PREDICTED: zinc finger protein 622-like          70.9    5e-11   
gb|KFA74887.1|  hypothetical protein S40288_06486                     70.9    6e-11   
gb|KEY64134.1|  hypothetical protein S7711_07479                      70.9    6e-11   
ref|XP_003700140.1|  PREDICTED: zinc finger protein 622-like          70.5    6e-11   
ref|XP_002415922.1|  ribosome biogenesis protein, putative            70.1    6e-11   
dbj|GAN02743.1|  conserved hypothetical protein                       70.1    6e-11   
ref|XP_002071631.1|  GK25039                                          70.1    7e-11   
ref|XP_007275944.1|  C2H2 type zinc finger domain-containing protein  70.9    7e-11   
gb|EQB43655.1|  zinc finger protein Yan                               70.9    7e-11   
gb|KIM31463.1|  hypothetical protein M408DRAFT_15209                  70.5    7e-11   
ref|XP_007761640.1|  hypothetical protein A1O7_09462                  70.5    8e-11   
dbj|GAC98590.1|  potential zinc finger protein                        70.5    8e-11   
gb|KHN31605.1|  Zinc finger protein 622                               69.7    8e-11   
gb|EGU86618.1|  hypothetical protein FOXB_02839                       70.5    8e-11   
emb|CEI90237.1|  hypothetical protein RMCBS344292_04565               69.7    8e-11   
emb|CCG83073.1|  Ribosome biogenesis protein                          70.1    8e-11   
gb|KIR76857.1|  pre-60S factor REI1                                   70.1    8e-11   
gb|EXK31550.1|  hypothetical protein FOMG_12089                       70.5    8e-11   
gb|KIR57743.1|  pre-60S factor REI1                                   70.1    8e-11   
gb|EWY96164.1|  hypothetical protein FOYG_04978                       70.5    8e-11   
gb|KIR83425.1|  pre-60S factor REI1                                   70.1    8e-11   
gb|EXL87506.1|  hypothetical protein FOPG_01693                       70.5    8e-11   
ref|XP_003192418.1|  mitotic signaling network protein involved i...  70.1    9e-11   
ref|XP_002011085.1|  GI16198                                          69.7    9e-11   
gb|KJE01412.1|  pre-60S factor REI1                                   70.1    9e-11   
gb|ENH65694.1|  hypothetical protein FOC1_g10005228                   70.5    9e-11   
gb|KIR45014.1|  pre-60S factor REI1                                   70.1    9e-11   
gb|KGB80285.1|  cytoplasm protein                                     70.1    9e-11   
gb|EMT60255.1|  hypothetical protein FOC4_g10011522                   70.5    9e-11   
ref|XP_569070.1|  cytoplasm protein                                   69.7    9e-11   
ref|XP_005709239.1|  zinc finger (C2H2 type) family protein           69.3    9e-11   
ref|XP_007786062.1|  hypothetical protein EPUS_08721                  70.9    9e-11   
gb|AFR93058.1|  pre-60S factor REI1                                   69.7    1e-10   
ref|XP_007309615.1|  hypothetical protein STEHIDRAFT_67289            70.1    1e-10   
dbj|BAN20557.1|  conserved hypothetical protein                       69.3    1e-10   



>ref|XP_009616044.1| PREDICTED: zinc finger protein 622 [Nicotiana tomentosiformis]
Length=415

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 150/186 (81%), Gaps = 3/186 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGL+CNAC+KEF DD EQKLHYKSEWHRYNLKRK+AGV GV E +FLARQS +AEEKKK
Sbjct  1    MPGLSCNACDKEFLDDTEQKLHYKSEWHRYNLKRKIAGVHGVREHIFLARQSALAEEKKK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ETP++Y+CG+CGK YRSSQA++QHLKSKSHL +ASQEP H+ EN V I+PL R   + 
Sbjct  61   LSETPLIYSCGLCGKGYRSSQAHAQHLKSKSHLARASQEPGHHDENSVTIKPLLRHPQNG  120

Query  405  STQQVee--dideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNM-QDADMDDY  575
            ++++ +E  +  +  +  E E  + +EE ++EA+DSL +L++NEHTSNGNM +D+D+D+ 
Sbjct  121  TSRKAKEYGEESDDSDESEWEEVDPEEEMISEATDSLTELKMNEHTSNGNMDEDSDVDED  180

Query  576  SEELDP  593
              +LDP
Sbjct  181  IGDLDP  186



>ref|XP_009800477.1| PREDICTED: zinc finger protein 622-like [Nicotiana sylvestris]
Length=415

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 149/186 (80%), Gaps = 3/186 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGL+CNAC+KEF DD EQKLHYKSEWHRYNLKRK+AGV GV E +FLARQS +AEEKKK
Sbjct  1    MPGLSCNACDKEFLDDTEQKLHYKSEWHRYNLKRKIAGVHGVREHIFLARQSALAEEKKK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ETP++Y+CG+CGK YRSSQA++QHLKSKSHL +ASQEP H+ EN V I+PL R   + 
Sbjct  61   LSETPLIYSCGLCGKGYRSSQAHAQHLKSKSHLARASQEPGHHDENSVTIKPLLRHPQNG  120

Query  405  STQQVe--edideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNM-QDADMDDY  575
            ++++ +   +  +  +  E E  + +EE ++EA+DSL +L++NEHTSNGNM +D+D+D+ 
Sbjct  121  TSRKAKEYVEESDDSDESEWEEVDPEEEMISEATDSLTELKMNEHTSNGNMDEDSDVDED  180

Query  576  SEELDP  593
              +LDP
Sbjct  181  IGDLDP  186



>ref|XP_004253056.1| PREDICTED: zinc finger protein 622 [Solanum lycopersicum]
Length=415

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 143/186 (77%), Gaps = 3/186 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNAC+KEF DD EQKLHYKSEWHRYNLKRKVAGVPGV E +FLARQ+ +AEEK+K
Sbjct  1    MPGLTCNACDKEFVDDTEQKLHYKSEWHRYNLKRKVAGVPGVRETIFLARQAALAEEKEK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ETP+LY CG+C KEYRSS+A++QHLKSKSHL +ASQ+P H  EN V I+PL R   + 
Sbjct  61   LSETPLLYACGLCDKEYRSSKAHAQHLKSKSHLARASQQPGHPNENSVTIKPLLRHPRNE  120

Query  405  STQQVeedideseeseeseweevd---eedmaeasdsLMQLQLNEHTSNGNMQDADMDDY  575
            ++++ +ED+ E  +  +    E     EE ++EA+DSL  L+++EHTSNGNM +   D+Y
Sbjct  121  TSRKAKEDVIEENDESDESEWEEVDPDEEMISEATDSLTDLKMDEHTSNGNMDEDSDDEY  180

Query  576  SEELDP  593
               LDP
Sbjct  181  VGNLDP  186



>ref|XP_006342459.1| PREDICTED: zinc finger protein 622-like [Solanum tuberosum]
Length=414

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 153/185 (83%), Gaps = 2/185 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGL+CNAC+KEF DD EQKLHYKSEWHRYNLKRKVAGVPGV E +FLARQ+ +AEEK+K
Sbjct  1    MPGLSCNACDKEFVDDTEQKLHYKSEWHRYNLKRKVAGVPGVRETIFLARQAALAEEKEK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ETP+LY CG+C KEYRSS+A++QHLKSKSHL +ASQ+P H  EN V I+P  R   + 
Sbjct  61   LSETPLLYACGLCDKEYRSSKAHAQHLKSKSHLARASQQPGHPNENSVTIKPFLRHPRNE  120

Query  405  STQQVeedideseeseeseweev--deedmaeasdsLMQLQLNEHTSNGNMQDADMDDYS  578
            ++++ +E+I+E++ES+ESEWEEV  DEE ++EA+DSL  L++NEHTSNGNM +   D+Y 
Sbjct  121  TSRKAKEEIEENDESDESEWEEVDPDEEMISEATDSLTDLKMNEHTSNGNMDEDSDDEYV  180

Query  579  EELDP  593
              LDP
Sbjct  181  GNLDP  185



>gb|KJB55203.1| hypothetical protein B456_009G068400 [Gossypium raimondii]
Length=237

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF DDA+QKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQS +A+EK+K
Sbjct  1    MPGLTCNACNKEFLDDADQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQSALAQEKEK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              ETPMLY+CGVCGK YRSS+AYSQHLKS++H+++ASQ  NH  E + II+PL R  +++
Sbjct  61   QNETPMLYSCGVCGKGYRSSKAYSQHLKSRAHIMQASQGTNHPQEVKAIIKPLPRRTVNK  120

Query  405  STQ  413
              Q
Sbjct  121  PPQ  123



>ref|XP_011082078.1| PREDICTED: zinc finger protein 622 [Sesamum indicum]
Length=411

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF D+ EQKLHYKSEWHRYNLKRKVAGVPGVTE LFLARQS +AEE++K
Sbjct  1    MPGLTCNACNKEFVDEVEQKLHYKSEWHRYNLKRKVAGVPGVTETLFLARQSALAEERRK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPI  395
            L ETPM+Y+CG+CGKEYRS +A++QHLKSKSHL++AS+ P  NG    II+PLQR +
Sbjct  61   LDETPMVYSCGLCGKEYRSPKAHAQHLKSKSHLMRASETPTSNGAGSTIIKPLQRRV  117



>gb|KJB55202.1| hypothetical protein B456_009G068400 [Gossypium raimondii]
Length=311

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF DDA+QKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQS +A+EK+K
Sbjct  1    MPGLTCNACNKEFLDDADQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQSALAQEKEK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              ETPMLY+CGVCGK YRSS+AYSQHLKS++H+++ASQ  NH  E + II+PL R  +++
Sbjct  61   QNETPMLYSCGVCGKGYRSSKAYSQHLKSRAHIMQASQGTNHPQEVKAIIKPLPRRTVNK  120

Query  405  STQ  413
              Q
Sbjct  121  PPQ  123



>gb|KJB55201.1| hypothetical protein B456_009G068400 [Gossypium raimondii]
 gb|KJB55205.1| hypothetical protein B456_009G068400 [Gossypium raimondii]
Length=407

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF DDA+QKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQS +A+EK+K
Sbjct  1    MPGLTCNACNKEFLDDADQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQSALAQEKEK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              ETPMLY+CGVCGK YRSS+AYSQHLKS++H+++ASQ  NH  E + II+PL R  +++
Sbjct  61   QNETPMLYSCGVCGKGYRSSKAYSQHLKSRAHIMQASQGTNHPQEVKAIIKPLPRRTVNK  120

Query  405  STQ  413
              Q
Sbjct  121  PPQ  123



>gb|KHN31608.1| Zinc finger protein [Glycine soja]
Length=407

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 142/184 (77%), Gaps = 5/184 (3%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EFKDD EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSV+A+EK K
Sbjct  1    MPGLTCNACNTEFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L ETPMLYTCG+CGK+Y+SS+A+++HLKS+ H+++AS+  +H  E + I++PL + +++R
Sbjct  61   LGETPMLYTCGLCGKDYKSSKAHAEHLKSRGHMMRASEGTSHADE-KAIVKPLPQRVVNR  119

Query  405  ST-QQVeedideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNMQDADMDDYSE  581
               ++  ++ +  E  +E E  + +E+ +  A+ SL  L +NEH  N +M+   +DD  E
Sbjct  120  PPPRREVDNSENEESEDEWEEVDPEEDLVDGAAKSLTDLNVNEHGENVDME---VDDDFE  176

Query  582  ELDP  593
            ELDP
Sbjct  177  ELDP  180



>ref|XP_003550140.1| PREDICTED: zinc finger protein 622-like isoform X1 [Glycine max]
 ref|XP_006601093.1| PREDICTED: zinc finger protein 622-like isoform X2 [Glycine max]
Length=407

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 142/184 (77%), Gaps = 5/184 (3%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EFKDD EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSV+A+EK K
Sbjct  1    MPGLTCNACNTEFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L ETPMLYTCG+CGK+Y+SS+A+++HLKS+ H+++AS+  +H  E + I++PL + +++R
Sbjct  61   LGETPMLYTCGLCGKDYKSSKAHAEHLKSRGHMMRASEGTSHADE-KAIVKPLPQRVVNR  119

Query  405  ST-QQVeedideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNMQDADMDDYSE  581
               ++  ++ +  E  +E E  + +E+ +  A+ SL  L +NEH  N +M+   +DD  E
Sbjct  120  PPPRREVDNSENEESEDEWEEVDPEEDLVDGAAKSLTDLNVNEHGENVDME---VDDDFE  176

Query  582  ELDP  593
            ELDP
Sbjct  177  ELDP  180



>ref|XP_010049815.1| PREDICTED: zinc finger protein 622 [Eucalyptus grandis]
 gb|KCW82616.1| hypothetical protein EUGRSUZ_C04005 [Eucalyptus grandis]
Length=414

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF+DDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQ+ +A+EKKK
Sbjct  1    MPGLTCNACNKEFEDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQAALAQEKKK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
             ++TPMLY+CG+CGK YRS +A++QHL+S+SH+L+ASQ  N     + IIRPL   +  R
Sbjct  61   SSQTPMLYSCGICGKGYRSDKAHAQHLQSRSHILRASQGVNLEDGEKTIIRPLAPRVQSR  120

Query  405  -STQQVeedideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNMQDADMDDYSE  581
             + Q+     +  +  +E E  + +++ + EA++SL ++ ++E +++ +M+D   DD   
Sbjct  121  PAPQKESGMAESEDSEDEWEEVDSEDDLVGEAANSLSEMNVDELSTDHHMEDGSDDDDFG  180

Query  582  ELDP  593
            E+DP
Sbjct  181  EVDP  184



>gb|KHG19598.1| Zinc finger protein [Gossypium arboreum]
Length=407

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF DDA+QKLHYKS+WHRYNLKRKVAGVPGV EALFLARQS +A+EK+K
Sbjct  1    MPGLTCNACNKEFLDDADQKLHYKSDWHRYNLKRKVAGVPGVMEALFLARQSALAQEKEK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              ETPMLY+CGVCGK YRSS+AYSQHLKS++H+++ASQ  NH  E + II+PL R  + +
Sbjct  61   QNETPMLYSCGVCGKGYRSSKAYSQHLKSRAHIMQASQGTNHPQEVKAIIKPLPRRTVSK  120

Query  405  STQ  413
              Q
Sbjct  121  PPQ  123



>gb|KHN13054.1| Zinc finger protein [Glycine soja]
Length=405

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 142/184 (77%), Gaps = 5/184 (3%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN +FKDD EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSV+A+EK K
Sbjct  1    MPGLTCNACNTKFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L ETPMLYTCG+CGK+Y+SS+A+++HLKS+ H+++AS+  +H  E + I++PL + +++R
Sbjct  61   LGETPMLYTCGLCGKDYKSSKAHAEHLKSRGHMMRASEGTSHADE-KAIVKPLPQRVVNR  119

Query  405  ST-QQVeedideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNMQDADMDDYSE  581
               ++  ++ +  E  +E E  + +E+ +  A+ SL  L +NEH  N +M+   +DD  E
Sbjct  120  PPPRREVDNSENEESEDEWEEVDPEEDLVDGAAKSLTDLNVNEHGENVDME---VDDDFE  176

Query  582  ELDP  593
            ELDP
Sbjct  177  ELDP  180



>ref|XP_003550141.1| PREDICTED: zinc finger protein 622-like [Glycine max]
Length=407

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 142/184 (77%), Gaps = 5/184 (3%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN +FKDD EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSV+A+EK K
Sbjct  1    MPGLTCNACNTKFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L ETPMLYTCG+CGK+Y+SS+A+++HLKS+ H+++AS+  +H  E + I++PL + +++R
Sbjct  61   LGETPMLYTCGLCGKDYKSSKAHAEHLKSRGHMMRASEGTSHADE-KAIVKPLPQRVVNR  119

Query  405  ST-QQVeedideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNMQDADMDDYSE  581
               ++  ++ +  E  +E E  + +E+ +  A+ SL  L +NEH  N +M+   +DD  E
Sbjct  120  PPPKREVDNSENEESEDEWEEVDPEEDLVDGAAKSLTDLNVNEHGENVDME---VDDDFE  176

Query  582  ELDP  593
            ELDP
Sbjct  177  ELDP  180



>ref|XP_007011584.1| Zinc finger protein 622 isoform 3 [Theobroma cacao]
 gb|EOY29203.1| Zinc finger protein 622 isoform 3 [Theobroma cacao]
Length=286

 Score =   190 bits (482),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEFKDDAEQKLHY+S+WHRYNLKRKVAGVPGVTEALFLARQS +A+EK K
Sbjct  1    MPGLTCNACNKEFKDDAEQKLHYRSDWHRYNLKRKVAGVPGVTEALFLARQSALAQEKDK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              ETPMLY+CG+CGK YRSS+A++QHL S++H+++ASQ  N+  E + II+PL R  +++
Sbjct  61   RNETPMLYSCGLCGKGYRSSKAHAQHLNSRTHVMRASQGTNNPEEEKAIIKPLPRCAVNK  120

