BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF018I04

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB09427.1|  hypothetical protein B456_001G141300                    358   2e-118   Gossypium raimondii
ref|XP_007051015.1|  Fumarase 1 isoform 1                               358   2e-118   
ref|XP_007051016.1|  Fumarase 1 isoform 2                               358   2e-118   
ref|XP_009622148.1|  PREDICTED: fumarate hydratase 1, mitochondri...    357   2e-118   Nicotiana tomentosiformis
ref|XP_009778286.1|  PREDICTED: fumarate hydratase 1, mitochondri...    357   3e-118   Nicotiana sylvestris
ref|NP_001275422.1|  fumarate hydratase 1, mitochondrial-like           347   3e-114   Solanum tuberosum [potatoes]
ref|XP_006359871.1|  PREDICTED: fumarate hydratase 1, mitochondri...    347   4e-114   
ref|XP_002523133.1|  aspartate ammonia lyase, putative                  345   6e-114   
ref|XP_006480011.1|  PREDICTED: fumarate hydratase 1, mitochondri...    346   1e-113   
ref|XP_008235134.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    345   2e-113   
ref|XP_007200983.1|  hypothetical protein PRUPE_ppa004758mg             344   3e-113   Prunus persica
gb|KDO87115.1|  hypothetical protein CISIN_1g010908mg                   342   4e-113   Citrus sinensis [apfelsine]
ref|XP_004247395.1|  PREDICTED: fumarate hydratase 1, mitochondrial     344   5e-113   Solanum lycopersicum
gb|KDO87114.1|  hypothetical protein CISIN_1g010908mg                   342   1e-112   Citrus sinensis [apfelsine]
gb|KDP28204.1|  hypothetical protein JCGZ_13975                         342   2e-112   Jatropha curcas
ref|XP_011079617.1|  PREDICTED: fumarate hydratase 1, mitochondrial     342   2e-112   Sesamum indicum [beniseed]
ref|XP_006444417.1|  hypothetical protein CICLE_v10019838mg             342   2e-112   
ref|XP_006444418.1|  hypothetical protein CICLE_v10019838mg             342   2e-112   Citrus clementina [clementine]
gb|EYU46762.1|  hypothetical protein MIMGU_mgv1a005258mg                340   9e-112   Erythranthe guttata [common monkey flower]
ref|XP_006397946.1|  hypothetical protein EUTSA_v10001422mg             340   1e-111   Eutrema salsugineum [saltwater cress]
ref|XP_011458750.1|  PREDICTED: fumarate hydratase 1, mitochondri...    340   1e-111   Fragaria vesca subsp. vesca
ref|XP_011458749.1|  PREDICTED: fumarate hydratase 1, mitochondri...    340   1e-111   Fragaria vesca subsp. vesca
emb|CDY57717.1|  BnaC04g51900D                                          340   2e-111   Brassica napus [oilseed rape]
ref|XP_010259454.1|  PREDICTED: fumarate hydratase 1, mitochondrial     340   2e-111   Nelumbo nucifera [Indian lotus]
ref|XP_010245463.1|  PREDICTED: fumarate hydratase 1, mitochondri...    340   8e-111   
ref|XP_002880309.1|  hypothetical protein ARALYDRAFT_483931             338   8e-111   
ref|XP_008386708.1|  PREDICTED: fumarate hydratase 1, mitochondrial     340   9e-111   
ref|NP_182273.1|  fumarate hydratase 1                                  338   9e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009142525.1|  PREDICTED: fumarate hydratase 1, mitochondrial     338   1e-110   Brassica rapa
ref|XP_010069886.1|  PREDICTED: fumarate hydratase 1, mitochondrial     338   1e-110   Eucalyptus grandis [rose gum]
ref|XP_010523964.1|  PREDICTED: fumarate hydratase 1, mitochondrial     337   2e-110   Tarenaya hassleriana [spider flower]
dbj|BAH19491.1|  AT2G47510                                              337   2e-110   Arabidopsis thaliana [mouse-ear cress]
emb|CDX80112.1|  BnaA05g00440D                                          336   4e-110   
ref|XP_010507880.1|  PREDICTED: fumarate hydratase 1, mitochondri...    336   7e-110   Camelina sativa [gold-of-pleasure]
gb|KHG29130.1|  Fumarate hydratase 1, mitochondrial -like protein       334   1e-109   Gossypium arboreum [tree cotton]
ref|XP_006296086.1|  hypothetical protein CARUB_v10025236mg             335   1e-109   Capsella rubella
ref|XP_010506787.1|  PREDICTED: fumarate hydratase 1, mitochondri...    335   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010507882.1|  PREDICTED: fumarate hydratase 1, mitochondri...    334   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010518455.1|  PREDICTED: fumarate hydratase 1, mitochondri...    334   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010680310.1|  PREDICTED: fumarate hydratase 1, mitochondrial     333   5e-109   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP17101.1|  unnamed protein product                                333   5e-109   Coffea canephora [robusta coffee]
ref|XP_009346608.1|  PREDICTED: fumarate hydratase 1, mitochondrial     332   1e-108   Pyrus x bretschneideri [bai li]
ref|XP_002302734.1|  Fumarate hydratase 1 family protein                332   2e-108   Populus trichocarpa [western balsam poplar]
ref|XP_002273033.1|  PREDICTED: fumarate hydratase 1, mitochondrial     332   3e-108   Vitis vinifera
ref|XP_011007799.1|  PREDICTED: fumarate hydratase 1, mitochondrial     331   4e-108   Populus euphratica
gb|AAB39989.1|  fumarase                                                330   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004240578.1|  PREDICTED: fumarate hydratase 1, mitochondri...    329   2e-107   Solanum lycopersicum
ref|XP_007145184.1|  hypothetical protein PHAVU_007G217600g             330   2e-107   Phaseolus vulgaris [French bean]
ref|XP_002283168.2|  PREDICTED: fumarate hydratase 1, mitochondrial     329   3e-107   
gb|AAL62385.1|  fumarate hydratase                                      318   5e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009378742.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    330   1e-106   
ref|XP_008345222.1|  PREDICTED: fumarate hydratase 1, mitochondrial     327   1e-106   
ref|XP_008790868.1|  PREDICTED: fumarate hydratase 1, mitochondri...    325   7e-106   Phoenix dactylifera
ref|XP_008454312.1|  PREDICTED: fumarate hydratase 1, mitochondrial     325   8e-106   Cucumis melo [Oriental melon]
ref|XP_010938348.1|  PREDICTED: fumarate hydratase 1, mitochondrial     324   3e-105   Elaeis guineensis
ref|XP_004152237.1|  PREDICTED: fumarate hydratase 1, mitochondri...    323   4e-105   Cucumis sativus [cucumbers]
ref|XP_006280350.1|  hypothetical protein CARUB_v10026277mg             323   5e-105   Capsella rubella
ref|XP_010442577.1|  PREDICTED: fumarate hydratase 2, chloroplast...    323   5e-105   
ref|XP_010442576.1|  PREDICTED: fumarate hydratase 2, chloroplast...    323   6e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010482421.1|  PREDICTED: fumarate hydratase 2, chloroplast...    323   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010442609.1|  PREDICTED: fumarate hydratase 2, chloroplast...    322   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010442613.1|  PREDICTED: fumarate hydratase 2, chloroplast...    322   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_009384520.1|  PREDICTED: fumarate hydratase 1, mitochondrial     321   5e-104   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ85812.1|  unknown                                                 315   7e-104   Medicago truncatula
ref|XP_004495932.1|  PREDICTED: fumarate hydratase 1, mitochondri...    320   1e-103   Cicer arietinum [garbanzo]
ref|NP_199908.1|  fumarate hydratase 2                                  319   2e-103   Arabidopsis thaliana [mouse-ear cress]
emb|CDY27481.1|  BnaC04g51220D                                          318   3e-103   Brassica napus [oilseed rape]
ref|XP_010442599.1|  PREDICTED: fumarate hydratase 2, chloroplastic     318   3e-103   Camelina sativa [gold-of-pleasure]
ref|NP_851166.1|  fumarate hydratase 2                                  318   6e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003591472.1|  Fumarate hydratase                                 318   6e-103   Medicago truncatula
ref|XP_002864085.1|  hypothetical protein ARALYDRAFT_495160             318   9e-103   Arabidopsis lyrata subsp. lyrata
ref|XP_003518952.1|  PREDICTED: fumarate hydratase 1, mitochondrial     317   9e-103   Glycine max [soybeans]
ref|XP_003557953.1|  PREDICTED: fumarate hydratase 1, mitochondri...    317   2e-102   Brachypodium distachyon [annual false brome]
ref|XP_006281482.1|  hypothetical protein CARUB_v10027566mg             314   9e-102   
gb|EMS52788.1|  Fumarate hydratase 2, chloroplastic                     313   6e-101   Triticum urartu
ref|XP_004984441.1|  PREDICTED: fumarate hydratase 1, mitochondri...    313   6e-101   Setaria italica
gb|EMT27288.1|  Fumarate hydratase 2, chloroplastic                     313   7e-101   
ref|XP_009802913.1|  PREDICTED: fumarate hydratase 1, mitochondrial     311   1e-100   Nicotiana sylvestris
ref|XP_010103413.1|  Fumarate hydratase 1                               312   1e-100   Morus notabilis
ref|XP_010482423.1|  PREDICTED: fumarate hydratase 2, chloroplast...    311   4e-100   Camelina sativa [gold-of-pleasure]
gb|EEC75213.1|  hypothetical protein OsI_11478                          310   5e-100   Oryza sativa Indica Group [Indian rice]
gb|ABF95833.1|  Fumarate hydratase 1, mitochondrial precursor, pu...    310   5e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003518957.1|  PREDICTED: fumarate hydratase 1, mitochondri...    309   6e-100   Glycine max [soybeans]
gb|KHN08665.1|  Fumarate hydratase 2, chloroplastic                     309   6e-100   Glycine soja [wild soybean]
gb|KCW58396.1|  hypothetical protein EUGRSUZ_H01083                     310   7e-100   Eucalyptus grandis [rose gum]
ref|XP_010026118.1|  PREDICTED: fumarate hydratase 1, mitochondri...    310   7e-100   
ref|XP_006651566.1|  PREDICTED: fumarate hydratase 1, mitochondri...    310   9e-100   Oryza brachyantha
ref|XP_003536023.1|  PREDICTED: fumarate hydratase 1, mitochondri...    309   1e-99    Glycine max [soybeans]
ref|XP_008795801.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    308   2e-99    Phoenix dactylifera
gb|ABK24782.1|  unknown                                                 309   2e-99    Picea sitchensis
gb|KHN30668.1|  Fumarate hydratase 1, mitochondrial                     308   4e-99    Glycine soja [wild soybean]
ref|XP_008359427.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    308   5e-99    
gb|ACL53645.1|  unknown                                                 307   1e-98    Zea mays [maize]
ref|NP_001146296.1|  uncharacterized protein LOC100279871               307   1e-98    Zea mays [maize]
gb|KFK37522.1|  hypothetical protein AALP_AA4G268000                    304   1e-97    Arabis alpina [alpine rockcress]
ref|XP_004290822.2|  PREDICTED: fumarate hydratase 1, mitochondri...    300   3e-96    Fragaria vesca subsp. vesca
ref|XP_006840369.1|  hypothetical protein AMTR_s00045p00124970          300   4e-96    
ref|XP_007145185.1|  hypothetical protein PHAVU_007G217700g             293   7e-94    Phaseolus vulgaris [French bean]
gb|KJB22510.1|  hypothetical protein B456_004G051500                    292   2e-93    Gossypium raimondii
gb|EPS58214.1|  hypothetical protein M569_16601                         271   4e-87    Genlisea aurea
gb|EEE59021.1|  hypothetical protein OsJ_10766                          272   2e-85    Oryza sativa Japonica Group [Japonica rice]
emb|CDW80164.1|  fumarate mitochondrial-like                            259   3e-80    Stylonychia lemnae
ref|XP_001761516.1|  predicted protein                                  255   1e-78    
gb|EJY71120.1|  Fumarate hydratase                                      253   1e-77    Oxytricha trifallax
ref|XP_003037573.1|  hypothetical protein SCHCODRAFT_81011              251   8e-77    Schizophyllum commune H4-8
emb|CDS07604.1|  Putative Fumarase                                      250   9e-77    Lichtheimia ramosa
emb|CDH55360.1|  fumarate hydratase                                     250   1e-76    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005850869.1|  hypothetical protein CHLNCDRAFT_34079              249   2e-76    Chlorella variabilis