Query  405  STQ  413
              Q
Sbjct  121  PPQ  123



>ref|XP_003538077.1| PREDICTED: zinc finger protein 622-like isoform X1 [Glycine max]
Length=407

 Score =   193 bits (490),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 142/184 (77%), Gaps = 5/184 (3%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EFKDD EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSV+A+EK K
Sbjct  1    MPGLTCNACNTEFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L ETPMLY+CG+CGK+Y+SS+A+++HLKS+ H+++AS+  +H  E + I++PL + +++R
Sbjct  61   LGETPMLYSCGLCGKDYKSSKAHAEHLKSRGHMMQASEGTSHADE-KAIVKPLPQRVVNR  119

Query  405  ST-QQVeedideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNMQDADMDDYSE  581
               ++  ++ +  E  +E E  + +E+ +  A+ SL  L +NEH  N +M+   +DD  E
Sbjct  120  PPPRREVDNSENEESEDEWEEVDPEEDLVDGAAKSLTDLNVNEHGENVDME---VDDDFE  176

Query  582  ELDP  593
            ELDP
Sbjct  177  ELDP  180



>ref|XP_009769243.1| PREDICTED: LOW QUALITY PROTEIN: cytoplasmic 60S subunit biogenesis 
factor SPCC550.15c [Nicotiana sylvestris]
Length=412

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 141/188 (75%), Gaps = 10/188 (5%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GL CNACNKEF  + EQKLHYKSEWH YNLKRKVAGVPG+TEALF+ARQS +AEE ++
Sbjct  1    MRGLACNACNKEFFYENEQKLHYKSEWHHYNLKRKVAGVPGLTEALFIARQSALAEENRR  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQR----P  392
            L+ETP+LY+CG CGKEYRSS+A++QHL+SKSHL +AS+EP H+ EN VII+PL R     
Sbjct  61   LSETPLLYSCGNCGKEYRSSKAHAQHLQSKSHLARASREPGHHYENSVIIKPLPRQPSHE  120

Query  393  ILDRSTQQVeedideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNM-QDADMD  569
              DR+ + +        +  E E  + +EE + EA+ SL QL++N  T NG + +D+D+D
Sbjct  121  PSDRADEDI-----NGSDESEWEEVDSEEEMVGEATISLNQLKMNGSTPNGTIDEDSDLD  175

Query  570  DYSEELDP  593
            ++ +ELDP
Sbjct  176  EHIDELDP  183



>emb|CDP12462.1| unnamed protein product [Coffea canephora]
Length=379

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 136/184 (74%), Gaps = 3/184 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF+D+ EQKLHYKSEWHRYNLKRKVAGVPGVTE L+LARQS +AEEKK 
Sbjct  1    MPGLTCNACNKEFQDEIEQKLHYKSEWHRYNLKRKVAGVPGVTEDLYLARQSALAEEKKN  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQE-PNHNGENRVIIRPLQRPILD  401
            L ETPMLY+CG+CGK YRSS+A++QHLKSKSH L+ASQ   NH G N  II+P Q P + 
Sbjct  61   LNETPMLYSCGLCGKSYRSSKAHAQHLKSKSHSLRASQGVGNHEGAN-AIIKPFQ-PRVP  118

Query  402  RSTQQVeedideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNMQDADMDDYSE  581
                Q  E  DE  E  E E  + +E+ M EA+DSL QL +NE  S    + +D D + +
Sbjct  119  NKLSQDNELDDEESEESEWEEVDPEEDLMGEATDSLTQLNMNEQNSMDEDEGSDPDQFLK  178

Query  582  ELDP  593
            ELDP
Sbjct  179  ELDP  182



>emb|CDP12454.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 136/184 (74%), Gaps = 3/184 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF+D+ EQKLHYKSEWHRYNLKRKVAGVPGVTE L+LARQS +AEEKK 
Sbjct  1    MPGLTCNACNKEFQDEIEQKLHYKSEWHRYNLKRKVAGVPGVTEDLYLARQSALAEEKKN  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQE-PNHNGENRVIIRPLQRPILD  401
            L ETPMLY+CG+CGK YRSS+A++QHLKSKSH L+ASQ   NH G N  II+P Q P + 
Sbjct  61   LNETPMLYSCGLCGKSYRSSKAHAQHLKSKSHSLRASQGVGNHEGAN-AIIKPFQ-PRVP  118

Query  402  RSTQQVeedideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNMQDADMDDYSE  581
                Q  E  DE  E  E E  + +E+ M EA+DSL QL +NE  S    + +D D + +
Sbjct  119  NKLSQDNELDDEESEESEWEEVDPEEDLMGEATDSLTQLNMNEQNSMDEDEGSDPDQFLK  178

Query  582  ELDP  593
            ELDP
Sbjct  179  ELDP  182



>ref|XP_007011582.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
 ref|XP_007011583.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
 gb|EOY29201.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
 gb|EOY29202.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
Length=407

 Score =   190 bits (483),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEFKDDAEQKLHY+S+WHRYNLKRKVAGVPGVTEALFLARQS +A+EK K
Sbjct  1    MPGLTCNACNKEFKDDAEQKLHYRSDWHRYNLKRKVAGVPGVTEALFLARQSALAQEKDK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              ETPMLY+CG+CGK YRSS+A++QHL S++H+++ASQ  N+  E + II+PL R  +++
Sbjct  61   RNETPMLYSCGLCGKGYRSSKAHAQHLNSRTHVMRASQGTNNPEEEKAIIKPLPRCAVNK  120

Query  405  STQ  413
              Q
Sbjct  121  PPQ  123



>ref|XP_010102859.1| Zinc finger protein [Morus notabilis]
 ref|XP_010111936.1| Zinc finger protein [Morus notabilis]
 gb|EXB94240.1| Zinc finger protein [Morus notabilis]
 gb|EXC32054.1| Zinc finger protein [Morus notabilis]
Length=410

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF DD+E KLHYKSEWHRYNLKRKVA VPGVTEALFL RQS +A+EK K
Sbjct  1    MPGLTCNACNKEFTDDSELKLHYKSEWHRYNLKRKVADVPGVTEALFLTRQSALAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ETPMLY+CG+CGK YRSS+A++QHL+S+SH+ +AS   NH  E R II+PL R + ++
Sbjct  61   LSETPMLYSCGLCGKGYRSSKAHAQHLQSRSHITRASHGTNHEDEERAIIKPLPRRVANK  120



>ref|XP_010265409.1| PREDICTED: zinc finger protein 622 [Nelumbo nucifera]
Length=404

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF DD +QKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQS +AEE+ K
Sbjct  1    MPGLTCNACNKEFGDDLQQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSALAEEQNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPN-HNGENRVIIRPLQRPILD  401
            L ETPMLY+CG+CGK YRSS+A++QHLKS++H+++ASQ  + H      IIRPL   + +
Sbjct  61   LNETPMLYSCGLCGKAYRSSKAHAQHLKSRTHIMRASQTTDGHQIVGDTIIRPLPNRVTN  120

Query  402  RSTQQ  416
            +S Q+
Sbjct  121  KSPQE  125



>ref|XP_007161307.1| hypothetical protein PHAVU_001G058800g [Phaseolus vulgaris]
 gb|ESW33301.1| hypothetical protein PHAVU_001G058800g [Phaseolus vulgaris]
Length=413

 Score =   188 bits (477),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 105/120 (88%), Gaps = 1/120 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EFKDD EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIA+EK K
Sbjct  1    MPGLTCNACNAEFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ETPMLY+CG+CGK+Y+S +A+++HLKS+ H+++AS E     + + II+PL + +++R
Sbjct  61   LSETPMLYSCGLCGKDYKSYKAHAEHLKSRGHMMRAS-EGTSGADEKAIIKPLPQRVVNR  119



>ref|XP_002527963.1| transcription factor, putative [Ricinus communis]
 gb|EEF34375.1| transcription factor, putative [Ricinus communis]
Length=407

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GLTCNACNKEF DDA+QKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQSV+ +EK K
Sbjct  1    MGGLTCNACNKEFNDDADQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQSVLVQEKDK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
             +ETPMLY+C +CGK YRSS+A++QHLKS+SH+L+ASQ  N N E+  +I+PL R I+++
Sbjct  61   SSETPMLYSCVLCGKGYRSSKAHAQHLKSRSHILRASQGANEN-EDTAVIKPLPRRIMNK  119

Query  405  STQQ  416
               Q
Sbjct  120  RPPQ  123



>ref|XP_003538078.1| PREDICTED: zinc finger protein 622-like [Glycine max]
Length=407

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 104/120 (87%), Gaps = 1/120 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EFKDD EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSV+A+EK K
Sbjct  1    MPGLTCNACNTEFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L ETPMLY CG+CGK+Y+SS+A+++HLKS+ H+++AS E     + + I++PL + +++R
Sbjct  61   LGETPMLYCCGLCGKDYKSSKAHAEHLKSRGHMMRAS-EGTSQADEKAIVKPLPQRVVNR  119



>ref|XP_010668047.1| PREDICTED: zinc finger protein 622 [Beta vulgaris subsp. vulgaris]
Length=404

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF DD +QKLHYKSEWHRYNLKRK+AGVPGVTEAL+LARQS + EEK+K
Sbjct  1    MPGLTCNACNKEFTDDFDQKLHYKSEWHRYNLKRKIAGVPGVTEALYLARQSALDEEKEK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQR  389
            L   PMLY+CG+CGK YRSS+A++QHL+SKSH+++ASQ  N+  E+  II+PL R
Sbjct  61   LNAAPMLYSCGLCGKGYRSSKAHAQHLESKSHIMRASQGVNNQNEDNTIIKPLPR  115



>gb|KDP33442.1| hypothetical protein JCGZ_07013 [Jatropha curcas]
Length=408

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEFKDD EQKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQS +A+EK  
Sbjct  1    MPGLTCNACNKEFKDDTEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQSALAQEKDN  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              E+PMLY+C +CGK YRSS+A++QHLKS+SH+++ASQ    + E+R +I+PLQR  + +
Sbjct  61   SNESPMLYSCILCGKGYRSSKAHAQHLKSRSHIMRASQGTTQD-EDRAVIKPLQRHAMSK  119



>ref|XP_008219929.1| PREDICTED: zinc finger protein 622 [Prunus mume]
Length=408

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKE  DDAEQKLHYKSEWHRYNLKRKVAGVPGVTE LF+ARQ  +A+EK  
Sbjct  1    MPGLTCNACNKELADDAEQKLHYKSEWHRYNLKRKVAGVPGVTETLFIARQDALAQEKNG  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ETPMLY+CG+CGK YRSS+A+++HLKS+SH+L+ASQ  + + E + IIRPL   ++++
Sbjct  61   LSETPMLYSCGLCGKGYRSSKAHAEHLKSRSHILRASQGTS-DQEEKAIIRPLPSRVVNK  119

Query  405  S  407
            +
Sbjct  120  A  120



>ref|XP_007222754.1| hypothetical protein PRUPE_ppa006521mg [Prunus persica]
 gb|EMJ23953.1| hypothetical protein PRUPE_ppa006521mg [Prunus persica]
Length=408

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKE  DDAEQKLHYKSEWHRYNLKRKVAGVPGVTE LF+ARQ  +A+EK  
Sbjct  1    MPGLTCNACNKELVDDAEQKLHYKSEWHRYNLKRKVAGVPGVTETLFIARQDALAQEKNG  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ETPMLY+CG+CGK YRSS+A+++HLKS+SH+L+ASQ  + + E + IIRPL   ++++
Sbjct  61   LSETPMLYSCGLCGKGYRSSKAHAEHLKSRSHILRASQGTS-DQEEKAIIRPLPSRVVNK  119

Query  405  S  407
            +
Sbjct  120  A  120



>gb|KHG15736.1| Zinc finger protein [Gossypium arboreum]
Length=372

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN+EF D+AE+KLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ +AEEK K
Sbjct  1    MPGLTCNACNREFLDEAERKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQTALAEEKDK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              ETPMLY+CG+CGK YRSS+AYSQHLKS++H+ + SQ P    E   II+P  R  +++
Sbjct  61   QNETPMLYSCGLCGKGYRSSKAYSQHLKSRAHIAQTSQHPEE--EKAAIIKPFIRRAVNK  118

Query  405  STQ  413
              Q
Sbjct  119  PPQ  121



>gb|KHG15735.1| Zinc finger protein [Gossypium arboreum]
Length=392

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN+EF D+AE+KLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ +AEEK K
Sbjct  1    MPGLTCNACNREFLDEAERKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQTALAEEKDK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              ETPMLY+CG+CGK YRSS+AYSQHLKS++H+ + SQ P    E   II+P  R  +++
Sbjct  61   QNETPMLYSCGLCGKGYRSSKAYSQHLKSRAHIAQTSQHPEE--EKAAIIKPFIRRAVNK  118

Query  405  STQ  413
              Q
Sbjct  119  PPQ  121



>ref|XP_009363611.1| PREDICTED: zinc finger protein 622-like [Pyrus x bretschneideri]
Length=405

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GLTCN+CNKEF DD+EQKLHYKSEWHRYNLKRKVAGVPGVTEALF+ARQ+ +A+EK  
Sbjct  1    MSGLTCNSCNKEFLDDSEQKLHYKSEWHRYNLKRKVAGVPGVTEALFIARQAALAQEKNN  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ETPMLY+CG+CGK YRSS+A+++HLKS+SH+L+ASQ  +   E + IIRPL   ++++
Sbjct  61   LSETPMLYSCGLCGKGYRSSKAHAEHLKSRSHILRASQGASEQ-EEKAIIRPLPPRVVNK  119

Query  405  S  407
            +
Sbjct  120  A  120



>ref|XP_009368013.1| PREDICTED: zinc finger protein 622-like [Pyrus x bretschneideri]
Length=405

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GLTCN+CNKEF DD+EQKLHYKSEWHRYNLKRKVAGVPGVTEALF+ARQ+ +A+EK  
Sbjct  1    MSGLTCNSCNKEFLDDSEQKLHYKSEWHRYNLKRKVAGVPGVTEALFIARQAALAQEKNN  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ETPMLY+CG+CGK YRSS+A+++HLKS+SH+L+ASQ  +   E + IIRPL   ++++
Sbjct  61   LSETPMLYSCGLCGKGYRSSKAHAEHLKSRSHILRASQGASEQ-EEKAIIRPLPPRVVNK  119

Query  405  S  407
            +
Sbjct  120  A  120



>ref|XP_009338830.1| PREDICTED: zinc finger protein 622-like [Pyrus x bretschneideri]
Length=405

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GLTCN+CNKEF DD+EQKLHYKSEWHRYNLKRKVAGVPGVTEALF+ARQ+ +A+EK  
Sbjct  1    MSGLTCNSCNKEFLDDSEQKLHYKSEWHRYNLKRKVAGVPGVTEALFIARQAALAQEKNS  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ETPMLY+CG+CGK YRSS+A+++HLKS+SH+L+ASQ  +   E + IIRPL   ++++
Sbjct  61   LSETPMLYSCGLCGKGYRSSKAHAEHLKSRSHILRASQGASEQ-EEKPIIRPLPSRVVNK  119

Query  405  S  407
            +
Sbjct  120  A  120



>ref|XP_011031356.1| PREDICTED: zinc finger protein 622-like [Populus euphratica]
Length=408

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF DDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF+ARQS IA+EK+K
Sbjct  1    MPGLTCNACNKEFDDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFVARQSAIAKEKEK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              ETPMLY+C +C K YRSS+A+ QHLKS+SH+L+ASQ  N   EN  +I+PL R  +++
Sbjct  61   -NETPMLYSCVLCNKGYRSSKAHDQHLKSRSHILRASQGTNQEEEN-TVIKPLPRREVNK  118

Query  405  STQQ  416
               Q
Sbjct  119  RVVQ  122



>ref|XP_006382168.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP59965.1| zinc finger family protein [Populus trichocarpa]
Length=408

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF DDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF+ARQS IA+EK+K
Sbjct  1    MPGLTCNACNKEFDDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFVARQSAIAKEKEK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              ETPMLY+C +C K YRSS+A+ QHLKS+SH+L+ASQ  N   EN  +I+PL R  +++
Sbjct  61   -NETPMLYSCVLCNKGYRSSKAHDQHLKSRSHILRASQGTNQEEEN-TVIKPLPRREVNK  118

Query  405  STQQ  416
               Q
Sbjct  119  RVVQ  122



>ref|NP_001280881.1| zinc finger protein 622 [Malus domestica]
 gb|ADL36644.1| C2H2L domain class transcription factor [Malus domestica]
Length=405

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GLTCN+CNKEF DD+EQKLHYKSEWHRYNLKRK+AGVPGVTEALF+ARQ+ +A+EK  
Sbjct  1    MSGLTCNSCNKEFLDDSEQKLHYKSEWHRYNLKRKIAGVPGVTEALFIARQAALAQEKNS  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ETPMLY+CG+CGK YRSS+A+++HLKS+SH+L+ASQ  +   E + IIRPL   ++++
Sbjct  61   LSETPMLYSCGLCGKGYRSSKAHAEHLKSRSHILRASQGASEQ-EEKAIIRPLPPRVVNK  119