ref|XP_006958376.1|  fumarate hydratase                                 248   4e-76    Wallemia mellicola CBS 633.66
emb|CCG81126.1|  Fumarate hydratase, mitochondrial                      247   7e-76    Taphrina deformans PYCC 5710
emb|CCA67859.1|  probable FUM1-fumarate hydratase                       248   8e-76    Serendipita indica DSM 11827
ref|XP_001753417.1|  predicted protein                                  247   9e-76    
ref|XP_005650930.1|  fumarate hydratase                                 247   1e-75    Coccomyxa subellipsoidea C-169
gb|EPZ35407.1|  Fumarate hydratase, mitochondrial                       246   1e-75    Rozella allomycis CSF55
gb|EIE78369.1|  fumarate hydratase                                      247   1e-75    Rhizopus delemar RA 99-880
pir||JC4293  fumarate hydratase (EC 4.2.1.2) precursor - Rhizopus...    247   2e-75 
emb|CEP15950.1|  hypothetical protein                                   247   2e-75    Parasitella parasitica
ref|XP_007861040.1|  fumarate hydratase                                 247   2e-75    Gloeophyllum trabeum ATCC 11539
emb|CEG73219.1|  Putative AaceriACR013Cp                                247   2e-75    Rhizopus microsporus
ref|XP_009701525.1|  PREDICTED: fumarate hydratase, mitochondrial       239   3e-75    Cariama cristata
gb|KFP59440.1|  hypothetical protein N322_00331                         239   3e-75    Cariama cristata
ref|XP_008369102.1|  PREDICTED: fumarate hydratase 1, mitochondri...    235   3e-75    
ref|XP_008333578.1|  PREDICTED: fumarate hydratase, mitochondrial       246   3e-75    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_009489604.1|  PREDICTED: fumarate hydratase, mitochondrial       238   5e-75    Pelecanus crispus
gb|KFQ55579.1|  hypothetical protein N334_00310                         238   5e-75    Pelecanus crispus
gb|KIK60394.1|  hypothetical protein GYMLUDRAFT_244393                  245   9e-75    Gymnopus luxurians FD-317 M1
ref|XP_008595655.1|  fumarate hydratase                                 246   1e-74    Beauveria bassiana ARSEF 2860
gb|ACY91850.1|  fumarase                                                244   1e-74    Rhizopus oryzae
sp|P55250.1|FUMH_RHIOR  RecName: Full=Fumarate hydratase, mitocho...    245   1e-74    Rhizopus oryzae
ref|XP_008635756.1|  PREDICTED: fumarate hydratase, mitochondrial       244   1e-74    
gb|KGQ09969.1|  Fumarate hydratase                                      246   2e-74    Beauveria bassiana D1-5
emb|CDH51516.1|  fumarate hydratase                                     244   2e-74    Lichtheimia corymbifera JMRC:FSU:9682
dbj|GAN02812.1|  fumarate hydratase                                     244   2e-74    Mucor ambiguus
ref|XP_008530562.1|  PREDICTED: fumarate hydratase, mitochondrial       236   2e-74    Equus przewalskii [Przewalski horse]
ref|XP_008847403.1|  PREDICTED: fumarate hydratase, mitochondrial       244   3e-74    Nannospalax galili
ref|XP_006998748.1|  PREDICTED: fumarate hydratase, mitochondrial...    240   3e-74    
gb|KIK06867.1|  hypothetical protein K443DRAFT_129452                   243   3e-74    Laccaria amethystina LaAM-08-1
ref|XP_003008083.1|  fumarate hydratase                                 240   5e-74    Verticillium alfalfae VaMs.102
gb|KFH63115.1|  fumarate hydratase, mitochondrial                       243   5e-74    Mortierella verticillata NRRL 6337
emb|CDS05044.1|  Putative Fumarate hydratase, mitochondrial             242   8e-74    Lichtheimia ramosa
ref|XP_001442829.1|  hypothetical protein                               242   9e-74    Paramecium tetraurelia strain d4-2
ref|XP_009087608.1|  PREDICTED: fumarate hydratase, mitochondrial       242   1e-73    
gb|ESA01861.1|  hypothetical protein GLOINDRAFT_337726                  241   2e-73    
ref|XP_004450319.1|  PREDICTED: fumarate hydratase, mitochondrial...    242   2e-73    Dasypus novemcinctus
gb|KFX93722.1|  hypothetical protein V490_04713                         236   2e-73    Pseudogymnoascus sp. VKM F-3557
ref|XP_001873245.1|  predicted protein                                  242   2e-73    Laccaria bicolor S238N-H82
ref|XP_011272281.1|  fumarate hydratase                                 241   2e-73    Wickerhamomyces ciferrii
ref|XP_006102845.1|  PREDICTED: fumarate hydratase, mitochondrial       242   2e-73    Myotis lucifugus
ref|NP_034339.2|  fumarate hydratase, mitochondrial precursor           242   2e-73    Mus musculus [mouse]
gb|AAH06048.1|  Fumarate hydratase 1                                    242   2e-73    Mus musculus [mouse]
ref|XP_009278489.1|  PREDICTED: fumarate hydratase, mitochondrial       241   2e-73    Aptenodytes forsteri
ref|XP_007807229.1|  fumarate hydratase precursor                       243   2e-73    Metarhizium acridum CQMa 102
emb|CCO37210.1|  fumarate hydratase, class II                           234   3e-73    Rhizoctonia solani AG-1 IB
ref|XP_005884158.1|  PREDICTED: fumarate hydratase, mitochondrial       241   3e-73    
ref|XP_747830.1|  fumarate hydratase                                    243   3e-73    Aspergillus fumigatus Af293
ref|XP_011396762.1|  Fumarate hydratase 2, chloroplastic                240   3e-73    Auxenochlorella protothecoides
prf||1709138A  fumarase                                                 241   3e-73 
sp|P14408.1|FUMH_RAT  RecName: Full=Fumarate hydratase, mitochond...    241   3e-73    
ref|XP_010164262.1|  PREDICTED: fumarate hydratase, mitochondrial...    235   3e-73    
gb|KIO08161.1|  hypothetical protein M404DRAFT_14265                    241   4e-73    Pisolithus tinctorius Marx 270
gb|KFH43308.1|  Fumarate hydratase-like protein                         243   4e-73    Acremonium chrysogenum ATCC 11550
ref|NP_058701.2|  fumarate hydratase, mitochondrial precursor           241   4e-73    Rattus norvegicus [brown rat]
ref|XP_004895657.1|  PREDICTED: fumarate hydratase, mitochondrial...    239   4e-73    
ref|XP_004036528.1|  hypothetical protein IMG5_078680                   241   4e-73    Ichthyophthirius multifiliis