Query  405  S  407
            +
Sbjct  120  A  120



>gb|KJB06568.1| hypothetical protein B456_001G001500 [Gossypium raimondii]
Length=390

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN+EF D+AE+KLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ +AEEK K
Sbjct  1    MPGLTCNACNREFLDEAERKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAEEKDK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              ETPMLY+CG+C K YRSS+AYSQHLKS++H+ +ASQ P    E   II+P  R  +++
Sbjct  61   QNETPMLYSCGLCDKGYRSSKAYSQHLKSRAHIAQASQHPEE--EKAAIIKPFIRRAVNK  118

Query  405  STQ  413
              Q
Sbjct  119  PPQ  121



>ref|XP_008352169.1| PREDICTED: zinc finger protein 622-like [Malus domestica]
Length=434

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GLTCN+CNKEF DD+EQKLHYKSEWHRYNLKRK+AGVPGVTEALF+ARQ+ +A+EK  
Sbjct  1    MSGLTCNSCNKEFLDDSEQKLHYKSEWHRYNLKRKIAGVPGVTEALFIARQAALAQEKNS  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ETPMLY+CG+CGK YRSS+A+++HLKS+SH+L+ASQ  +   E + IIRPL   ++++
Sbjct  61   LSETPMLYSCGLCGKGYRSSKAHAEHLKSRSHILRASQGASEQ-EEKAIIRPLPPRVVNK  119

Query  405  S  407
            +
Sbjct  120  A  120



>gb|KJB06566.1| hypothetical protein B456_001G001500 [Gossypium raimondii]
Length=392

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN+EF D+AE+KLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ +AEEK K
Sbjct  1    MPGLTCNACNREFLDEAERKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAEEKDK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              ETPMLY+CG+C K YRSS+AYSQHLKS++H+ +ASQ P    E   II+P  R  +++
Sbjct  61   QNETPMLYSCGLCDKGYRSSKAYSQHLKSRAHIAQASQHPEE--EKAAIIKPFIRRAVNK  118

Query  405  STQ  413
              Q
Sbjct  119  PPQ  121



>ref|XP_004498584.1| PREDICTED: zinc finger protein 622-like [Cicer arietinum]
Length=410

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 105/120 (88%), Gaps = 1/120 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGL+CNACN EF DDA+QKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQS +A EK K
Sbjct  1    MPGLSCNACNTEFNDDADQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSALALEKDK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              ETPMLY+CG+CGK Y+SS+A+++HLKS++H+++AS+  +H+ + + II+PL + ++++
Sbjct  61   SNETPMLYSCGLCGKGYKSSKAHAEHLKSRTHMMRASEGASHS-DGKAIIKPLPQRVVNK  119



>gb|EYU22071.1| hypothetical protein MIMGU_mgv1a007393mg [Erythranthe guttata]
Length=409

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EF DD +QKLHYKSEWHRYNLKRKVAGVPGVTE LF+ARQS IAEE+  
Sbjct  1    MPGLTCNACNTEFLDDVDQKLHYKSEWHRYNLKRKVAGVPGVTETLFIARQSAIAEERGN  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQR  389
            L  TPM+Y+CG CGK YRSS+A++QHL+SKSHL+  S+      E   II+PL+R
Sbjct  61   LNVTPMMYSCGFCGKGYRSSKAHAQHLQSKSHLITVSEATGGKDEGSTIIKPLRR  115



>gb|KFK29727.1| hypothetical protein AALP_AA7G170800 [Arabis alpina]
Length=399

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EF+D+AE+  HYKS+WHRYNLKRKVAGVPGVTE LF ARQS +A EK K
Sbjct  1    MPGLTCNACNMEFEDEAERGFHYKSDWHRYNLKRKVAGVPGVTEELFEARQSALASEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRV-IIRPLQRPILD  401
              E PMLYTCG+CGK YRSS+A+ QHLKS+SH L+ SQ  + NGE  + IIRPL R + +
Sbjct  61   SDEVPMLYTCGICGKGYRSSKAHEQHLKSRSHALRVSQGTSSNGEEDIAIIRPLTRRVNN  120

Query  402  RSTQ  413
            R  +
Sbjct  121  RDNE  124



>ref|XP_008378248.1| PREDICTED: zinc finger protein 622-like [Malus domestica]
Length=405

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GLTCN+CNKEF DD+EQKLHYKSEWHRYNLKRKVAGVPGVTEALF+ARQ+ +A+EK  
Sbjct  1    MSGLTCNSCNKEFLDDSEQKLHYKSEWHRYNLKRKVAGVPGVTEALFIARQAALAQEKNG  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+E PMLY+CG+CGK YRSS+A+++HLKS+SH+L+ASQ  +   E + IIRPL   ++++
Sbjct  61   LSEXPMLYSCGLCGKGYRSSKAHAEHLKSRSHILRASQGASEQ-EEKPIIRPLPSRVVNK  119

Query  405  S  407
            +
Sbjct  120  T  120



>gb|KHN13053.1| Zinc finger protein 622 [Glycine soja]
Length=346

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EFKDD EQKLHYK EWHRYNLKRKVAGVPGVTEALFLARQSV+A+EK K
Sbjct  1    MPGLTCNACNTEFKDDTEQKLHYKPEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRV  368
            L ETPMLY CG+CGK+Y+SS+A+++HLKS+ H+++AS+  +   E  +
Sbjct  61   LGETPMLYCCGLCGKDYKSSKAHAEHLKSRGHMMRASEGTSQADEKAI  108



>gb|KDO67269.1| hypothetical protein CISIN_1g015261mg [Citrus sinensis]
Length=233

 Score =   173 bits (439),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 101/119 (85%), Gaps = 3/119 (3%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCN+CN+EF DDAEQKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ +A+EK K
Sbjct  1    MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILD  401
               TPM Y+CG+CGK YRSS+A +QHL S+SH+++ASQ  ++  + +VII+P+  P+ D
Sbjct  61   -NATPMTYSCGLCGKGYRSSKALAQHLNSRSHIMRASQGTSNEEKEKVIIKPI--PLRD  116



>ref|XP_006404984.1| hypothetical protein EUTSA_v10000189mg [Eutrema salsugineum]
 dbj|BAJ34463.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46437.1| hypothetical protein EUTSA_v10000189mg [Eutrema salsugineum]
Length=403

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GL CN+CNKEF+DDAEQKLHYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ IA+EK K
Sbjct  1    MSGLACNSCNKEFEDDAEQKLHYKSEWHRYNLKRKIAGVPGVTEALFEARQAAIAQEKVK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNG-ENRVIIRPL  383
              E P+LY+CG+CGK YRSS+A+ QHLKSKSH+LKAS +   NG E++ II+ L
Sbjct  61   SNEAPLLYSCGICGKGYRSSKAHEQHLKSKSHVLKASSQGTSNGDEDKAIIKQL  114



>ref|XP_002324955.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF03520.2| zinc finger family protein [Populus trichocarpa]
Length=407

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF DDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF+ARQS IA+EK+K
Sbjct  1    MPGLTCNACNKEFNDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFVARQSAIAKEKEK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              E PMLY+C +C K Y+SS+A+ QHLKS+SH+L+ASQ  N   EN VI +  +R +  R
Sbjct  61   -NEIPMLYSCVLCNKGYQSSKAHDQHLKSRSHILRASQGTNQEEENTVIKQLPRREVNKR  119

Query  405  STQ  413
            + Q
Sbjct  120  AVQ  122



>emb|CAN62771.1| hypothetical protein VITISV_027109 [Vitis vinifera]
Length=374

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M  LTCNACNKEF  ++EQKLHYKS+WHRYNLKRK+AGVPGVTEAL+LARQS +AEEK +
Sbjct  1    MATLTCNACNKEFIGESEQKLHYKSDWHRYNLKRKIAGVPGVTEALYLARQSSLAEEKNR  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
            L ETPMLY+C +CGK YRSS+A  QHLKS+SH+L+ASQ  +H  E   II+PL
Sbjct  61   LNETPMLYSCSLCGKGYRSSKALGQHLKSRSHILRASQRASHQDEETTIIKPL  113



>ref|XP_010914164.1| PREDICTED: zinc finger protein 622-like [Elaeis guineensis]
Length=418

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP LTCNACNKEF D+ EQKLHY+SEWHRYNLKRKVAGVPGVTEALF ARQS +AEE+ K
Sbjct  1    MPVLTCNACNKEFHDEVEQKLHYRSEWHRYNLKRKVAGVPGVTEALFQARQSALAEERNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ TPMLY+C +CGKEYRSS+A++QHLKS+ H +KASQE +       II+P+   + ++
Sbjct  61   LSATPMLYSCALCGKEYRSSKAHAQHLKSRVHAMKASQESDPAIAGITIIKPITGRMQNK  120

Query  405  ST  410
            ST
Sbjct  121  ST  122



>ref|XP_002867303.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43562.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=405

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EFKD+ E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A EK K
Sbjct  1    MPGLTCNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALALEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRV-IIRPLQRPILD  401
              E PMLYTCG+CGK YRSS+A+ QHL+S+SH+L+ SQ P+ NGE  + IIR L R +  
Sbjct  61   SNEAPMLYTCGICGKGYRSSKAHEQHLQSRSHVLRVSQGPSINGEEDIAIIRQLPRRVQH  120

Query  402  RST  410
            R +
Sbjct  121  RGS  123



>ref|XP_009618306.1| PREDICTED: zinc finger protein 622-like [Nicotiana tomentosiformis]
Length=416

 Score =   177 bits (450),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 133/188 (71%), Gaps = 6/188 (3%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSV----IAE  212
            M GL CNACNKEF D+ EQKLHYKSEWHRYNLKRKVA VPG+TEALF+ARQS     +AE
Sbjct  1    MRGLACNACNKEFFDENEQKLHYKSEWHRYNLKRKVARVPGLTEALFVARQSALAEELAE  60

Query  213  EKKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRP  392
            E ++L+ETP+LY+CG CGKEYRS  A++QHL+SKSHL +AS+E  H+ EN  II+PL R 
Sbjct  61   ENRRLSETPVLYSCGNCGKEYRSCTAHAQHLQSKSHLARASRELGHHDENSSIIKPLPRQ  120

Query  393  ILDRSTQQVeedideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNM-QDADMD  569
               R      ++     +  E E  + +EE +  A+ SL QL++N  T NG + +D+D+D
Sbjct  121  P-SREPSDKADEDISGSDEGEWEEVDSEEEMVGGATASLNQLKMNGSTPNGTIDEDSDLD  179

Query  570  DYSEELDP  593
            +  +EL P
Sbjct  180  ECIDELGP  187



>emb|CBI20772.3| unnamed protein product [Vitis vinifera]
Length=376

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M  LTCNACNKEF  +++QKLHYKS+WHRYNLKRK+AGVPGVTEAL+LARQS +AEEK +
Sbjct  1    MATLTCNACNKEFIGESDQKLHYKSDWHRYNLKRKIAGVPGVTEALYLARQSSLAEEKNR  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
            L ETPMLY+C +CGK YRSS+A  QHLKS+SH+L+ASQ  +H  E   II+PL
Sbjct  61   LNETPMLYSCSLCGKGYRSSKALGQHLKSRSHILRASQRASHQDEETTIIKPL  113



>ref|XP_002282746.1| PREDICTED: zinc finger protein 622 [Vitis vinifera]
Length=411

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M  LTCNACNKEF  +++QKLHYKS+WHRYNLKRK+AGVPGVTEAL+LARQS +AEEK +
Sbjct  1    MATLTCNACNKEFIGESDQKLHYKSDWHRYNLKRKIAGVPGVTEALYLARQSSLAEEKNR  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
            L ETPMLY+C +CGK YRSS+A  QHLKS+SH+L+ASQ  +H  E   II+PL
Sbjct  61   LNETPMLYSCSLCGKGYRSSKALGQHLKSRSHILRASQRASHQDEETTIIKPL  113



>gb|KDO67268.1| hypothetical protein CISIN_1g015261mg [Citrus sinensis]
Length=327

 Score =   173 bits (438),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCN+CN+EF DDAEQKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ +A+EK K
Sbjct  1    MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
               TPM Y+CG+CGK YRSS+A +QHL S+SH+++ASQ  ++  + +VII+P+
Sbjct  61   -NATPMTYSCGLCGKGYRSSKALAQHLNSRSHIMRASQGTSNEEKEKVIIKPI  112



>ref|XP_006412594.1| hypothetical protein EUTSA_v10025366mg [Eutrema salsugineum]
 dbj|BAJ34316.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54047.1| hypothetical protein EUTSA_v10025366mg [Eutrema salsugineum]
Length=402

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EF D+AE+KLHYKS+WHRYNLKRKVAGVPGVTE LF ARQS +A+E  K
Sbjct  1    MPGLTCNACNMEFDDEAERKLHYKSDWHRYNLKRKVAGVPGVTEELFEARQSALAQENGK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNG-ENRVIIRPL  383
              E PMLY+CG+CGK YRSS+A+ QHLKS+SH+++ SQ    NG E++ IIRPL
Sbjct  61   SDEAPMLYSCGICGKGYRSSKAHEQHLKSRSHVVRVSQGTTTNGEEDKAIIRPL  114



>ref|XP_010525877.1| PREDICTED: zinc finger protein 622 [Tarenaya hassleriana]
Length=410

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN+EF  DAEQKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQS I ++K  
Sbjct  1    MPGLTCNACNQEFNGDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQSAIVQQKSS  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRV-IIRPL  383
              E+P+LY+CGVCGK YRSS+A+ QHLKSK+H+L+ASQ  N  G+  + II+PL
Sbjct  61   -DESPLLYSCGVCGKGYRSSKAHEQHLKSKAHILRASQGANDGGQQDLPIIKPL  113



>ref|XP_006283853.1| hypothetical protein CARUB_v10004960mg [Capsella rubella]
 gb|EOA16751.1| hypothetical protein CARUB_v10004960mg [Capsella rubella]
Length=403

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 127/184 (69%), Gaps = 9/184 (5%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EFKD+ E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +  EK K
Sbjct  1    MPGLTCNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALDLEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRV-IIRPLQRPILD  401
              E PMLY+C +CGK YRSS+A+ QHL+S+SH+L+ SQ    NGE  V IIRPL R +  
Sbjct  61   SNEAPMLYSCAICGKGYRSSKAHEQHLQSRSHVLRVSQGTTTNGEEDVAIIRPLPRRVQH  120

Query  402  RSTQQVeedideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNMQDADMDDYSE  581
            R +      ID+  ++E  E +  +E    EASDSL +L +NE  S  +M D   D Y  
Sbjct  121  RGS------IDDDSDAEWVEVDSDEELAAEEASDSLSKLNVNESGSAEDMDDDQADKY--  172

Query  582  ELDP  593
            +LDP
Sbjct  173  DLDP  176



>ref|XP_004291236.1| PREDICTED: zinc finger protein 622 [Fragaria vesca subsp. vesca]
Length=408

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GL CNACNKE KDDAEQ+LHYKSEWHRYNLKRKVAGVPGVTEALFLARQ+ +A EK  
Sbjct  1    MSGLACNACNKELKDDAEQRLHYKSEWHRYNLKRKVAGVPGVTEALFLARQAALAMEKNG  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
               TPMLY+C +CGK YRSS+A+++HLKS++H++KA+Q      E++ I+RPL
Sbjct  61   ANATPMLYSCALCGKGYRSSKAHAEHLKSRTHIMKAAQGTGDEEEDKAIVRPL  113



>ref|XP_006450152.1| hypothetical protein CICLE_v10008476mg [Citrus clementina]
 ref|XP_006483574.1| PREDICTED: zinc finger protein 622-like [Citrus sinensis]
 gb|ESR63392.1| hypothetical protein CICLE_v10008476mg [Citrus clementina]
 gb|KDO67267.1| hypothetical protein CISIN_1g015261mg [Citrus sinensis]
Length=410

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 101/119 (85%), Gaps = 3/119 (3%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCN+CN+EF DDAEQKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ +A+EK K
Sbjct  1    MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILD  401
               TPM Y+CG+CGK YRSS+A +QHL S+SH+++ASQ  ++  + +VII+P+  P+ D
Sbjct  61   -NATPMTYSCGLCGKGYRSSKALAQHLNSRSHIMRASQGTSNEEKEKVIIKPI--PLRD  116



>emb|CAA16545.1| putative zinc finger protein [Arabidopsis thaliana]
 emb|CAB79860.1| putative zinc finger protein [Arabidopsis thaliana]
Length=433

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = +3

Query  39   EEMPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEK  218
            E+MPGLTCNACN EFKD+ E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A+EK
Sbjct  21   EKMPGLTCNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALAQEK  80