gb|AAY59704.1|  fumarate hydratase                                      240   5e-73    Cricetulus griseus [Chinese hamsters]
emb|CEJ82858.1|  Putative Fumarase                                      241   6e-73    Torrubiella hemipterigena
emb|CCF51284.1|  probable FUM1-fumarate hydratase                       241   6e-73    Ustilago hordei
ref|XP_006993784.1|  PREDICTED: fumarate hydratase, mitochondrial       240   6e-73    
ref|XP_005041811.1|  PREDICTED: fumarate hydratase, mitochondrial...    240   6e-73    
ref|XP_004578565.1|  PREDICTED: fumarate hydratase, mitochondrial       241   6e-73    Ochotona princeps [southern American pika]
emb|CAY86698.1|  Fum1p                                                  240   6e-73    Saccharomyces cerevisiae EC1118
gb|KIK28430.1|  hypothetical protein PISMIDRAFT_7450                    241   6e-73    Pisolithus microcarpus 441
ref|XP_010392198.1|  PREDICTED: fumarate hydratase, mitochondrial       240   6e-73    
ref|XP_009651690.1|  fumarate hydratase                                 241   6e-73    Verticillium dahliae VdLs.17
gb|KFO62089.1|  hypothetical protein N302_14449                         239   6e-73    Corvus brachyrhynchos
gb|AAA52483.1|  fumarase precursor (EC 4.2.1.2)                         239   6e-73    Homo sapiens [man]
gb|KFW87389.1|  hypothetical protein N305_02194                         239   7e-73    Manacus vitellinus
gb|KID89475.1|  fumarate hydratase                                      241   7e-73    Metarhizium guizhouense ARSEF 977
gb|KIL70702.1|  hypothetical protein M378DRAFT_6637                     240   7e-73    Amanita muscaria Koide BX008
ref|XP_005041810.1|  PREDICTED: fumarate hydratase, mitochondrial...    240   7e-73    
gb|KIM34410.1|  hypothetical protein M408DRAFT_325817                   239   8e-73    Serendipita vermifera MAFF 305830
ref|XP_005419421.1|  PREDICTED: fumarate hydratase, mitochondrial...    241   8e-73    
gb|EPE08450.1|  fumarate hydratase                                      241   8e-73    Ophiostoma piceae UAMH 11346
ref|NP_015061.1|  fumarase FUM1                                         240   8e-73    Saccharomyces cerevisiae S288C
ref|XP_005969001.1|  PREDICTED: fumarate hydratase, mitochondrial       240   9e-73    Pantholops hodgsonii [Tibetan antelope]
dbj|GAA26717.1|  K7_Fum1p                                               240   9e-73    Saccharomyces cerevisiae Kyokai no. 7
pdb|1YFM|A  Chain A, Recombinant Yeast Fumarase                         240   9e-73    Saccharomyces cerevisiae [brewer's yeast]
ref|XP_004895654.1|  PREDICTED: fumarate hydratase, mitochondrial...    239   9e-73    
ref|XP_007441617.1|  PREDICTED: fumarate hydratase, mitochondrial...    234   1e-72    
gb|KDN71424.1|  putative fumarate hydratase                             239   1e-72    Colletotrichum sublineola
ref|XP_007532622.1|  PREDICTED: fumarate hydratase, mitochondrial       240   1e-72    Erinaceus europaeus [common hedgehog]
gb|KHN98805.1|  fumarate hydratase                                      241   1e-72    Metarhizium album ARSEF 1941
ref|NP_001069271.1|  fumarate hydratase, mitochondrial                  240   1e-72    Bos taurus [bovine]
ref|XP_004711822.1|  PREDICTED: fumarate hydratase, mitochondrial...    240   1e-72    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_005897261.1|  PREDICTED: fumarate hydratase, mitochondrial       240   1e-72    Bos mutus
gb|KID72552.1|  fumarate hydratase                                      241   1e-72    Metarhizium brunneum ARSEF 3297
ref|XP_004330338.1|  PREDICTED: fumarate hydratase, mitochondrial...    238   1e-72    
ref|XP_002717380.1|  PREDICTED: fumarate hydratase, mitochondrial       240   1e-72    Oryctolagus cuniculus [domestic rabbit]
pdb|3E04|A  Chain A, Crystal Structure Of Human Fumarate Hydratase      239   1e-72    Homo sapiens [man]
gb|KIM67197.1|  hypothetical protein SCLCIDRAFT_14296                   239   1e-72    Scleroderma citrinum Foug A
gb|KFP81385.1|  hypothetical protein N311_05316                         238   1e-72    Apaloderma vittatum
gb|EPB87937.1|  fumarate hydratase, mitochondrial                       239   1e-72    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_006050829.1|  PREDICTED: fumarate hydratase, mitochondrial       240   1e-72    Bubalus bubalis [domestic water buffalo]
ref|NP_001155363.1|  fumarate hydratase, mitochondrial                  240   1e-72    Ovis aries [domestic sheep]
ref|XP_007820058.1|  fumarate hydratase                                 241   1e-72    Metarhizium robertsii ARSEF 23
ref|XP_007265454.1|  fumarate hydratase                                 239   1e-72    Fomitiporia mediterranea MF3/22
gb|KFV66685.1|  hypothetical protein N307_11320                         239   1e-72    Picoides pubescens
gb|KIE00198.1|  fumarate hydratase                                      241   1e-72    Metarhizium majus ARSEF 297
gb|KFW71651.1|  hypothetical protein AS28_14072                         239   1e-72    Pygoscelis adeliae
gb|EGA76536.1|  Fum1p                                                   239   2e-72    Saccharomyces cerevisiae Vin13
ref|XP_008929917.1|  PREDICTED: fumarate hydratase, mitochondrial       239   2e-72    
ref|XP_007762775.1|  fumarate hydratase                                 239   2e-72    Coniophora puteana RWD-64-598 SS2
ref|XP_010075048.1|  PREDICTED: fumarate hydratase, mitochondrial       239   2e-72    Pterocles gutturalis
ref|XP_003499892.1|  PREDICTED: fumarate hydratase, mitochondrial...    240   2e-72    Cricetulus griseus [Chinese hamsters]
ref|XP_010295483.1|  PREDICTED: fumarate hydratase, mitochondrial       239   2e-72    Phaethon lepturus
ref|XP_005517420.1|  PREDICTED: fumarate hydratase, mitochondrial...    239   2e-72    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005078228.1|  PREDICTED: fumarate hydratase, mitochondrial       239   2e-72    Mesocricetus auratus [Syrian golden hamster]
gb|EHK50052.1|  fumarate hydratase                                      239   2e-72    Trichoderma atroviride IMI 206040
gb|ELQ41093.1|  fumarate hydratase class II 1                           239   2e-72    Magnaporthe oryzae Y34
ref|XP_009508750.1|  PREDICTED: fumarate hydratase, mitochondrial       238   2e-72    Phalacrocorax carbo [common cormorant]
ref|XP_010309788.1|  PREDICTED: fumarate hydratase, mitochondrial       238   2e-72    Balearica regulorum gibbericeps
ref|XP_005368585.1|  PREDICTED: fumarate hydratase, mitochondrial       239   2e-72    Microtus ochrogaster [prairie voles]
ref|XP_011378307.1|  PREDICTED: fumarate hydratase, mitochondrial...    239   2e-72    Pteropus vampyrus
gb|EQK99496.1|  fumarate hydratase class II                             236   2e-72    Ophiocordyceps sinensis CO18
gb|EHN00014.1|  Fum1p                                                   239   2e-72    Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|KDQ19923.1|  hypothetical protein BOTBODRAFT_51294                   239   2e-72    Botryobasidium botryosum FD-172 SS1
ref|XP_004895653.1|  PREDICTED: fumarate hydratase, mitochondrial...    239   2e-72    
gb|EXV03852.1|  fumarase                                                238   2e-72    Metarhizium robertsii
gb|KJA29256.1|  hypothetical protein HYPSUDRAFT_503715                  238   2e-72    Hypholoma sublateritium FD-334 SS-4
ref|XP_003974177.1|  PREDICTED: fumarate hydratase, mitochondrial...    239   2e-72    
gb|KIM85397.1|  hypothetical protein PILCRDRAFT_817407                  239   2e-72    Piloderma croceum F 1598
ref|XP_004439637.1|  PREDICTED: fumarate hydratase, mitochondrial       239   2e-72    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_010581869.1|  PREDICTED: fumarate hydratase, mitochondrial...    238   2e-72    Haliaeetus leucocephalus
gb|KFZ60559.1|  hypothetical protein N338_09291                         238   2e-72    Podiceps cristatus
gb|KFQ04696.1|  hypothetical protein N329_04765                         238   2e-72    Haliaeetus albicilla
gb|KGL93621.1|  hypothetical protein N301_03833                         238   2e-72    Charadrius vociferus
gb|KGL79172.1|  hypothetical protein N309_10896                         238   2e-72    Tinamus guttatus
ref|XP_009979909.1|  PREDICTED: fumarate hydratase, mitochondrial       237   2e-72    Tauraco erythrolophus
ref|NP_588397.3|  fumarate hydratase (predicted)                        239   3e-72    Schizosaccharomyces pombe
dbj|GAA87674.1|  fumarate hydratase class II                            240   3e-72    Aspergillus kawachii IFO 4308
gb|KIW47448.1|  fumarate hydratase, class II                            240   3e-72    Exophiala oligosperma
gb|KFO98944.1|  hypothetical protein N300_02760                         238   3e-72    Calypte anna
ref|XP_006924183.1|  PREDICTED: fumarate hydratase, mitochondrial       239   3e-72    Pteropus alecto
gb|KFP18053.1|  hypothetical protein Z169_14841                         238   3e-72    Egretta garzetta
gb|KIK96362.1|  hypothetical protein PAXRUDRAFT_826028                  239   3e-72    Paxillus rubicundulus Ve08.2h10
gb|KFV39301.1|  hypothetical protein N341_12919                         238   3e-72    Tyto alba [Schleiereule]
ref|XP_003439886.2|  PREDICTED: fumarate hydratase, mitochondrial...    239   3e-72    Oreochromis niloticus
ref|XP_008489569.1|  PREDICTED: fumarate hydratase, mitochondrial       238   3e-72    Calypte anna
ref|XP_008295685.1|  PREDICTED: fumarate hydratase, mitochondrial       239   3e-72    Stegastes partitus
gb|KFW11876.1|  hypothetical protein N326_13222                         238   3e-72    Eurypyga helias
ref|XP_006198857.1|  PREDICTED: fumarate hydratase, mitochondrial       239   3e-72    Vicugna pacos
ref|XP_006185613.1|  PREDICTED: fumarate hydratase, mitochondrial       239   3e-72    Camelus ferus
gb|KFV00612.1|  hypothetical protein N340_04373                         237   3e-72    Tauraco erythrolophus
gb|KDO87117.1|  hypothetical protein CISIN_1g010908mg                   237   3e-72    Citrus sinensis [apfelsine]
ref|XP_009897885.1|  PREDICTED: fumarate hydratase, mitochondrial       238   3e-72    Picoides pubescens
ref|XP_008156858.1|  PREDICTED: fumarate hydratase, mitochondrial       239   3e-72    
ref|XP_010990377.1|  PREDICTED: fumarate hydratase, mitochondrial...    239   3e-72    Camelus dromedarius [camel]
ref|XP_007940907.1|  PREDICTED: fumarate hydratase, mitochondrial       239   3e-72    Orycteropus afer afer
ref|XP_009074698.1|  PREDICTED: fumarate hydratase, mitochondrial       238   3e-72    Acanthisitta chloris
ref|XP_007595676.1|  fumarate hydratase                                 240   3e-72    
ref|XP_010971718.1|  PREDICTED: fumarate hydratase, mitochondrial...    239   3e-72    Camelus bactrianus [camel]
gb|ELR03472.1|  fumarate hydratase, class II                            240   3e-72    Pseudogymnoascus destructans 20631-21
ref|XP_004283542.1|  PREDICTED: fumarate hydratase, mitochondrial       238   3e-72    
ref|XP_005326633.1|  PREDICTED: fumarate hydratase, mitochondrial       239   3e-72    Ictidomys tridecemlineatus
ref|XP_010182284.1|  PREDICTED: fumarate hydratase, mitochondrial       238   3e-72    Mesitornis unicolor
gb|EOA97454.1|  Fumarate hydratase, mitochondrial                       238   3e-72    Anas platyrhynchos [duck]
ref|XP_007872376.1|  hypothetical protein PNEG_00490                    239   3e-72    Pneumocystis murina B123
gb|KFP81796.1|  hypothetical protein N310_10621                         238   3e-72    Acanthisitta chloris
ref|XP_007462683.1|  PREDICTED: fumarate hydratase, mitochondrial       239   3e-72    Lipotes vexillifer [baiji]
ref|XP_002718365.1|  PREDICTED: fumarate hydratase, mitochondrial...    239   4e-72    Oryctolagus cuniculus [domestic rabbit]
gb|KFU98791.1|  hypothetical protein N339_03040                         238   4e-72    Pterocles gutturalis
gb|KFR02179.1|  hypothetical protein N306_08359                         238   4e-72    Opisthocomus hoazin [hoatzin]
ref|XP_010971707.1|  PREDICTED: fumarate hydratase, mitochondrial...    239   4e-72    Camelus bactrianus [camel]