Query  219  KKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRV-IIRPLQRPI  395
             K  E PMLYTC +C K YRSS+A+ QHL+S+SH+L+ SQ  + NGE  + IIR L R +
Sbjct  81   NKSNEAPMLYTCAICAKGYRSSKAHEQHLQSRSHVLRVSQGTSINGEEDIAIIRQLPRRV  140

Query  396  LDRST  410
              R +
Sbjct  141  QHRGS  145



>gb|AFK41799.1| unknown [Lotus japonicus]
Length=410

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EF DDA+QKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQ+ +AEEK K
Sbjct  1    MPGLTCNACNTEFIDDADQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQAALAEEKDK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
              ET MLY+CG+CGK Y+SS+A+++HLKS+ HL++ S+  + + E + I++PL
Sbjct  61   ANETAMLYSCGLCGKGYKSSKAHAEHLKSRGHLMRVSEGTSQSDE-KAIVKPL  112



>gb|AFK42392.1| unknown [Lotus japonicus]
Length=410

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EF DDA+QKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQ+ +AEEK K
Sbjct  1    MPGLTCNACNTEFIDDADQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQAALAEEKDK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
              ET MLY+CG+CGK Y+SS+A+++HLKS+ HL++ S+  + + E + I++PL
Sbjct  61   ANETAMLYSCGLCGKGYKSSKAHAEHLKSRGHLMRVSEGTSQSDE-KAIVKPL  112



>ref|XP_004171115.1| PREDICTED: zinc finger protein 622-like, partial [Cucumis sativus]
Length=172

 Score =   166 bits (421),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQS-VIAEEKK  221
            MPGLTCNACNKEF D  EQKLHYKSEWHRYNLKRKVA VPGVTEALFLARQS   A+E  
Sbjct  1    MPGLTCNACNKEFLDVDEQKLHYKSEWHRYNLKRKVANVPGVTEALFLARQSAAAAQENA  60

Query  222  KLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILD  401
            K  E  MLY+CG+C K YRS+QA++QHLKS+SH+++ASQ  +     + II+PL + I +
Sbjct  61   KSRENSMLYSCGLCSKAYRSAQAHAQHLKSRSHIIRASQGAHDQEVEKPIIKPLPQRISN  120

Query  402  RSTQQ  416
            ++ QQ
Sbjct  121  KAPQQ  125



>emb|CDX68744.1| BnaC01g07090D [Brassica napus]
Length=403

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EF+++AE+KLHY S+WHRYNLKRKVAGVPGVTE LF ARQS +A EK K
Sbjct  1    MPGLTCNACNMEFENEAERKLHYSSDWHRYNLKRKVAGVPGVTEELFEARQSALALEKGK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNG-ENRVIIRPLQRPILD  401
              E PMLYTCGVCGK YRSS+A+ QHLKS+SH+L+ SQ    NG E+  I+ PL R   +
Sbjct  61   SDEAPMLYTCGVCGKGYRSSKAHEQHLKSRSHVLRVSQGETSNGDEDVAIVTPLTRRFKN  120

Query  402  RSTQQ  416
            +  ++
Sbjct  121  KENEE  125



>ref|XP_011045006.1| PREDICTED: zinc finger protein 622-like [Populus euphratica]
Length=408

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACNKEF D+AEQKLHYKSEWHRYNLKRKVAGVPGV+EALF+ARQS I +EK+K
Sbjct  1    MPGLTCNACNKEFNDEAEQKLHYKSEWHRYNLKRKVAGVPGVSEALFVARQSAIDKEKEK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              E PM Y+C +C K Y+SS+A+ QHLKS+SH+L+ASQ  N   EN VI +  +R +  R
Sbjct  61   -NEIPMFYSCVLCNKGYQSSKAHDQHLKSRSHILRASQGTNQEAENTVIKQLPRREVNKR  119

Query  405  STQ  413
            + Q
Sbjct  120  AVQ  122



>gb|AAK44084.1|AF370269_1 putative zinc finger protein [Arabidopsis thaliana]
Length=404

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 1/123 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EFKD+ E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A+EK K
Sbjct  1    MPGLTCNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFGARQSALAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRV-IIRPLQRPILD  401
              E PMLYTC +C K YRSS+A+ QHL+S+SH+L+ SQ  + NGE  + IIR L R +  
Sbjct  61   SNEAPMLYTCAICAKGYRSSKAHEQHLQSRSHVLRVSQGTSINGEEDIAIIRQLPRRVQH  120

Query  402  RST  410
            R +
Sbjct  121  RGS  123



>ref|NP_567875.1| protein REI1-LIKE 1 [Arabidopsis thaliana]
 gb|AAN12920.1| putative zinc finger protein [Arabidopsis thaliana]
 gb|AEE85908.1| zinc finger protein 622 [Arabidopsis thaliana]
Length=404

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 1/123 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EFKD+ E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A+EK K
Sbjct  1    MPGLTCNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRV-IIRPLQRPILD  401
              E PMLYTC +C K YRSS+A+ QHL+S+SH+L+ SQ  + NGE  + IIR L R +  
Sbjct  61   SNEAPMLYTCAICAKGYRSSKAHEQHLQSRSHVLRVSQGTSINGEEDIAIIRQLPRRVQH  120

Query  402  RST  410
            R +
Sbjct  121  RGS  123



>ref|NP_974652.1| protein REI1-LIKE 1 [Arabidopsis thaliana]
 gb|AEE85909.1| zinc finger protein 622 [Arabidopsis thaliana]
Length=405

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 1/123 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EFKD+ E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A+EK K
Sbjct  1    MPGLTCNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALAQEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRV-IIRPLQRPILD  401
              E PMLYTC +C K YRSS+A+ QHL+S+SH+L+ SQ  + NGE  + IIR L R +  
Sbjct  61   SNEAPMLYTCAICAKGYRSSKAHEQHLQSRSHVLRVSQGTSINGEEDIAIIRQLPRRVQH  120

Query  402  RST  410
            R +
Sbjct  121  RGS  123



>ref|XP_008794317.1| PREDICTED: zinc finger protein 622-like [Phoenix dactylifera]
 ref|XP_008776891.1| PREDICTED: zinc finger protein 622-like [Phoenix dactylifera]
Length=418

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP LTCNACNKEF+D+ EQKLHY+SEWHRYNLKRKVAGVPGVTEALF ARQS +AEE+ +
Sbjct  1    MPVLTCNACNKEFQDEVEQKLHYRSEWHRYNLKRKVAGVPGVTEALFQARQSALAEERNQ  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
            L+ T MLY C +CGKEYRSS+A+ QHLKS++H +KASQE +       II+P+
Sbjct  61   LSATAMLYGCALCGKEYRSSKAHDQHLKSRAHAMKASQESDPAIAGITIIKPI  113



>ref|XP_010429428.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=404

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GL CN+CNKEF+DDAEQK HYKSEWHRYNLKRK+AGVPGVTE+LF ARQ+ IA+EK K
Sbjct  1    MSGLACNSCNKEFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTESLFEARQAAIAQEKVK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              E PMLYTCG+C K YRSS+A+ QHLKSKSH+LKAS      G+  +I +   R +   
Sbjct  61   AVEAPMLYTCGICNKGYRSSKAHEQHLKSKSHVLKASASNKEEGDKAIIKQLPPRRVEKN  120

Query  405  STQQV  419
             T Q+
Sbjct  121  DTAQL  125



>emb|CDY28267.1| BnaA01g05820D [Brassica napus]
Length=395

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EF++++E+KLHY S+WHRYNLKRKVAGVPGVTE LF ARQS +A EK K
Sbjct  1    MPGLTCNACNMEFENESERKLHYSSDWHRYNLKRKVAGVPGVTEELFEARQSALALEKGK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNG-ENRVIIRPLQRPILD  401
              E PMLYTCG CGK YRSS+A+ QHLKS+SH+L+ SQ    NG E+  I+ PL R   +
Sbjct  61   SDEAPMLYTCGACGKGYRSSKAHEQHLKSRSHVLRVSQGETSNGDEDVAIVTPLTRRFKN  120

Query  402  RSTQQ  416
            R  ++
Sbjct  121  RENEE  125



>ref|XP_009126994.1| PREDICTED: zinc finger protein 622 [Brassica rapa]
Length=395

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCNACN EF+++AE+KLHY S+WHRYNLKRKVAGVPGVTE LF ARQS +A EK K
Sbjct  1    MPGLTCNACNMEFENEAERKLHYSSDWHRYNLKRKVAGVPGVTEELFEARQSALALEKGK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNG-ENRVIIRPLQRPILD  401
              E PMLYTCG CGK YRSS+A+ QHLKS+SH+L+ SQ    NG E+  I+ PL R   +
Sbjct  61   SDEAPMLYTCGACGKGYRSSKAHEQHLKSRSHVLRVSQGETSNGDEDVAIVTPLTRRFKN  120

Query  402  RSTQQ  416
            +  ++
Sbjct  121  KENEE  125



>ref|XP_010472458.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=403

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GL CN+CNKEF+DDAEQK HYKSEWHRYNLKRK+AGVPGVTE+LF ARQ+ IA+EK K
Sbjct  1    MSGLACNSCNKEFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTESLFEARQAAIAQEKVK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVI  371
              E PMLYTCG+C K YRSS+A+ QHLKSKSH+LKAS      G+  +I
Sbjct  61   AVEAPMLYTCGICNKGYRSSKAHEQHLKSKSHVLKASASNKEEGDKAII  109



>ref|XP_010438043.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=407

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCN CN EF+ + E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A EK K
Sbjct  1    MPGLTCNGCNMEFEGEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALALEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRV-IIRPLQRPILD  401
              E PMLY+C +CGK YRSS+A+ QHL+S+SH+L+ SQ    NGE  V IIRPL R +  
Sbjct  61   SNEAPMLYSCAICGKGYRSSKAHEQHLQSRSHVLRVSQGTTTNGEEDVAIIRPLPRRVQH  120

Query  402  RST  410
            R +
Sbjct  121  RGS  123



>ref|XP_009140559.1| PREDICTED: zinc finger protein 622 [Brassica rapa]
Length=407

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GL CN+CNKEF+DD++QKLHYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ IA++K K
Sbjct  1    MSGLACNSCNKEFEDDSDQKLHYKSEWHRYNLKRKIAGVPGVTEALFEARQTAIAQQKIK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRP  392
              E P+LYTCGVC K YRSS+A+ QHLKSKSH+LKAS   N   E++ II+ L  P
Sbjct  61   SNEAPLLYTCGVCNKSYRSSKAHEQHLKSKSHVLKASSSSNGE-EDKAIIKELPPP  115



>ref|XP_010417208.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=401

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GL CN+CNKEF+DDAEQK HYKSEWHRYNLKRK+AGVPGVTE+LF ARQ+ IA+EK K
Sbjct  1    MSGLACNSCNKEFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTESLFEARQAAIAQEKVK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVI  371
              E PMLYTCG+C K YRSS+A+ QHLKSKSH+LKAS      G+  +I
Sbjct  61   AVEAPMLYTCGICNKGYRSSKAHEQHLKSKSHVLKASASNKEEGDIAII  109



>ref|XP_010447561.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=406

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCN CN EF  + E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A EK K
Sbjct  1    MPGLTCNGCNMEFDGEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALALEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRV-IIRPLQRPILD  401
              E PMLY+C +CGK YRSS+A+ QHL+S+SH+L+ SQ    NGE  V IIRPL R +  
Sbjct  61   SNEAPMLYSCAICGKGYRSSKAHEQHLQSRSHVLRVSQGTTTNGEEDVAIIRPLPRRVQH  120

Query  402  RST  410
            R +
Sbjct  121  RGS  123



>ref|XP_010432868.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=406

 Score =   169 bits (429),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MPGLTCN CN EF  + E+ LHYKS+WHRYNLKRKVAGVPGVTEALF ARQS +A EK K
Sbjct  1    MPGLTCNGCNMEFDGEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALALEKNK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRV-IIRPLQRPILD  401
              E PMLY+C +CGK YRSS+A+ QHL+S+SH+L+ SQ    NGE  V IIRPL R +  
Sbjct  61   SNEAPMLYSCAICGKGYRSSKAHEQHLQSRSHVLRVSQGTTTNGEEDVAIIRPLPRRVQH  120

Query  402  RST  410
            R +
Sbjct  121  RGS  123



>ref|XP_006293479.1| hypothetical protein CARUB_v10023355mg [Capsella rubella]
 gb|EOA26377.1| hypothetical protein CARUB_v10023355mg [Capsella rubella]
Length=401

 Score =   169 bits (429),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 95/114 (83%), Gaps = 4/114 (4%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GL CN+CNKEF+DDAEQK HYKSEWHRYNLKRK+AGVPGVTE+LF ARQ+ IA+EK K
Sbjct  1    MSGLACNSCNKEFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTESLFEARQAAIAQEKVK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNG-ENRVIIRPL  383
              E PMLY+CG+C K YRSS+A+ QHLKSKSH+LKAS+    NG E++ II+ L
Sbjct  61   AVEAPMLYSCGICNKGYRSSKAHEQHLKSKSHVLKASKS---NGEEDKAIIKQL  111



>ref|NP_180026.1| zinc finger domain protein REI1-LIKE 2 [Arabidopsis thaliana]
 gb|AAD25324.1|AF095588_1 C2H2 zinc finger protein FZF [Arabidopsis thaliana]
 gb|AAD18121.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AAL32698.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AAM48014.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AEC07585.1| C2H2 zinc finger protein FZF [Arabidopsis thaliana]
Length=395

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GL CN+CNK+F+DDAEQK HYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ IA+EK K
Sbjct  1    MSGLACNSCNKDFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTEALFEARQAAIAQEKVK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
              E PMLY+CG+C K YRSS+A+ QHLKSKSH+LKAS       E++ II+ L
Sbjct  61   AVEAPMLYSCGICNKGYRSSKAHEQHLKSKSHVLKASTSTGE--EDKAIIKQL  111



>ref|XP_006656412.1| PREDICTED: zinc finger protein 622-like [Oryza brachyantha]
Length=398

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 127/183 (69%), Gaps = 14/183 (8%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP +TCNACN  F D+ +Q+LHY+SEWHRYNLKRKVAGVPGVTEALFLARQ+V+AE    
Sbjct  1    MPTVTCNACNAGFDDEEQQRLHYRSEWHRYNLKRKVAGVPGVTEALFLARQTVLAEGSNS  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
               TPMLY+C +CGKEYRSS+A++QHL S+SHL+KASQEPN +     +++P    +  R
Sbjct  61   -DSTPMLYSCALCGKEYRSSKAHAQHLNSRSHLMKASQEPNASIAGITVVKPRPERVQRR  119

Query  405  STQQVeedideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNMQDADMDDYSEE  584
                VEED DE EE  E +  E++            ++Q++EH+S     D DMD++ EE
Sbjct  120  GPSSVEEDEDEEEEWVEVDPSELESTS---------EMQVDEHSSK---SDDDMDEF-EE  166

Query  585  LDP  593
            LDP
Sbjct  167  LDP  169



>ref|XP_002437507.1| hypothetical protein SORBIDRAFT_10g028300 [Sorghum bicolor]
 gb|EER88874.1| hypothetical protein SORBIDRAFT_10g028300 [Sorghum bicolor]
Length=404

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP +TCNACN  F D+ +Q+LHY+SEWHRYNLKRKVAGVPGVTEALFLARQ+ +AE  K 
Sbjct  1    MPTVTCNACNTGFDDEEQQRLHYRSEWHRYNLKRKVAGVPGVTEALFLARQAALAEGSKP  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
             + TPMLY+C +CGKEYRSS+A+ QHL S+SHLLKASQEPN +     I++PL
Sbjct  61   AS-TPMLYSCALCGKEYRSSKAHEQHLNSRSHLLKASQEPNASIAGITIVKPL  112



>ref|NP_001151247.1| LOC100284880 [Zea mays]
 gb|ACG42118.1| zinc finger protein 622 [Zea mays]
 gb|ACR38026.1| unknown [Zea mays]
 gb|AFW69246.1| Zinc finger protein 622 [Zea mays]
Length=404

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP +TCNACN  F D+ +Q+LHY+SEWHRYNLKRKVAGVPGVTEALFLARQ+ +AE  K 
Sbjct  1    MPTVTCNACNAGFDDEEQQRLHYRSEWHRYNLKRKVAGVPGVTEALFLARQAALAEGSKP  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
             + TPMLY+C +CGKEYRSS+A+ QHL S+SHLLKASQEPN +     I++PL   +  R
Sbjct  61   AS-TPMLYSCALCGKEYRSSKAHEQHLNSRSHLLKASQEPNASIAGITIVKPLPERVSRR  119

Query  405  S  407
            +
Sbjct  120  A  120



>emb|CDY46155.1| BnaA04g14430D [Brassica napus]
Length=399

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GL CN+CNK+F+DD++QKLHYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ IA++K K
Sbjct  1    MSGLACNSCNKDFEDDSDQKLHYKSEWHRYNLKRKIAGVPGVTEALFEARQTAIAQQKIK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRP  392
              E P+LYTCGVC K YRSS+A+ QHLKSKSH+LKAS   N   E++ II+ L  P
Sbjct  61   SNEAPLLYTCGVCNKSYRSSKAHEQHLKSKSHVLKASSSSNGE-EDKAIIKELPPP  115



>gb|EPS72142.1| hypothetical protein M569_02614 [Genlisea aurea]
Length=383

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 3/113 (3%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GLTCNACNKE  D+ EQ++HYKSEWHRYNLKRKVAGVPGVTE LF ARQS +A+EK K
Sbjct  1    MAGLTCNACNKELADEVEQRIHYKSEWHRYNLKRKVAGVPGVTEVLFQARQSALADEKGK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
            L + PMLY CG+CGKEY+SS+A++QHLKS +HL++ S+  +    +  IIRP+
Sbjct  61   LDQAPMLYACGICGKEYKSSKAHAQHLKSNTHLMRVSEATS---SDDTIIRPV  110



>ref|XP_009117121.1| PREDICTED: zinc finger protein 622-like [Brassica rapa]
Length=400

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GL CN+CNKEF+DDAEQKLHYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ +A+E+ K
Sbjct  1    MSGLACNSCNKEFEDDAEQKLHYKSEWHRYNLKRKIAGVPGVTEALFEARQAALAQERIK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKA-SQEPNHNGENRVIIRPLQRP  392
              E P+LYTCGVC K YRS +A+ QHLKSKSH+L A SQ  N   E++ II+ L  P
Sbjct  61   SVEAPLLYTCGVCDKAYRSYKAHEQHLKSKSHVLNAFSQGGNGEEEDKAIIKQLLPP  117



>emb|CDY20320.1| BnaC04g36360D [Brassica napus]
Length=399

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 95/116 (82%), Gaps = 2/116 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GL CN+CNKEF+DD++QKLHYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ IA++K K
Sbjct  1    MSGLACNSCNKEFEDDSDQKLHYKSEWHRYNLKRKIAGVPGVTEALFEARQTAIAQQKIK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRP  392
              E P+LYTCGVC K YRSS+A+ QHLKSKSH+LKAS   +   E++ II+ L  P
Sbjct  61   SNEAPLLYTCGVCNKSYRSSKAHEQHLKSKSHVLKASS--SSGDEDKAIIKELPPP  114



>emb|CDY34766.1| BnaA09g41330D [Brassica napus]
Length=400

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GL CN+CNKEF+DDAEQKLHYKSEWHRYNLKRK+AGVPGVTEALF AR++ +A+E+ K
Sbjct  1    MSGLACNSCNKEFEDDAEQKLHYKSEWHRYNLKRKIAGVPGVTEALFDAREAALAQERIK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKA-SQEPNHNGENRVIIRPLQRP  392
              E PMLYTCGVC K YRS +A+ QHLKSKSH+L A SQ  N   E++ II+ L  P
Sbjct  61   SVEAPMLYTCGVCDKAYRSYKAHEQHLKSKSHVLNASSQGGNGEEEDKAIIKQLPPP  117



>gb|KEH39759.1| C2H2-type zinc finger protein [Medicago truncatula]
Length=408

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GLTCN+CN EF  DA+QKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQ+ +A+E+ K
Sbjct  1    MSGLTCNSCNTEFTHDADQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQAALAQERDK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
              E+PMLY+CG+CGK Y+S +A+++HLKS++H+++AS E +   + + II+PL + ++++
Sbjct  61   SNESPMLYSCGLCGKGYKSEKAHAEHLKSRTHMMRAS-EGDSQSDGKAIIKPLPQRVVNK  119



>ref|XP_006483736.1| PREDICTED: zinc finger protein 622-like, partial [Citrus sinensis]
Length=419

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            +PGLTCNACN+EF DDAE+KLHYKS+W+RYNLKRKVAGVPGVTEALFLARQ+ +A+E K 
Sbjct  10   LPGLTCNACNREFNDDAEKKLHYKSDWYRYNLKRKVAGVPGVTEALFLARQAALAQE-KN  68

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQ  386
              ETPM Y+CG+CGK YRSS+A +QHL S+SH+++A+Q  ++  + +VIIR + 
Sbjct  69   TNETPMTYSCGLCGKGYRSSKALAQHLNSRSHIMRAAQGTSNEEKEKVIIRSIS  122



>ref|XP_002880589.1| hypothetical protein ARALYDRAFT_481305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56848.1| hypothetical protein ARALYDRAFT_481305 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M  L CN+CNKEF+DDAEQK HYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ IA+EK K
Sbjct  1    MSALACNSCNKEFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTEALFEARQAAIAQEKVK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
              E PMLYTCG+C K YRSS+A+ QHLKSKSH+LKAS       +++ II+ L
Sbjct  61   AVEAPMLYTCGICNKGYRSSKAHEQHLKSKSHVLKASTSSGE--QDKAIIKQL  111



>gb|KFK32629.1| hypothetical protein AALP_AA6G268300 [Arabis alpina]
Length=403

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = +3

Query  51   GLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLT  230
            GL CN+CNKEF+DDAEQK HYKSEWHRYNLKRK+AGVPGVTEALF ARQ+ IA+EK K  
Sbjct  5    GLACNSCNKEFEDDAEQKFHYKSEWHRYNLKRKIAGVPGVTEALFEARQAAIAQEKVKAI  64

Query  231  ETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
            E PMLY+CGVC K YRS +A+ QHLKSKSH+LKAS +   + E++ IIR L
Sbjct  65   EAPMLYSCGVCVKSYRSFKAHEQHLKSKSHVLKASSQGTGD-EDKAIIRQL  114



>ref|XP_004966161.1| PREDICTED: zinc finger protein 622-like [Setaria italica]
Length=405

 Score =   167 bits (422),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP +TCNACN  F D+ +Q+LHY+SEWHRYNLKRKVAGVPGVTEALFLARQ+ +AE  K 
Sbjct  1    MPTVTCNACNAGFDDEEQQRLHYRSEWHRYNLKRKVAGVPGVTEALFLARQAALAEGSKP  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
             + TPMLY+C +CGKEYRSS+A+ QHL S+SHL++ASQEPN +     I++PL
Sbjct  61   AS-TPMLYSCALCGKEYRSSKAHEQHLNSRSHLMRASQEPNASIAGITIVKPL  112



>ref|XP_004136315.1| PREDICTED: zinc finger protein 622-like [Cucumis sativus]
 gb|KGN60160.1| hypothetical protein Csa_3G881730 [Cucumis sativus]
Length=395

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQS-VIAEEKK  221
            MPGLTCNACNKEF D  EQKLHYKSEWHRYNLKRKVA VPGVTEALFLARQS   A+E  
Sbjct  1    MPGLTCNACNKEFLDVDEQKLHYKSEWHRYNLKRKVANVPGVTEALFLARQSAAAAQENA  60

Query  222  KLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILD  401
            K  E  MLY+CG+C K YRS+QA++QHLKS+SH+++ASQ  +     + II+PL + I +
Sbjct  61   KSRENSMLYSCGLCSKAYRSAQAHAQHLKSRSHIIRASQGAHDQEVEKPIIKPLPQRISN  120

Query  402  RSTQQ  416
            ++ QQ
Sbjct  121  KAPQQ  125



>gb|EEC81236.1| hypothetical protein OsI_24290 [Oryza sativa Indica Group]
Length=358

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP +TCNACN  F D+ +Q+LHY+SEWHRYNLKRKVAGVPGVTEALFLARQ+ +AE    
Sbjct  1    MPTVTCNACNAGFDDEEQQRLHYRSEWHRYNLKRKVAGVPGVTEALFLARQTALAEGSNS  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRP  380
               TPMLY+C +CGKEYRSS+A++QHL S+SHL+KASQEPN +     I++P
Sbjct  61   -DSTPMLYSCALCGKEYRSSKAHAQHLNSRSHLMKASQEPNASIAGITIVKP  111



>ref|XP_009406616.1| PREDICTED: zinc finger protein 622-like [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP L CNACNK F D+A+QKLHY+SEWHRYNLKRKVAGVPGVTE LF ARQ  +AEE+ K
Sbjct  1    MPVLMCNACNKGFDDEAQQKLHYRSEWHRYNLKRKVAGVPGVTEELFQARQLALAEERSK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
            L+ TPMLY C +CGKEYRSS+A++QHLKS++H ++ASQE   +      I+P      ++
Sbjct  61   LSATPMLYGCALCGKEYRSSKAHAQHLKSRAHTMRASQELGPSTARITTIKPFAGRTSNK  120

Query  405  STQQV  419
            +T  V
Sbjct  121  ATVHV  125



>ref|XP_008466318.1| PREDICTED: zinc finger protein 622 [Cucumis melo]
Length=393

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQS-VIAEEKK  221
            MPGLTCNACNKEF D  EQKLHYKSEWHRYNLKRKVA VPGVTEALFLARQS   A+E  
Sbjct  1    MPGLTCNACNKEFLDVDEQKLHYKSEWHRYNLKRKVANVPGVTEALFLARQSAAAAQENA  60

Query  222  KLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILD  401
            K  ET MLY+C +C K YRS+QA++QHLKS+SH+++ASQ  +     + II+PL + I +
Sbjct  61   KSRETAMLYSCCLCSKAYRSAQAHAQHLKSRSHIIRASQGAHDQEVEKPIIKPLPQRISN  120

Query  402  RSTQQ  416
            ++ QQ
Sbjct  121  KAPQQ  125



>ref|NP_001058435.1| Os06g0693500 [Oryza sativa Japonica Group]
 dbj|BAD53867.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF20349.1| Os06g0693500 [Oryza sativa Japonica Group]
 gb|EAZ38119.1| hypothetical protein OsJ_22468 [Oryza sativa Japonica Group]
 dbj|BAG95937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=399

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 128/183 (70%), Gaps = 12/183 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP +TCNACN  F D+ +Q+LHY+SEWHRYNLKRKVAGVPGVTEALFLARQ+ +AE    
Sbjct  1    MPTVTCNACNAGFDDEEQQRLHYRSEWHRYNLKRKVAGVPGVTEALFLARQTALAEGSNS  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILDR  404
               TPMLY+C +CGKEYRSS+A++QHL S+SHL+KASQEPN +     I++P    +  R
Sbjct  61   -DSTPMLYSCALCGKEYRSSKAHAQHLNSRSHLMKASQEPNASIAGITIVKPRPERVQRR  119

Query  405  STQQVeedideseeseeseweevdeedmaeasdsLMQLQLNEHTSNGNMQDADMDDYSEE  584
            +   VEED DE EE E  E +  + E  +       ++Q++EH+S     D ++D++ EE
Sbjct  120  APSAVEEDEDEDEEEEWVEVDPSELESTS-------EMQVDEHSSK---SDDEIDEF-EE  168

Query  585  LDP  593
            LDP
Sbjct  169  LDP  171



>ref|XP_006845651.1| hypothetical protein AMTR_s00019p00227240 [Amborella trichopoda]
 gb|ERN07326.1| hypothetical protein AMTR_s00019p00227240 [Amborella trichopoda]
Length=403

 Score =   164 bits (416),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP  TCNACN EF+DDA+QK+HYKSEWHRYNLKRKVAG+PGVTEALF AR S +A+E+ +
Sbjct  1    MPAFTCNACNTEFEDDAQQKIHYKSEWHRYNLKRKVAGIPGVTEALFQARLSALADERTR  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
            L +T M+Y+C +CGKEYRSS+A+++HLKS+SH  KASQ  N       +IRPL
Sbjct  61   LDQTRMIYSCALCGKEYRSSKAHAEHLKSRSH-AKASQTTNATVSGITVIRPL  112



>dbj|BAK05098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=400

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP +TCNACN  F+++ EQ+LHY+SEWHRYNLKRKVAGVPGVTEALF+ARQ+V+AE    
Sbjct  1    MPTVTCNACNAAFEEEEEQRLHYRSEWHRYNLKRKVAGVPGVTEALFIARQTVLAEGSNS  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
                PM Y+C +CGK YRS++A++QHL ++SHLL+ASQEP  N     +++PL
Sbjct  61   TIAPPMSYSCALCGKGYRSAKAHAQHLTTRSHLLRASQEP--NASTAAVVKPL  111



>ref|XP_003563458.1| PREDICTED: zinc finger protein 622 [Brachypodium distachyon]
Length=402

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 90/113 (80%), Gaps = 3/113 (3%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP LTCNACN  F+++ EQ+LHY+SEWHRYNLKRKVAGVPGVTEALF+ARQ+ +AE    
Sbjct  1    MPTLTCNACNAAFEEEEEQRLHYRSEWHRYNLKRKVAGVPGVTEALFMARQTALAEGTNS  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
             +  PM Y+C +CGK YRSS+A++QHL ++SHL++ASQEP  N     +++PL
Sbjct  61   AS-APMSYSCALCGKGYRSSKAHAQHLTTRSHLMRASQEP--NASTAAVVKPL  110



>gb|ABK25050.1| unknown [Picea sitchensis]
Length=420

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP LTCNACN EF ++A QK HYKSEWHRYNL+RKVAGVPGVTEALF ARQ  +AEE+K+
Sbjct  1    MPILTCNACNAEFNEEAAQKFHYKSEWHRYNLRRKVAGVPGVTEALFQARQQALAEEQKR  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
            L    MLY+C +CGKEYRS++A++QHL S++H L+AS+  +       +I+ L
Sbjct  61   LESNRMLYSCSLCGKEYRSAKAHAQHLNSRAHTLRASETSDSRSAGIAVIKQL  113



>emb|CDX76808.1| BnaC08g33940D [Brassica napus]
Length=319

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  60   CNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTETP  239
            CN+CNKEF+DDAEQKLHYKSEWHRYNLKRK+ GVPGVTE LF ARQ+ +A+E+ K  E P
Sbjct  2    CNSCNKEFEDDAEQKLHYKSEWHRYNLKRKITGVPGVTEGLFDARQAALAQERIKSFEAP  61

Query  240  MLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            +LYTCGVC K YRSS+A+ QHLKSKSHL
Sbjct  62   LLYTCGVCDKAYRSSKAHEQHLKSKSHL  89



>ref|XP_004966160.1| PREDICTED: zinc finger protein 622-like [Setaria italica]
Length=360

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M   TCNACN  F DD +++LHY+S+WH +NLKRKVAGVPGVTEALFLA Q+ +  E   
Sbjct  1    MATATCNACNVRFVDDEQKRLHYRSDWHCFNLKRKVAGVPGVTEALFLAWQAALG-EGST  59

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQE-PNHNGENRVIIRPLQRP  392
            LT TP+ Y C +CGKEYRSS+A++QHL S+SHL++AS E P+ +    + +  L+ P
Sbjct  60   LTGTPIQYGCALCGKEYRSSRAHAQHLSSRSHLMRASDEGPDSSIAAGIAVVKLKPP  116



>ref|XP_010929264.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 622-like 
[Elaeis guineensis]
Length=411

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP LTCNACNKEF+D+AEQKLH +S+WHR+NLKR+  G+P VTEALF +R S +AE++ K
Sbjct  1    MPVLTCNACNKEFQDEAEQKLHCRSQWHRFNLKRQAVGLPRVTEALFQSRPSELAEKRSK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPL  383
             +   +LY C +CGKEY SS+A++QHLKS++H ++ SQE          I+P+
Sbjct  61   SSAATLLYGCALCGKEYGSSKAHAQHLKSQAHSMRTSQESGPAVARISTIKPI  113



>ref|XP_004244493.1| PREDICTED: zinc finger protein 622 [Solanum lycopersicum]
Length=311

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 80/104 (77%), Gaps = 8/104 (8%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M  L CN CNKEF D+ EQK+HYKSEWH YNLKRKVAGVPG+TEAL+ ARQS        
Sbjct  1    MKSLICNCCNKEFFDENEQKIHYKSEWHTYNLKRKVAGVPGLTEALYKARQSA-------  53

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKS-KSHLLKASQEPNHN  353
            L ETP+LY+C  CGKE+ +S+A++QHLKS K+HL +ASQE  H+
Sbjct  54   LLETPLLYSCEHCGKEFTTSKAHAQHLKSKKTHLARASQEIAHH  97



>ref|XP_002437508.1| hypothetical protein SORBIDRAFT_10g028310 [Sorghum bicolor]
 gb|EER88875.1| hypothetical protein SORBIDRAFT_10g028310 [Sorghum bicolor]
Length=216

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 77/103 (75%), Gaps = 7/103 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            MP  TCNACN  F DD ++++HY+SEWHR+NLKRKVAGVPGVTEALF A ++ ++     
Sbjct  1    MPTTTCNACNVVFFDDEQKRIHYRSEWHRFNLKRKVAGVPGVTEALFRAWEAALSAGT--  58

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLK--ASQEPN  347
               TP LYTC +C KEY SS+A+ QHL S+SHL++  ASQ+P 
Sbjct  59   ---TPTLYTCSLCEKEYTSSRAHEQHLTSRSHLMRAAASQDPT  98