ref|XP_007182482.1|  PREDICTED: fumarate hydratase, mitochondrial       239   4e-72    Balaenoptera acutorostrata scammoni
ref|XP_010990376.1|  PREDICTED: fumarate hydratase, mitochondrial...    239   4e-72    Camelus dromedarius [camel]
ref|XP_006691770.1|  fumarate hydratase-like protein                    239   4e-72    Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_009328750.1|  PREDICTED: fumarate hydratase, mitochondrial       238   4e-72    Pygoscelis adeliae
gb|KFG85558.1|  fumarate hydratase                                      239   4e-72    Metarhizium anisopliae
ref|XP_003893750.1|  PREDICTED: fumarate hydratase, mitochondrial       239   4e-72    Papio anubis [baboon]
ref|XP_009541236.1|  hypothetical protein HETIRDRAFT_153879             238   4e-72    
ref|XP_004028710.1|  PREDICTED: fumarate hydratase, mitochondrial       239   4e-72    
ref|XP_005374877.1|  PREDICTED: fumarate hydratase, mitochondrial       239   4e-72    
ref|NP_001230517.1|  fumarate hydratase                                 239   4e-72    
gb|ENH86884.1|  fumarate hydratase                                      239   4e-72    
ref|XP_003267364.1|  PREDICTED: fumarate hydratase, mitochondrial       239   4e-72    
ref|XP_004555021.1|  PREDICTED: fumarate hydratase, mitochondrial...    238   4e-72    
ref|XP_009439959.1|  PREDICTED: fumarate hydratase, mitochondrial...    239   4e-72    
gb|EFQ26635.1|  fumarate hydratase                                      239   4e-72    
sp|P10173.1|FUMH_PIG  RecName: Full=Fumarate hydratase, mitochond...    238   4e-72    
ref|NP_957257.1|  fumarate hydratase, mitochondrial precursor           239   4e-72    
ref|XP_001094968.1|  PREDICTED: fumarate hydratase, mitochondrial...    239   4e-72    
ref|XP_009869372.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    238   4e-72    
ref|NP_000134.2|  fumarate hydratase, mitochondrial                     239   4e-72    
ref|XP_007240663.1|  PREDICTED: fumarate hydratase, mitochondrial...    231   4e-72    
ref|XP_003824573.1|  PREDICTED: fumarate hydratase, mitochondrial       239   4e-72    
gb|EHH15914.1|  hypothetical protein EGK_02083                          239   4e-72    
ref|XP_010215690.1|  PREDICTED: fumarate hydratase, mitochondrial       238   5e-72    
ref|XP_007360110.1|  fumarate hydratase                                 238   5e-72    
ref|XP_007988126.1|  PREDICTED: fumarate hydratase, mitochondrial       238   5e-72    
ref|XP_007119566.1|  PREDICTED: fumarate hydratase, mitochondrial       238   5e-72    
sp|Q60HF9.1|FUMH_MACFA  RecName: Full=Fumarate hydratase, mitocho...    238   5e-72    
ref|NP_001267172.1|  fumarate hydratase, mitochondrial                  238   5e-72    
ref|XP_003935387.1|  PREDICTED: fumarate hydratase, mitochondrial       238   5e-72    
gb|EJT43864.1|  FUM1-like protein                                       238   5e-72    
ref|XP_002760919.1|  PREDICTED: fumarate hydratase, mitochondrial       238   5e-72    
emb|CDI51724.1|  probable FUM1-fumarate hydratase                       237   5e-72    
ref|XP_009962196.1|  PREDICTED: fumarate hydratase, mitochondrial       238   5e-72    
ref|NP_001272104.1|  fumarate hydratase, mitochondrial                  238   5e-72    
ref|XP_010382999.1|  PREDICTED: fumarate hydratase, mitochondrial       238   5e-72    
ref|XP_005024942.1|  PREDICTED: fumarate hydratase, mitochondrial...    238   5e-72    
ref|XP_011320020.1|  fumarate hydratase                                 239   5e-72    
ref|XP_002189151.2|  PREDICTED: fumarate hydratase, mitochondrial...    238   5e-72    
ref|NP_001125540.1|  fumarate hydratase, mitochondrial                  238   5e-72    
ref|XP_009572884.1|  PREDICTED: fumarate hydratase, mitochondrial       237   5e-72    
gb|AAA66909.1|  fumarase                                                238   6e-72    
gb|KIN01511.1|  hypothetical protein OIDMADRAFT_123939                  237   6e-72    
gb|KFM08161.1|  hypothetical protein AS27_00695                         237   6e-72    
gb|EHH50891.1|  hypothetical protein EGM_01787                          238   6e-72    
ref|XP_009883751.1|  PREDICTED: fumarate hydratase, mitochondrial       238   6e-72    
ref|XP_005482998.1|  PREDICTED: fumarate hydratase, mitochondrial...    238   6e-72    
ref|XP_009259090.1|  hypothetical protein FPSE_07697                    239   6e-72    
gb|AGO11273.1|  AaceriACR013Cp                                          238   6e-72    
ref|XP_010640964.1|  PREDICTED: fumarate hydratase, mitochondrial       238   6e-72    
gb|KFY44404.1|  hypothetical protein V494_01487                         239   6e-72    
ref|XP_011386691.1|  putative fumarase FUM1                             238   6e-72    
ref|XP_010117491.1|  PREDICTED: fumarate hydratase, mitochondrial       237   6e-72    
ref|XP_010157072.1|  PREDICTED: fumarate hydratase, mitochondrial       238   7e-72    
ref|XP_003720956.1|  fumarate hydratase                                 239   7e-72    
ref|XP_009957277.1|  PREDICTED: fumarate hydratase, mitochondrial       237   7e-72    
emb|CDO72379.1|  hypothetical protein BN946_scf184977.g78               238   7e-72    
ref|XP_009809639.1|  PREDICTED: fumarate hydratase, mitochondrial       237   7e-72    
ref|XP_007319010.1|  hypothetical protein SERLADRAFT_469035             237   7e-72    
gb|KFU88789.1|  hypothetical protein M959_14247                         237   7e-72    
ref|XP_011289145.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    238   7e-72    
ref|XP_010202049.1|  PREDICTED: fumarate hydratase, mitochondrial       237   7e-72    
gb|KFP26128.1|  hypothetical protein N325_10917                         237   8e-72    
gb|KIJ68316.1|  hypothetical protein HYDPIDRAFT_173069                  237   8e-72    
gb|KIM48081.1|  hypothetical protein M413DRAFT_220518                   237   8e-72    
gb|EMC82421.1|  Fumarate hydratase, mitochondrial                       237   8e-72    