>emb|CDX80697.1| BnaC08g05310D [Brassica napus]
Length=185

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +3

Query  96   EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCGVCGKEY  275
            E+KLHY S+WH YNLKRKVAG PGVTE LF A+QS +A EK K  E PMLYTC VCGK Y
Sbjct  74   ERKLHYSSDWHSYNLKRKVAGAPGVTEELFEAKQSALAMEKGKSDERPMLYTCRVCGKSY  133

Query  276  RSSQAYSQHLKSKSHLLKASQEPNHNG-ENRVIIRPLQR  389
            RSS+A+ QH KS  H+L+ SQ    NG E+  I+ PL R
Sbjct  134  RSSKAHEQHCKSWRHVLRVSQGTASNGDEDVAIVTPLPR  172



>emb|CDX73317.1| BnaC05g27890D [Brassica napus]
Length=211

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +3

Query  96   EQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCGVCGKEY  275
            E+KLHY S+WH YNLKRKVAG PGVTE LF ARQS +A EK K  E PMLYTC VCGK Y
Sbjct  11   ERKLHYSSDWHSYNLKRKVAGAPGVTEELFEARQSALAMEKGKSDEKPMLYTCRVCGKSY  70

Query  276  RSSQAYSQHLKSKSHLLKASQEPNHNG-ENRVIIRPLQR  389
            RSS+A+ QH KS  H+L+ SQ    NG E+  I+ PL R
Sbjct  71   RSSKAHEQHCKSWRHVLRVSQGTASNGDEDVAIVTPLPR  109



>ref|XP_001753134.1| predicted protein [Physcomitrella patens]
 gb|EDQ82175.1| predicted protein [Physcomitrella patens]
Length=398

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK  224
            M GL CNACN+ F D+  QK HYK+EWHRYNL+RKVAGVPGVTEALF  R   +  EK K
Sbjct  1    MRGLACNACNETFADEETQKKHYKTEWHRYNLRRKVAGVPGVTEALFNLRIEALEAEKSK  60

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKAS  335
                 +LY C +C KEY +S+A++ HL+SK H+ +A+
Sbjct  61   KEGARLLYKCALCNKEYTTSKAHANHLQSKLHITRAA  97



>ref|XP_008347704.1| PREDICTED: zinc finger protein 622-like [Malus domestica]
Length=381

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 103/148 (70%), Gaps = 7/148 (5%)
 Frame = +3

Query  150  VAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLK  329
            VAGVPGVTEALF+ARQ+ +A+EK  L+E PMLY+CG+CGK YRSS+A+++HLKS+SH+L+
Sbjct  12   VAGVPGVTEALFIARQAALAQEKNGLSEXPMLYSCGLCGKGYRSSKAHAEHLKSRSHILR  71

Query  330  ASQEPNHNGENRVIIRPLQRPILDRSTQQVeedideseeseeseweevdeedmaeasdsL  509
            ASQ  +   E + IIRPL   +++++  +        EE++ESE E V+ +   + S SL
Sbjct  72   ASQGASEQ-EEKPIIRPLPSRVVNKAPPK---REANDEETDESEDEWVEFDPDEDLSKSL  127

Query  510  MQLQLNEHTSNGNMQDADMDDYSEELDP  593
              + ++EH S    +D D DD  EELDP
Sbjct  128  TDMNVDEHASE---EDMDQDDDFEELDP  152



>ref|XP_002985761.1| hypothetical protein SELMODRAFT_234873 [Selaginella moellendorffii]
 gb|EFJ13339.1| hypothetical protein SELMODRAFT_234873 [Selaginella moellendorffii]
Length=394

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 12/117 (10%)
 Frame = +3

Query  60   CNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTETP  239
            CNACN +  D+ EQ+ HY+SEWHR+NLKRKVAG+PGV+E LF  R  ++A EK    E  
Sbjct  4    CNACNADL-DEGEQRAHYRSEWHRHNLKRKVAGIPGVSEKLFNLRLELLAAEKNT-QEAR  61

Query  240  MLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENR---VIIRPLQRPILD  401
            M+YTC  C K Y +  A+ QHLKSK HL +A       G+ R    ++RP + P +D
Sbjct  62   MIYTCATCNKSYSTVNAHEQHLKSKLHLSRA-------GDGRDATAVVRPARSPSMD  111



>gb|KJB06567.1| hypothetical protein B456_001G001500 [Gossypium raimondii]
Length=363

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = +3

Query  147  KVAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLL  326
            +VAGVPGVTEALFLARQ+ +AEEK K  ETPMLY+CG+C K YRSS+AYSQHLKS++H+ 
Sbjct  6    QVAGVPGVTEALFLARQAALAEEKDKQNETPMLYSCGLCDKGYRSSKAYSQHLKSRAHIA  65

Query  327  KASQEPNHNGENRVIIRPLQRPILDRSTQ  413
            +ASQ P    E   II+P  R  +++  Q
Sbjct  66   QASQHPEE--EKAAIIKPFIRRAVNKPPQ  92



>ref|XP_002974456.1| hypothetical protein SELMODRAFT_101058 [Selaginella moellendorffii]
 gb|EFJ24678.1| hypothetical protein SELMODRAFT_101058 [Selaginella moellendorffii]
Length=398

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 6/114 (5%)
 Frame = +3

Query  60   CNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTETP  239
            CNACN +  D+ EQ+ HY+SEWHR+NLKRKVAG+PGV+E LF  R  ++A EK    E  
Sbjct  4    CNACNADL-DEGEQRAHYRSEWHRHNLKRKVAGIPGVSEKLFNLRLELLAAEKNT-QEAR  61

Query  240  MLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILD  401
            M+YTC  C K Y +  A+ QHLKSK HL +AS   +       ++RP +   +D
Sbjct  62   MIYTCATCNKSYSTVNAHEQHLKSKLHLSRASDGRDAT----AVVRPARSLSMD  111



>gb|KDO67270.1| hypothetical protein CISIN_1g015261mg [Citrus sinensis]
Length=389

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 69/86 (80%), Gaps = 3/86 (3%)
 Frame = +3

Query  144  RKVAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            ++VAGVPGVTEALFLARQ+ +A+EK K   TPM Y+CG+CGK YRSS+A +QHL S+SH+
Sbjct  13   KQVAGVPGVTEALFLARQAALAQEKNK-NATPMTYSCGLCGKGYRSSKALAQHLNSRSHI  71

Query  324  LKASQEPNHNGENRVIIRPLQRPILD  401
            ++ASQ  ++  + +VII+P+  P+ D
Sbjct  72   MRASQGTSNEEKEKVIIKPI--PLRD  95



>gb|KEH41235.1| C2H2-type zinc finger protein [Medicago truncatula]
Length=476

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = +3

Query  147  KVAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLL  326
            +VAGVPGVTE LFLARQ+  A+E+ K  E PMLY+CG+CGK Y+S +A+++HLKS++H++
Sbjct  11   RVAGVPGVTEELFLARQTAPAQERDKSNEIPMLYSCGLCGKRYKSEKAHAEHLKSRTHMM  70

Query  327  KASQEPNHNGENRVIIRPLQRPILDR  404
            +AS E +   + + II+PL++ ++++
Sbjct  71   RAS-EGDSQSDGKAIIKPLRQHVVNK  95



>gb|KDO38064.1| hypothetical protein CISIN_1g042126mg, partial [Citrus sinensis]
Length=369

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 63/79 (80%), Gaps = 1/79 (1%)
 Frame = +3

Query  150  VAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLK  329
            VAGVPGVTEALFLARQ+ +A+EK    ETPM Y+CG+CGK YRSS+A +QHL S+SH+++
Sbjct  1    VAGVPGVTEALFLARQAALAQEKNT-NETPMTYSCGLCGKGYRSSKALAQHLNSRSHIMR  59

Query  330  ASQEPNHNGENRVIIRPLQ  386
            A+Q  ++  + +VIIR + 
Sbjct  60   AAQGTSNEEKEKVIIRSIS  78



>gb|EMT04737.1| Zinc finger protein 622 [Aegilops tauschii]
Length=379

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = +3

Query  147  KVAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLL  326
            +VAGVPGVTEALF+ARQ+V+AE        PM Y+C +CGK YRS++A++QHL ++SHLL
Sbjct  14   EVAGVPGVTEALFIARQTVLAEGSNSTIAPPMSYSCALCGKGYRSAKAHAQHLTTRSHLL  73

Query  327  KASQEPNHNGENRVIIRPL  383
            +ASQEP  N     +++PL
Sbjct  74   RASQEP--NASTAAVVKPL  90



>ref|XP_008794318.1| PREDICTED: zinc finger protein 622-like [Phoenix dactylifera]
 ref|XP_008776890.1| PREDICTED: zinc finger protein 622-like [Phoenix dactylifera]
Length=426

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  150  VAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLK  329
            VAGV GVTEALF AR+S +AEE+ +L+ T MLY+C +CGKEYRSS+A+ QHLKS++H +K
Sbjct  96   VAGVSGVTEALFQARRSALAEERNQLSATAMLYSCALCGKEYRSSKAHDQHLKSRAHAMK  155

Query  330  ASQEPN  347
            ASQE +
Sbjct  156  ASQESD  161



>ref|XP_010059081.1| PREDICTED: cytoplasmic 60S subunit biogenesis factor SPCC550.15c-like 
[Eucalyptus grandis]
Length=451

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 100/150 (67%), Gaps = 15/150 (10%)
 Frame = +3

Query  150  VAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLK  329
            VAGVPGVTEALFL RQ+ +A+EK   ++TPMLY+CG+CG+ YRS +A++QHL+S+SH+L 
Sbjct  112  VAGVPGVTEALFLVRQAALAQEKNMSSQTPMLYSCGICGRGYRSDKAHAQHLQSRSHIL-  170

Query  330  ASQEPNHNGENRVIIRPLQRPILDR-STQQVeedideseeseeseweevdeedmaeasds  506
                       R ++RPL   +  + + Q+     +  +  +E E  + +++ + EA++S
Sbjct  171  -----------RTLLRPLAPRVQSKPAPQKESGMAESEDSEDEWEEVDSEDDLVGEAANS  219

Query  507  LMQLQLNEHTSNGNMQ-DADMDDYSEELDP  593
            L ++ +NE +++ +M+ D+D DD+  E+DP
Sbjct  220  LSEMNVNELSTDHHMEDDSDNDDFC-EVDP  248



>gb|AES97876.2| hypothetical protein MTR_5g061270 [Medicago truncatula]
Length=203

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 64/83 (77%), Gaps = 6/83 (7%)
 Frame = +3

Query  150  VAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLK  329
            VAGVPGVTEALFLARQ+ +A+E+ +  E+PMLY+CG+CGK Y+S +A+++HLKS    ++
Sbjct  13   VAGVPGVTEALFLARQAELAQERDESNESPMLYSCGLCGKGYKSEKAHAEHLKS----MR  68

Query  330  ASQEPNHNGENRVIIRPL-QRPI  395
            AS E +   + + II+PL QR +
Sbjct  69   AS-EGDSQSDGKAIIKPLPQRDV  90



>emb|CDX95734.1| BnaC03g26150D [Brassica napus]
Length=197

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +3

Query  144  RKVAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            +KVAG PGV E LF ARQS +A EK K  E PMLYTC VCGK YRSS+A+ QH KS  H+
Sbjct  41   QKVAGAPGVAEELFEARQSALAMEKGKSDERPMLYTCRVCGKGYRSSKAHEQHCKSWRHV  100

Query  324  LKASQEPNHNGENRV  368
            L+ SQ    NG+  V
Sbjct  101  LRVSQGTASNGDEDV  115



>ref|XP_001779994.1| predicted protein [Physcomitrella patens]
 gb|EDQ55203.1| predicted protein, partial [Physcomitrella patens]
Length=381

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +3

Query  81   FKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCGV  260
            F D   QK HYK+EWHRYNL+RKVAGVPGVTEAL   R   +  E K      +LY C +
Sbjct  1    FADKELQKQHYKTEWHRYNLRRKVAGVPGVTEALHNLRIQGLEAEGKTKEGDRVLYKCAL  60

Query  261  CGKEYRSSQAYSQHLKSKSHLLKAS  335
            C KEY +++A++ HL+SK H+ +A+
Sbjct  61   CRKEYTTAKAHANHLESKLHVTRAA  85



>ref|XP_009961992.1| PREDICTED: zinc finger protein 622, partial [Tyto alba]
Length=202

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_010149978.1| PREDICTED: zinc finger protein 622 [Eurypyga helias]
 gb|KFV93343.1| Zinc finger protein 622 [Eurypyga helias]
Length=342

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 57/96 (59%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q V+AEE
Sbjct  1    MASYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVAEMPPVTAENFQERVLAQRVVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>gb|KFV39278.1| Zinc finger protein 622, partial [Tyto alba]
Length=205

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_003614918.1| C2H2 zinc finger protein FZF [Medicago truncatula]
Length=244

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 64/83 (77%), Gaps = 6/83 (7%)
 Frame = +3

Query  150  VAGVPGVTEALFLARQSVIAEEKKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLK  329
            VAGVPGVTEALFLARQ+ +A+E+ +  E+PMLY+CG+CGK Y+S +A+++HLKS    ++
Sbjct  13   VAGVPGVTEALFLARQAELAQERDESNESPMLYSCGLCGKGYKSEKAHAEHLKS----MR  68

Query  330  ASQEPNHNGENRVIIRPL-QRPI  395
            AS E +   + + II+PL QR +
Sbjct  69   AS-EGDSQSDGKAIIKPLPQRDV  90



>ref|XP_005010777.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 622 [Anas 
platyrhynchos]
Length=374

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            K K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   KNKVTAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_008496309.1| PREDICTED: zinc finger protein 622 [Calypte anna]
Length=351

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDAEIQRAHYKTDWHRYNLKRKVAEMPPVTAENFEERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009955918.1| PREDICTED: zinc finger protein 622 [Leptosomus discolor]
 gb|KFQ15286.1| Zinc finger protein 622 [Leptosomus discolor]
Length=469

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 57/96 (59%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q+ IAEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQTAIAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>gb|EOB07815.1| Zinc finger protein 622, partial [Anas platyrhynchos]
Length=469

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            K K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   KNKVTAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>gb|AAK97212.1|AF299386_1 putative Zn-finger protein C47L [Gallus gallus]
Length=374

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   RDKVTAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>sp|Q90Y35.1|ZN622_CHICK RecName: Full=Zinc finger protein 622; AltName: Full=Zn-finger 
protein C47 [Gallus gallus]
 gb|AAK97213.1|AF299387_1 putative Zn-finger protein C47S [Gallus gallus]
Length=405

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   RDKVTAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009882040.1| PREDICTED: zinc finger protein 622 [Charadrius vociferus]
 gb|KGL92229.1| Zinc finger protein 622 [Charadrius vociferus]
Length=469

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  IAEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAIAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_010122778.1| PREDICTED: zinc finger protein 622 [Chlamydotis macqueenii]
 gb|KFP36837.1| Zinc finger protein 622 [Chlamydotis macqueenii]
Length=469

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_003204860.1| PREDICTED: zinc finger protein 622 [Meleagris gallopavo]
Length=469

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   RDKVTAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_010175401.1| PREDICTED: zinc finger protein 622 [Caprimulgus carolinensis]
 gb|KFZ45703.1| Zinc finger protein 622 [Caprimulgus carolinensis]
Length=469

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_005484357.1| PREDICTED: zinc finger protein 622 [Zonotrichia albicollis]
Length=470

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_005041707.1| PREDICTED: zinc finger protein 622 isoform X1 [Ficedula albicollis]
 ref|XP_005041708.1| PREDICTED: zinc finger protein 622 isoform X2 [Ficedula albicollis]
Length=474

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>gb|KFO61817.1| Zinc finger protein 622 [Corvus brachyrhynchos]
Length=467

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|NP_989461.2| zinc finger protein 622 [Gallus gallus]
Length=469

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   RDKVTAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009907485.1| PREDICTED: zinc finger protein 622 [Picoides pubescens]
 gb|KFV76561.1| Zinc finger protein 622 [Picoides pubescens]
Length=468

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 57/96 (59%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C+  FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCHVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009980421.1| PREDICTED: zinc finger protein 622 [Tauraco erythrolophus]
 gb|KFV13854.1| Zinc finger protein 622 [Tauraco erythrolophus]
Length=469

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_010193686.1| PREDICTED: zinc finger protein 622 [Colius striatus]
Length=469

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADFQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_008635410.1| PREDICTED: zinc finger protein 622 [Corvus brachyrhynchos]
Length=471

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>gb|KFR13904.1| Zinc finger protein 622 [Opisthocomus hoazin]
Length=479

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKVTAT----YCAVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009323268.1| PREDICTED: zinc finger protein 622 [Pygoscelis adeliae]
 gb|KFW67768.1| Zinc finger protein 622 [Pygoscelis adeliae]
Length=469

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_008920936.1| PREDICTED: zinc finger protein 622 [Manacus vitellinus]
 gb|KFW79957.1| Zinc finger protein 622 [Manacus vitellinus]
Length=469