gb|EXK34074.1|  fumarate hydratase, mitochondrial                       238   8e-72    
ref|XP_010133173.1|  PREDICTED: fumarate hydratase, mitochondrial       237   8e-72    
ref|XP_005690753.1|  PREDICTED: fumarate hydratase, mitochondrial       239   8e-72    
gb|KFO88947.1|  hypothetical protein N320_10832                         237   9e-72    
gb|KIH91518.1|  fumarate hydratase, class II                            237   9e-72    
ref|XP_008692868.1|  PREDICTED: fumarate hydratase, mitochondrial       237   9e-72    
gb|EST06716.1|  ferredoxin                                              238   9e-72    
ref|XP_001257435.1|  fumarate hydratase, putative                       239   1e-71    
ref|XP_010774773.1|  PREDICTED: fumarate hydratase, mitochondrial       238   1e-71    
emb|CCE27068.1|  probable FUM1-fumarate hydratase                       238   1e-71    
ref|XP_002625783.1|  fumarate hydratase class II                        239   1e-71    
ref|XP_006134174.1|  PREDICTED: fumarate hydratase, mitochondrial...    238   1e-71    
ref|NP_001006382.1|  fumarate hydratase, mitochondrial                  238   1e-71    
gb|EEQ86930.1|  fumarate hydratase class II                             239   1e-71    
gb|EGU80484.1|  hypothetical protein FOXB_08944                         238   1e-71    
gb|ERT00077.1|  fumarate hydratase, mitochondrial                       236   1e-71    
gb|EQL30770.1|  fumarate hydratase, mitochondrial                       239   1e-71    
ref|XP_005510051.1|  PREDICTED: fumarate hydratase, mitochondrial...    236   1e-71    
gb|KFY64660.1|  hypothetical protein V496_03115                         238   1e-71    
gb|KDQ63611.1|  hypothetical protein JAAARDRAFT_44408                   236   1e-71    
ref|XP_009918043.1|  PREDICTED: fumarate hydratase, mitochondrial       238   1e-71    
gb|KIJ21628.1|  fumarate hydratase                                      237   1e-71    
ref|XP_003474362.1|  PREDICTED: fumarate hydratase, mitochondrial       238   1e-71    
gb|EGA56432.1|  Fum1p                                                   236   1e-71    
ref|XP_004414328.1|  PREDICTED: fumarate hydratase, mitochondrial       238   1e-71    
gb|KEY76450.1|  fumarate hydratase                                      238   1e-71    
ref|XP_003410962.1|  PREDICTED: fumarate hydratase, mitochondrial       238   1e-71    
gb|EPB82664.1|  fumarate hydratase, mitochondrial                       236   1e-71    
emb|CEL56809.1|  fumarate hydratase, class II                           237   1e-71    
ref|XP_006800490.1|  PREDICTED: fumarate hydratase, mitochondrial...    237   1e-71    
gb|KDB17172.1|  fumarate hydratase precursor                            238   1e-71    
gb|KFO70082.1|  hypothetical protein N303_02489                         236   1e-71    
ref|XP_009639608.1|  PREDICTED: fumarate hydratase, mitochondrial       237   1e-71    
ref|XP_501530.1|  YALI0C06776p                                          237   1e-71    
ref|XP_007298997.1|  fumarate hydratase                                 237   1e-71    
ref|XP_009942498.1|  PREDICTED: fumarate hydratase, mitochondrial       238   1e-71    
ref|XP_009994835.1|  PREDICTED: fumarate hydratase, mitochondrial       237   2e-71    
gb|KDN39226.1|  Fumarate hydratase, mitochondrial                       237   2e-71    
ref|XP_004375908.1|  PREDICTED: fumarate hydratase, mitochondrial       237   2e-71    
gb|KFY24949.1|  hypothetical protein V493_04923                         238   2e-71    
ref|XP_007058980.1|  PREDICTED: fumarate hydratase, mitochondrial...    236   2e-71    
ref|XP_006142425.1|  PREDICTED: fumarate hydratase, mitochondrial...    237   2e-71    
ref|XP_005242931.1|  PREDICTED: fumarate hydratase, mitochondrial...    237   2e-71    
dbj|GAC99563.1|  hypothetical protein PHSY_007165                       236   2e-71    
ref|XP_002918506.1|  PREDICTED: fumarate hydratase, mitochondrial       237   2e-71    
ref|XP_009561479.1|  PREDICTED: fumarate hydratase, mitochondrial       236   2e-71    
gb|KFV82233.1|  hypothetical protein N308_03081                         236   2e-71    
ref|XP_005153635.1|  PREDICTED: fumarate hydratase, mitochondrial...    236   2e-71    
ref|XP_001526417.1|  fumarate hydratase, mitochondrial precursor        236   2e-71    
gb|EGE07834.1|  fumarate hydratase                                      237   2e-71    
emb|CBQ68213.1|  probable FUM1-fumarate hydratase                       237   2e-71    
ref|XP_009270148.1|  hypothetical protein J056_002608                   244   2e-71    
ref|XP_008573483.1|  PREDICTED: fumarate hydratase, mitochondrial       236   2e-71    
ref|XP_001270284.1|  fumarate hydratase, putative                       238   2e-71    
gb|KIO21601.1|  hypothetical protein M407DRAFT_245426                   236   2e-71    
ref|XP_005296563.1|  PREDICTED: fumarate hydratase, mitochondrial...    237   2e-71    
gb|EWG38672.1|  fumarate hydratase, mitochondrial                       237   3e-71    
gb|EQB57830.1|  fumarate hydratase                                      236   3e-71    
ref|XP_003053160.1|  predicted protein                                  237   3e-71    
emb|CDM27295.1|  Fumarate hydratase, mitochondrial                      237   3e-71    
emb|CCT70191.1|  probable FUM1-fumarate hydratase                       237   3e-71    
ref|XP_008062082.1|  PREDICTED: fumarate hydratase, mitochondrial       238   3e-71    
ref|XP_003204919.2|  PREDICTED: fumarate hydratase, mitochondrial       237   3e-71    
ref|XP_002143446.1|  fumarate hydratase, putative                       237   3e-71    
ref|XP_008937257.1|  PREDICTED: fumarate hydratase, mitochondrial       235   3e-71    
gb|EZF33427.1|  fumarate hydratase, mitochondrial                       237   3e-71    
dbj|GAM89660.1|  hypothetical protein ANO11243_076990                   237   3e-71    
ref|XP_007274400.1|  fumarate hydratase                                 235   3e-71    