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009875577.1| PREDICTED: zinc finger protein 622 [Apaloderma vittatum]
 gb|KFP79648.1| Zinc finger protein 622 [Apaloderma vittatum]
Length=469

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_005530939.1| PREDICTED: zinc finger protein 622 [Pseudopodoces humilis]
Length=470

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_010129714.1| PREDICTED: zinc finger protein 622 [Buceros rhinoceros silvestris]
 gb|KFO86817.1| Zinc finger protein 622 [Buceros rhinoceros silvestris]
Length=469

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009679581.1| PREDICTED: zinc finger protein 622 [Struthio camelus australis]
 ref|XP_009679588.1| PREDICTED: zinc finger protein 622 [Struthio camelus australis]
 gb|KFV73715.1| Zinc finger protein 622 [Struthio camelus australis]
Length=470

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKVTAT----YCTVCSKRFATFNAYENHLKSKKHL  92



>ref|XP_009470313.1| PREDICTED: zinc finger protein 622 [Nipponia nippon]
 gb|KFR04938.1| Zinc finger protein 622 [Nipponia nippon]
Length=469

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MTTYTCITCRVAFKDADMQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009476736.1| PREDICTED: zinc finger protein 622 [Pelecanus crispus]
 gb|KFQ49577.1| Zinc finger protein 622 [Pelecanus crispus]
Length=469

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_010298371.1| PREDICTED: zinc finger protein 622 [Balearica regulorum gibbericeps]
Length=468

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009572955.1| PREDICTED: zinc finger protein 622 [Fulmarus glacialis]
 gb|KFW02129.1| Zinc finger protein 622 [Fulmarus glacialis]
Length=469

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>gb|KFP54392.1| Zinc finger protein 622 [Cathartes aura]
Length=469

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_005422625.1| PREDICTED: zinc finger protein 622 [Geospiza fortis]
Length=471

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_010185136.1| PREDICTED: zinc finger protein 622 [Mesitornis unicolor]
 gb|KFQ37778.1| Zinc finger protein 622 [Mesitornis unicolor]
Length=469

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_010225595.1| PREDICTED: zinc finger protein 622 isoform X2 [Tinamus guttatus]
 gb|KGL72339.1| Zinc finger protein 622 [Tinamus guttatus]
Length=471

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVAEMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009820658.1| PREDICTED: zinc finger protein 622 [Gavia stellata]
 gb|KFV49366.1| Zinc finger protein 622 [Gavia stellata]
Length=469

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_010225587.1| PREDICTED: zinc finger protein 622 isoform X1 [Tinamus guttatus]
Length=472

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVAEMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009936853.1| PREDICTED: zinc finger protein 622 [Opisthocomus hoazin]
Length=471

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKVTAT----YCAVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009911754.1| PREDICTED: zinc finger protein 622 [Haliaeetus albicilla]
 ref|XP_009911755.1| PREDICTED: zinc finger protein 622 [Haliaeetus albicilla]
 ref|XP_010569760.1| PREDICTED: zinc finger protein 622 [Haliaeetus leucocephalus]
 ref|XP_010569761.1| PREDICTED: zinc finger protein 622 [Haliaeetus leucocephalus]
 gb|KFP93499.1| Zinc finger protein 622 [Haliaeetus albicilla]
Length=469

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009286281.1| PREDICTED: zinc finger protein 622 [Aptenodytes forsteri]
 gb|KFM01626.1| Zinc finger protein 622 [Aptenodytes forsteri]
Length=469

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>gb|KFO09709.1| Zinc finger protein 622 [Balearica regulorum gibbericeps]
Length=473

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_010014921.1| PREDICTED: zinc finger protein 622 [Nestor notabilis]
 gb|KFQ42858.1| Zinc finger protein 622 [Nestor notabilis]
Length=469

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>gb|KFQ84619.1| Zinc finger protein 622 [Phoenicopterus ruber ruber]
Length=469

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009505834.1| PREDICTED: zinc finger protein 622 [Phalacrocorax carbo]
 gb|KFW92549.1| Zinc finger protein 622 [Phalacrocorax carbo]
Length=469

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>gb|KFO96100.1| Zinc finger protein 622 [Calypte anna]
Length=448

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDAEIQRAHYKTDWHRYNLKRKVAEMPPVTAENFEERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_008937252.1| PREDICTED: zinc finger protein 622 [Merops nubicus]
 gb|KFQ16680.1| Zinc finger protein 622 [Merops nubicus]
Length=467

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_010291352.1| PREDICTED: zinc finger protein 622 [Phaethon lepturus]
 gb|KFQ69785.1| Zinc finger protein 622 [Phaethon lepturus]
Length=462

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVAEMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>gb|KFZ65667.1| Zinc finger protein 622 [Podiceps cristatus]
Length=469

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVAEMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_010003388.1| PREDICTED: zinc finger protein 622 [Chaetura pelagica]
 gb|KFU95282.1| Zinc finger protein 622 [Chaetura pelagica]
Length=469

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVAEMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_010084783.1| PREDICTED: zinc finger protein 622 [Pterocles gutturalis]
 gb|KFU97200.1| Zinc finger protein 622 [Pterocles gutturalis]
Length=469

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  IAEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAIAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HL+SK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLRSKKHL  92



>ref|XP_009568575.1| PREDICTED: zinc finger protein 622 [Cuculus canorus]
 gb|KFO70706.1| Zinc finger protein 622 [Cuculus canorus]
Length=469

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKS+ HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSRKHL  92



>ref|XP_005498025.1| PREDICTED: zinc finger protein 622 isoform X1 [Columba livia]
 ref|XP_005498026.1| PREDICTED: zinc finger protein 622 isoform X2 [Columba livia]
 gb|EMC86977.1| Zinc finger protein 622 [Columba livia]
Length=469

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKVTAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_005153414.1| PREDICTED: zinc finger protein 622 [Melopsittacus undulatus]
Length=469

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKS+ HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSRKHL  92



>ref|XP_005235847.1| PREDICTED: zinc finger protein 622 [Falco peregrinus]
 ref|XP_005444534.1| PREDICTED: zinc finger protein 622 [Falco cherrug]
Length=467

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFEERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSNFNAYENHLKSKKHL  92



>ref|XP_008166808.1| PREDICTED: zinc finger protein 622 isoform X3 [Chrysemys picta 
bellii]
Length=427

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  31   MASYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVTEE  90

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  91   QNKVTAT----YCTVCSKRFSTFNAYENHLKSKKHL  122



>ref|XP_004175197.1| PREDICTED: zinc finger protein 622 [Taeniopygia guttata]
Length=470

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVTEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009702614.1| PREDICTED: zinc finger protein 622 [Cariama cristata]
 gb|KFP59623.1| Zinc finger protein 622 [Cariama cristata]
Length=469

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K++ T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKISAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_009636175.1| PREDICTED: zinc finger protein 622 [Egretta garzetta]
 gb|KFP15134.1| Zinc finger protein 622 [Egretta garzetta]
Length=470

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFQDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_005290262.1| PREDICTED: zinc finger protein 622 isoform X2 [Chrysemys picta 
bellii]
Length=466

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  1    MASYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVTEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKVTAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_006027689.1| PREDICTED: zinc finger protein 622 isoform X1 [Alligator sinensis]
Length=489

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P +T   F  R   Q  +AEE
Sbjct  12   MAAYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPITAENFQERVLAQRAVAEE  71

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C  C K + +  AY  HLKSK HL
Sbjct  72   QSKITAT----YCTACSKRFSTFNAYENHLKSKKHL  103



>ref|XP_006027690.1| PREDICTED: zinc finger protein 622 isoform X2 [Alligator sinensis]
Length=488

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P +T   F  R   Q  +AEE
Sbjct  12   MAAYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPITAENFQERVLAQRAVAEE  71

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C  C K + +  AY  HLKSK HL
Sbjct  72   QSKITAT----YCTACSKRFSTFNAYENHLKSKKHL  103



>ref|XP_006261028.1| PREDICTED: zinc finger protein 622 isoform X2 [Alligator mississippiensis]
Length=475

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P +T   F  R   Q  +AEE
Sbjct  1    MAAYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPITAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C  C K + +  AY  HLKSK HL
Sbjct  61   QSKITAT----YCTACSKRFSTFNAYENHLKSKRHL  92



>ref|XP_006261027.1| PREDICTED: zinc finger protein 622 isoform X1 [Alligator mississippiensis]
Length=476

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P +T   F  R   Q  +AEE
Sbjct  1    MAAYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPITAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C  C K + +  AY  HLKSK HL
Sbjct  61   QSKITAT----YCTACSKRFSTFNAYENHLKSKRHL  92



>ref|XP_009076748.1| PREDICTED: zinc finger protein 622 [Acanthisitta chloris]
 gb|KFP72291.1| Zinc finger protein 622 [Acanthisitta chloris]
Length=469

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVTEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKVTAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_005290261.1| PREDICTED: zinc finger protein 622 isoform X1 [Chrysemys picta 
bellii]
Length=496

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  31   MASYTCITCRVAFKDADVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVTEE  90

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  91   QNKVTAT----YCTVCSKRFSTFNAYENHLKSKKHL  122



>emb|CAJ83907.1| zinc finger protein 622 [Xenopus (Silurana) tropicalis]
Length=218

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 53/96 (55%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC +C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  1    MASYTCISCRVAFADPDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVVEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C  C K + S  AY  HLKSK HL
Sbjct  61   QSKETAT----YCTACSKRFASFNAYENHLKSKKHL  92



>gb|KIJ18836.1| hypothetical protein PAXINDRAFT_127953 [Paxillus involutus ATCC 
200175]
Length=446

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 70/121 (58%), Gaps = 5/121 (4%)
 Frame = +3

Query  48   PGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIA-EEKKK  224
            P  TC +C+  F    +Q+ HY+S+ HRYN+KR+VA +P V+ A+F   Q V+   ++  
Sbjct  6    PFFTCLSCSIAFTSPEDQRTHYRSDHHRYNMKRRVASLPPVSAAVF--NQKVLERRQETA  63

Query  225  LTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEP--NHNGENRVIIRPLQRPIL  398
            +T +   ++C +CGK Y +  AYS H+ SK H    SQ P  NH+G       P + P+L
Sbjct  64   VTSSSKGFSCDLCGKTYTTMNAYSSHINSKKHKETKSQNPQSNHDGLYESPASPPRSPVL  123

Query  399  D  401
            +
Sbjct  124  E  124



>gb|EMP28578.1| hypothetical protein UY3_14325 [Chelonia mydas]
Length=418

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 54/96 (56%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  1    MASYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVTEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C  C K + +  AY  HLKSK HL
Sbjct  61   QNKVTAT----YCTACSKRFSTLNAYENHLKSKKHL  92



>ref|XP_009094102.1| PREDICTED: zinc finger protein 622 [Serinus canaria]
Length=470

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQ---SVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R      +AEE
Sbjct  1    MATYTCITCRVAFKDGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLALRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  AY  HLKSK HL
Sbjct  61   QNKVTAT----YCTVCSKRFSTFNAYENHLKSKKHL  92



>ref|XP_008611697.1| hypothetical protein SDRG_07629 [Saprolegnia diclina VS20]
 gb|EQC34825.1| hypothetical protein SDRG_07629 [Saprolegnia diclina VS20]
Length=392

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 67/119 (56%), Gaps = 8/119 (7%)
 Frame = +3

Query  54   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTE  233
            LTC AC +EF     QK H+K +WHRYNLKRKV G+P VTEA F AR++  A       +
Sbjct  2    LTCTACREEFPTYELQKEHFKLDWHRYNLKRKVVGLPAVTEAQFQARKADGASALAAAPK  61

Query  234  TP---MLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILD  401
             P   M Y C  CGK + +++A   H  +K H+    +    +GE ++  + L+ P+ D
Sbjct  62   EPPVDMSYKCHNCGKSFTNTKALDNHKATKKHMAAVKK----DGEEKITSKVLE-PVKD  115



>ref|XP_006126163.1| PREDICTED: zinc finger protein 622-like isoform X2 [Pelodiscus 
sinensis]
Length=465

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 54/96 (56%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MASFTCITCRVAFKDADFQRAHYKTDWHRYNLKRKVADMPPVTVENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C  C K + +  AY  HLKSK HL
Sbjct  61   QNKDTAT----YCTACSKRFSTFNAYENHLKSKKHL  92



>ref|XP_006126162.1| PREDICTED: zinc finger protein 622-like isoform X1 [Pelodiscus 
sinensis]
Length=476

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 54/96 (56%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  12   MASFTCITCRVAFKDADFQRAHYKTDWHRYNLKRKVADMPPVTVENFQERVLAQRAVAEE  71

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C  C K + +  AY  HLKSK HL
Sbjct  72   QNKDTAT----YCTACSKRFSTFNAYENHLKSKKHL  103



>ref|XP_007067500.1| PREDICTED: zinc finger protein 622 [Chelonia mydas]
Length=496

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 54/96 (56%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  31   MASYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVTEE  90

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C  C K + +  AY  HLKSK HL
Sbjct  91   QNKVTAT----YCTACSKRFSTLNAYENHLKSKKHL  122



>ref|XP_003466756.1| PREDICTED: zinc finger protein 622 isoform X1 [Cavia porcellus]
Length=480

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>gb|KFO24852.1| Zinc finger protein 622 [Fukomys damarensis]
Length=472

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>ref|XP_005002366.1| PREDICTED: zinc finger protein 622 isoform X2 [Cavia porcellus]
Length=478

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>ref|XP_010642309.1| PREDICTED: zinc finger protein 622 [Fukomys damarensis]
Length=475

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>ref|XP_003759684.1| PREDICTED: zinc finger protein 622 [Sarcophilus harrisii]
Length=435

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYKS+WHRYNLKRKVA +  VT   F  R   Q  +AEE
Sbjct  1    MASYTCITCRVAFKDADIQRAHYKSDWHRYNLKRKVADMAPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ +  AY  HLKS+ HL
Sbjct  61   ESKGTAT----YCTVCSKKFATFNAYENHLKSRRHL  92



>ref|XP_003340644.1| PREDICTED: zinc finger protein 622 [Monodelphis domestica]
Length=467

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FKD   Q+ HYKS+WHRYNLKRKVA +  VT   F  R   Q  +AEE
Sbjct  1    MASYTCITCRVAFKDADIQRAHYKSDWHRYNLKRKVADMAPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ +  AY  HLKS+ HL
Sbjct  61   ESKGTAT----YCTVCSKKFATFNAYENHLKSRRHL  92



>ref|XP_005002367.1| PREDICTED: zinc finger protein 622 isoform X3 [Cavia porcellus]
Length=447

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>ref|XP_010398489.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 622 [Corvus 
cornix cornix]
Length=473

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   FK+   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFKEGDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K+T T     C VC K + +  A   HLKSK HL
Sbjct  61   QNKITAT----YCTVCSKRFSTFNAXENHLKSKKHL  92



>ref|XP_001200563.1| PREDICTED: zinc finger protein 622-like [Strongylocentrotus purpuratus]
Length=437

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 55/95 (58%), Gaps = 9/95 (9%)
 Frame = +3

Query  48   PGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF----LARQSVIAEE  215
            P  TC +C   F     Q+ HYKS+WHRYNLKRKVA +P VT   F    LA+QS  AEE
Sbjct  4    PVFTCISCRVAFASMDLQRAHYKSDWHRYNLKRKVAELPPVTAVEFKQRLLAQQSKTAEE  63

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSH  320
             +  +       CGVCGK + +  AY+ HL SK H
Sbjct  64   ARDTST-----RCGVCGKHFGTENAYTNHLGSKKH  93



>ref|XP_004583683.1| PREDICTED: zinc finger protein 622 [Ochotona princeps]
Length=459

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 57/96 (59%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC +C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AE 
Sbjct  1    MATYTCISCRVAFRDAELQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVWAQRAVAER  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + + T T     C VCGK++ S  AY  HL+S+ HL
Sbjct  61   ESQGTAT----YCTVCGKKFASLNAYENHLRSRRHL  92



>ref|XP_004078799.1| PREDICTED: zinc finger protein 622 [Oryzias latipes]
Length=464

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 56/95 (59%), Gaps = 5/95 (5%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC +C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  +AE+
Sbjct  1    MASYTCISCRVTFADGEVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLLQRAVAEQ  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSH  320
              +L+E+     CGVC K + S+ A+  HL+S  H
Sbjct  61   --QLSESTATEVCGVCNKRFSSANAHQNHLQSHKH  93



>ref|XP_007577180.1| PREDICTED: zinc finger protein 622 [Poecilia formosa]
 ref|XP_007577181.1| PREDICTED: zinc finger protein 622 [Poecilia formosa]
Length=454

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 56/95 (59%), Gaps = 5/95 (5%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEK--  218
            M   TC +C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R  V+A+    
Sbjct  1    MASYTCISCRVAFADGEVQRAHYKTDWHRYNLKRKVADMPPVTAENFQER--VLAQRAAT  58

Query  219  -KKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSH  320
             ++LT      +CGVC K++ S+ AY  HL+S  H
Sbjct  59   DQQLTHAAATESCGVCSKKFSSANAYQNHLQSHKH  93



>ref|NP_001011460.1| zinc finger protein 622 [Xenopus (Silurana) tropicalis]
 gb|AAH88572.1| zinc finger protein 622 [Xenopus (Silurana) tropicalis]
Length=466

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 53/96 (55%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC +C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  1    MASYTCISCRVAFADPDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVVEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C  C K + S  AY  HLKSK HL
Sbjct  61   QSKETAT----YCTACSKRFASFNAYENHLKSKKHL  92



>ref|XP_008819991.1| PREDICTED: zinc finger protein 622 isoform X2 [Nannospalax galili]
Length=448

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ +  AY  HL+S+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFATFNAYDNHLRSRRHV  92



>ref|XP_005796649.1| PREDICTED: zinc finger protein 622-like [Xiphophorus maculatus]
Length=459

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 56/95 (59%), Gaps = 5/95 (5%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEK--  218
            M   TC +C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R  V+A+    
Sbjct  1    MASYTCISCRVAFADGEVQRAHYKTDWHRYNLKRKVADMPPVTAENFQER--VLAQRAAA  58

Query  219  -KKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSH  320
             ++LT      +CGVC K++ S+ AY  HL+S  H
Sbjct  59   NQQLTHAAATESCGVCSKKFSSANAYQNHLQSHKH  93



>ref|XP_008433012.1| PREDICTED: zinc finger protein 622 [Poecilia reticulata]
Length=459

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 56/95 (59%), Gaps = 5/95 (5%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEK--  218
            M   TC +C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R  V+A+    
Sbjct  1    MASYTCISCRVAFADGEVQRAHYKTDWHRYNLKRKVADMPPVTAENFQER--VLAQRAAA  58

Query  219  -KKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSH  320
             ++LT      +CGVC K++ S+ AY  HL+S  H
Sbjct  59   DQQLTHAAATESCGVCSKKFSSANAYQNHLQSHKH  93



>gb|KDO30833.1| hypothetical protein SPRG_04734 [Saprolegnia parasitica CBS 223.65]
Length=390

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 67/119 (56%), Gaps = 8/119 (7%)
 Frame = +3

Query  54   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKL-T  230
            LTC AC +EF     QK H+K +WHRYNLKRKV G+P VTEA F AR++  A        
Sbjct  2    LTCTACREEFPTYELQKEHFKLDWHRYNLKRKVVGLPPVTEAQFQARKADGASALAAAPK  61

Query  231  ETP--MLYTCGVCGKEYRSSQAYSQHLKSKSHLLKASQEPNHNGENRVIIRPLQRPILD  401
            E P  M Y C  CGK + +++A   H  +K H+    +    +GE ++  + L+ P+ D
Sbjct  62   EAPVDMSYKCHNCGKSFTNTKALDNHKATKKHMAAVKK----DGEEKITSKVLE-PVKD  115



>ref|XP_004641912.1| PREDICTED: zinc finger protein 622-like [Octodon degus]
Length=478

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 57/96 (59%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC +C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AE+
Sbjct  1    MATYTCISCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVHAQRAVAEQ  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + + T T     C VC K++ S  AY  HL+S+ H+
Sbjct  61   ESRATAT----YCTVCSKKFASFNAYENHLRSRRHV  92



>ref|XP_004644793.1| PREDICTED: zinc finger protein 622 [Octodon degus]
Length=480

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 57/96 (59%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC +C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AE+
Sbjct  1    MATYTCISCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVHAQRAVAEQ  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + + T T     C VC K++ S  AY  HL+S+ H+
Sbjct  61   ESRATAT----YCTVCSKKFASFNAYENHLRSRRHV  92



>ref|XP_005386190.1| PREDICTED: zinc finger protein 622 isoform X1 [Chinchilla lanigera]
Length=476

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAELQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRVQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ S  AY  HL+S+ H+
Sbjct  61   EGKGTAT----YCTVCSKKFASFNAYENHLRSRRHV  92



>ref|XP_005386191.1| PREDICTED: zinc finger protein 622 isoform X2 [Chinchilla lanigera]
Length=478

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAELQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRVQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ S  AY  HL+S+ H+
Sbjct  61   EGKGTAT----YCTVCSKKFASFNAYENHLRSRRHV  92



>emb|CDQ00177.1| Protein Bm13985, isoform a [Brugia malayi]
Length=378

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 57/94 (61%), Gaps = 7/94 (7%)
 Frame = +3

Query  51   GLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEK----  218
            GLTC  C   F ++  Q+ HYK++WHRYNLKRK+ G P VTE  F  RQ +IA +K    
Sbjct  6    GLTCLCCQSVFANNDLQREHYKTDWHRYNLKRKITGFPIVTEEQF--RQKIIAYKKETDD  63

Query  219  KKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSH  320
            +K  ET +   C  C K ++S+ AY  HL S+ H
Sbjct  64   EKNAETKVA-ICKCCSKRFQSANAYDNHLSSRKH  96



>ref|XP_008819990.1| PREDICTED: zinc finger protein 622 isoform X1 [Nannospalax galili]
Length=471

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ +  AY  HL+S+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFATFNAYDNHLRSRRHV  92



>ref|XP_001899722.1| Zinc finger, C2H2 type family protein [Brugia malayi]
Length=378

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 57/94 (61%), Gaps = 7/94 (7%)
 Frame = +3

Query  51   GLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEK----  218
            GLTC  C   F ++  Q+ HYK++WHRYNLKRK+ G P VTE  F  RQ +IA +K    
Sbjct  6    GLTCLCCQSVFANNDLQREHYKTDWHRYNLKRKITGFPIVTEEQF--RQKIIAYKKETDD  63

Query  219  KKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSH  320
            +K  ET +   C  C K ++S+ AY  HL S+ H
Sbjct  64   EKNAETKVA-ICKCCSKRFQSANAYDNHLSSRKH  96



>ref|XP_004845257.1| PREDICTED: zinc finger protein 622 [Heterocephalus glaber]
Length=477

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +A E
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAAE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFGSFNAYENHLKSRRHV  92



>ref|XP_004884669.1| PREDICTED: zinc finger protein 622 [Heterocephalus glaber]
 gb|EHB02941.1| Zinc finger protein 622 [Heterocephalus glaber]
Length=478

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVAG+  VT   F  R   Q  +A E
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVAGMAPVTAEGFQERVRAQRAVAAE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFGSFNAYENHLKSRRHV  92



>ref|XP_789492.3| PREDICTED: zinc finger protein 622-like [Strongylocentrotus purpuratus]
Length=437

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 54/95 (57%), Gaps = 9/95 (9%)
 Frame = +3

Query  48   PGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALF----LARQSVIAEE  215
            P  TC +C   F     Q+ HYKS+WHRYNLKRKVA +P VT   F    LA+QS  AE 
Sbjct  4    PVFTCISCRVAFASMDLQRAHYKSDWHRYNLKRKVAELPPVTAVEFKQRLLAQQSKTAEA  63

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSH  320
             +  +       CGVCGK + +  AY+ HL SK H
Sbjct  64   ARDTST-----RCGVCGKHFGTENAYTNHLGSKKH  93



>gb|AAO13531.1| zinc finger protein Yan [Bufo gargarizans]
Length=468

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 52/96 (54%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q  + EE
Sbjct  1    MASYTCITCRVAFADPDIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVVEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C  C K + +  AY  HLKSK HL
Sbjct  61   QSKETAT----YCTACSKRFSTFNAYENHLKSKKHL  92



>ref|XP_005319724.1| PREDICTED: zinc finger protein 622 [Ictidomys tridecemlineatus]
Length=477

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVANMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>ref|XP_003287650.1| hypothetical protein DICPUDRAFT_91955 [Dictyostelium purpureum]
 gb|EGC35813.1| hypothetical protein DICPUDRAFT_91955 [Dictyostelium purpureum]
Length=154

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 53/89 (60%), Gaps = 1/89 (1%)
 Frame = +3

Query  54   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLTE  233
             TC +C  +F+   +Q+ HYKSE HR+NLKRK   +P V E  F ++   + +E+ K T 
Sbjct  7    FTCISCRIQFEHSEDQREHYKSELHRFNLKRKAFDLPPVNEQTFKSKVEALKQEQNKKT-  65

Query  234  TPMLYTCGVCGKEYRSSQAYSQHLKSKSH  320
            TP  + C +C KE+ S   Y QHL SK H
Sbjct  66   TPEKFECRICDKEFASDGPYQQHLSSKKH  94



>sp|Q7TM96.2|ZN622_RAT RecName: Full=Zinc finger protein 622; AltName: Full=Liver regeneration-related 
protein LRRG121 [Rattus norvegicus]
Length=386

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVANMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ +  AY  HLKS+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFATFNAYENHLKSRRHV  92



>ref|XP_001830498.1| cytoplasmic protein [Coprinopsis cinerea okayama7#130]
 gb|EAU91378.1| cytoplasmic protein [Coprinopsis cinerea okayama7#130]
Length=458

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 55/91 (60%), Gaps = 5/91 (5%)
 Frame = +3

Query  54   LTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKK--L  227
             TC +C+  F    EQ+LHY+S+ HRYN+KR+VAG+P ++  LF  R   + E K +  +
Sbjct  12   FTCLSCSIAFLSAEEQRLHYRSDHHRYNMKRRVAGLPPISATLFNQR---VLERKTETAI  68

Query  228  TETPMLYTCGVCGKEYRSSQAYSQHLKSKSH  320
            T TP   TC +C K Y S   Y  HL+SK H
Sbjct  69   TTTPKSMTCEICNKVYTSENTYKSHLQSKKH  99



>ref|XP_010742488.1| PREDICTED: zinc finger protein 622 [Larimichthys crocea]
Length=466

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 55/95 (58%), Gaps = 5/95 (5%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC +C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R   Q V AE+
Sbjct  1    MSSYTCISCRVAFADGEVQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRVAAEQ  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSH  320
              +L++      C VC K++ S+ AY  HL+S  H
Sbjct  61   --QLSDAASTEGCAVCSKKFSSANAYQNHLQSHKH  93



>gb|EPY72545.1| zinc finger protein 622 [Camelus ferus]
Length=435

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 57/105 (54%), Gaps = 7/105 (7%)
 Frame = +3

Query  18   LNPIHNFEEMPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR-  194
            L P  +   M   TCN C     D   Q+ HYK++WHRYNL+RKVAG+  V+   F  R 
Sbjct  22   LLPFSSHLAMATYTCNTCRVALYDAEAQRAHYKTDWHRYNLRRKVAGMAPVSAEGFQERV  81

Query  195  --QSVIAEEKKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
              Q  +AE + K   T     C VC K++ S +AY  HLKS+ H+
Sbjct  82   RAQRALAEPESKGAAT----YCAVCSKKFASFKAYENHLKSRRHV  122



>ref|XP_006804666.1| PREDICTED: zinc finger protein 622-like [Neolamprologus brichardi]
Length=422

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 55/95 (58%), Gaps = 5/95 (5%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEK--  218
            M   TC +C   F D   Q+ HYK++WHRYNLKRKVA +P VT   F  R  V+A+    
Sbjct  1    MASYTCISCRVAFADGEVQRAHYKTDWHRYNLKRKVADMPPVTAENFQER--VLAQRAAA  58

Query  219  -KKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSH  320
             ++LT+      C +C K++ S+ AY  HL+S  H
Sbjct  59   DQQLTDASATEYCAICNKKFSSANAYQNHLQSHKH  93



>gb|EDL82619.1| zinc finger protein 622, isoform CRA_a [Rattus norvegicus]
Length=406

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVANMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ +  AY  HLKS+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFATFNAYENHLKSRRHV  92



>gb|EJD75085.1| hypothetical protein LOAG_17697 [Loa loa]
Length=383

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 54/93 (58%), Gaps = 5/93 (5%)
 Frame = +3

Query  51   GLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVIAEEKKKLT  230
            GLTC  C   F +   Q+ HYK++WHRYNLKRK+ G   +TE  F  RQ VIA +K+   
Sbjct  6    GLTCLCCQAVFGNSDLQREHYKTDWHRYNLKRKITGFTIITEEQF--RQKVIAYKKETTA  63

Query  231  ETPM---LYTCGVCGKEYRSSQAYSQHLKSKSH  320
            E      +  C  CGK ++S+ AY  HL S+ H
Sbjct  64   EESTETRMIICKCCGKHFQSTNAYDNHLSSRKH  96



>ref|XP_635923.1| C2H2-type zinc finger-containing protein [Dictyostelium discoideum 
AX4]
 gb|EAL62420.1| C2H2-type zinc finger-containing protein [Dictyostelium discoideum 
AX4]
Length=402

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +3

Query  27   IHNFEEMPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVI  206
            + +++E    TC +C  +F++  EQ+ HYKSE HR+NLKRK   +P V E  F  +   +
Sbjct  1    MSDYDEKIIFTCISCRIQFENSEEQRDHYKSELHRFNLKRKAFDLPPVNEQTFKNKVEAL  60

Query  207  AEEKKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSH  320
             +E+ K ++TP  + C +C KE+ S   Y QHL SK H
Sbjct  61   KQEESK-SKTPAKFECRICDKEFNSDGTYQQHLTSKKH  97



>ref|NP_001009652.1| zinc finger protein 622 [Rattus norvegicus]
 ref|XP_008773315.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 622 [Rattus 
norvegicus]
 ref|XP_008759044.1| PREDICTED: zinc finger protein 622 [Rattus norvegicus]
 gb|AAH88214.1| Zinc finger protein 622 [Rattus norvegicus]
Length=470

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVANMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ +  AY  HLKS+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFATFNAYENHLKSRRHV  92



>ref|XP_006591049.1| PREDICTED: zinc finger protein 622-like isoform X2 [Glycine max]
Length=347

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVA  155
            MPGLTCNACN EFKDD EQKLHYKSEWHRYNLKRK +
Sbjct  1    MPGLTCNACNTEFKDDTEQKLHYKSEWHRYNLKRKAS  37



>ref|XP_008260303.1| PREDICTED: zinc finger protein 622 [Oryctolagus cuniculus]
Length=476

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AE+
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVWAQRAVAEQ  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>ref|XP_007959442.1| PREDICTED: zinc finger protein 622 [Chlorocebus sabaeus]
Length=477

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K + T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGSAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>ref|XP_003310680.1| PREDICTED: zinc finger protein 622 [Pan troglodytes]
Length=476

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K + T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGSAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>ref|XP_002815490.1| PREDICTED: zinc finger protein 622 [Pongo abelii]
Length=472

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K + T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGSAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>ref|XP_010354635.1| PREDICTED: zinc finger protein 622 [Rhinopithecus roxellana]
Length=477

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K + T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGSAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>ref|XP_003821988.1| PREDICTED: zinc finger protein 622 [Pan paniscus]
Length=477

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K + T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGSAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>ref|NP_219482.1| zinc finger protein 622 [Homo sapiens]
 sp|Q969S3.1|ZN622_HUMAN RecName: Full=Zinc finger protein 622; AltName: Full=Zinc finger-like 
protein 9 [Homo sapiens]
 gb|AAH08752.1| Zinc finger protein 622 [Homo sapiens]
 gb|AAH10545.1| Zinc finger protein 622 [Homo sapiens]
 gb|AAL02121.1| zinc finger-like protein 9 [Homo sapiens]
 gb|EAX08025.1| zinc finger protein 622 [Homo sapiens]
 dbj|BAG10213.1| zinc finger protein 622 [synthetic construct]
Length=477

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K + T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGSAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>ref|XP_003263222.1| PREDICTED: zinc finger protein 622 [Nomascus leucogenys]
Length=477

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K + T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGSAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>ref|XP_003899566.1| PREDICTED: zinc finger protein 622 isoform X2 [Papio anubis]
Length=476

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K + T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGSAT----YCTVCSKKFASFNAYDNHLKSRRHV  92



>ref|XP_004059066.1| PREDICTED: zinc finger protein 622 [Gorilla gorilla gorilla]
Length=477

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K + T     C VC K++ S  AY  HLKS+ H+
Sbjct  61   ESKGSAT----YCTVCSKKFASFNAYENHLKSRRHV  92



>ref|XP_005356713.1| PREDICTED: zinc finger protein 622 [Microtus ochrogaster]
Length=473

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +3

Query  45   MPGLTCNACNKEFKDDAEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLAR---QSVIAEE  215
            M   TC  C   F+D   Q+ HYK++WHRYNL+RKVA +  VT   F  R   Q  +AEE
Sbjct  1    MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVADMDPVTAEGFQERVRAQRAVAEE  60

Query  216  KKKLTETPMLYTCGVCGKEYRSSQAYSQHLKSKSHL  323
            + K T T     C VC K++ + +AY  HLKS+ H+
Sbjct  61   ESKGTAT----YCTVCSKKFATFKAYENHLKSRRHV  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 778590373395