gb|KGO68131.1|  Fumarase C, C-terminal                                  237   4e-71    
gb|KIP12608.1|  hypothetical protein PHLGIDRAFT_81895                   236   4e-71    
ref|XP_007325603.1|  hypothetical protein AGABI1DRAFT_110391            236   4e-71    
gb|KIW26938.1|  fumarate hydratase, class II                            237   4e-71    
emb|CDR44678.1|  CYFA0S15e01376g1_1                                     236   4e-71    
gb|KIL89638.1|  hypothetical protein FAVG1_07218                        236   4e-71    
gb|KGK38814.1|  hypothetical protein JL09_g1983                         235   4e-71    
ref|XP_006962506.1|  fumarate hydratase-like protein                    235   4e-71    
ref|XP_004619073.1|  PREDICTED: fumarate hydratase, mitochondrial       236   4e-71    
ref|XP_009464197.1|  PREDICTED: fumarate hydratase, mitochondrial       237   4e-71    
ref|XP_003238110.1|  fumarate hydratase class II                        236   4e-71    
ref|XP_008167560.1|  PREDICTED: fumarate hydratase, mitochondrial...    236   4e-71    
ref|XP_002566272.1|  Pc22g23810                                         236   4e-71    
gb|KIW71400.1|  fumarate hydratase, class II                            236   5e-71    
ref|XP_001900957.1|  fumarase                                           236   5e-71    
gb|KFY08291.1|  hypothetical protein V492_06360                         237   5e-71    
gb|EEH36265.2|  fumarate hydratase                                      237   5e-71    
ref|XP_003177324.1|  fumarate hydratase                                 236   5e-71    
ref|XP_003651420.1|  hypothetical protein THITE_2111697                 236   5e-71    
ref|XP_010735106.1|  PREDICTED: fumarate hydratase, mitochondrial       236   5e-71    
ref|XP_007916152.1|  putative fumarate hydratase protein                235   6e-71    
gb|EZF33426.1|  fumarate hydratase, mitochondrial                       236   6e-71    
gb|EKD04289.1|  fumarate hydratase                                      236   6e-71    
ref|XP_537215.1|  PREDICTED: fumarate hydratase, mitochondrial is...    236   6e-71    
gb|EPS28448.1|  hypothetical protein PDE_03394                          236   7e-71    
dbj|GAA96186.1|  hypothetical protein E5Q_02850                         235   7e-71    
ref|XP_007379084.1|  fumarate hydratase                                 234   8e-71    
gb|EMD41748.1|  hypothetical protein CERSUDRAFT_110324                  235   8e-71    
gb|KIK47297.1|  hypothetical protein CY34DRAFT_765027                   235   8e-71    
dbj|GAK61852.1|  fumarate hydratase                                     235   8e-71    
gb|AII97846.1|  BLTX475                                                 228   8e-71    
gb|EKV10050.1|  Fumarate hydratase, putative                            236   8e-71    
gb|EUC63756.1|  aspartate ammonia-lyase                                 235   9e-71    
ref|XP_001209891.1|  fumarate hydratase class II                        236   9e-71    
ref|XP_001377948.1|  PREDICTED: fumarate hydratase, mitochondrial       235   1e-70    
ref|XP_003660142.1|  hypothetical protein MYCTH_2298064                 236   1e-70    
gb|EEH23130.2|  fumarate hydratase, mitochondrial                       236   1e-70    
ref|XP_004799295.1|  PREDICTED: fumarate hydratase, mitochondrial       235   1e-70    
emb|CAK41235.1|  unnamed protein product                                236   1e-70    
gb|KIY45456.1|  fumarate hydratase                                      234   1e-70    
ref|XP_001492705.2|  PREDICTED: fumarate hydratase, mitochondrial       235   1e-70    
gb|KIJ45649.1|  hypothetical protein M422DRAFT_67105                    234   1e-70    
gb|KFY69882.1|  hypothetical protein V499_09667                         236   1e-70    
ref|XP_008111211.1|  PREDICTED: fumarate hydratase, mitochondrial...    234   1e-70    
ref|XP_001395836.2|  fumarate hydratase                                 236   1e-70    
gb|EKG18019.1|  Fumarate lyase                                          235   1e-70    
gb|EHK21508.1|  hypothetical protein TRIVIDRAFT_170638                  234   1e-70    
ref|XP_003672058.1|  hypothetical protein NDAI_0I02470                  234   2e-70    
gb|EPX73578.1|  fumarate hydratase                                      235   2e-70    
ref|XP_003956083.1|  hypothetical protein KAFR_0B06520                  234   2e-70    
ref|XP_006277022.1|  PREDICTED: fumarate hydratase, mitochondrial...    234   2e-70    
ref|XP_006746745.1|  PREDICTED: fumarate hydratase, mitochondrial       234   2e-70    
ref|XP_007077049.1|  PREDICTED: fumarate hydratase, mitochondrial       234   2e-70    
ref|XP_007796907.1|  putative fumarate hydratase protein                233   2e-70    
gb|KIX10220.1|  fumarate hydratase, class II                            235   2e-70    
ref|XP_002175916.2|  fumarate hydratase                                 234   2e-70    
gb|EJW81137.1|  fumarate hydratase                                      234   2e-70    
emb|CCK70534.1|  hypothetical protein KNAG_0E02750                      234   2e-70    
ref|XP_001593815.1|  conserved hypothetical protein                     233   2e-70    
gb|KIY72840.1|  fumarate hydratase                                      234   2e-70    
gb|EFB22120.1|  hypothetical protein PANDA_006972                       233   2e-70    
emb|CCM00895.1|  predicted protein                                      233   3e-70    
gb|EAW70091.1|  fumarate hydratase, isoform CRA_b                       234   3e-70    
gb|KDQ30668.1|  hypothetical protein PLEOSDRAFT_1074958                 233   3e-70    
ref|NP_983416.2|  ACR013Cp                                              233   3e-70    
ref|XP_453112.1|  hypothetical protein                                  233   3e-70    
ref|XP_003347025.1|  hypothetical protein SMAC_05224                    234   3e-70    
gb|EPT04192.1|  hypothetical protein FOMPIDRAFT_1021913                 233   3e-70    
ref|XP_010354171.1|  PREDICTED: fumarate hydratase, mitochondrial...    234   3e-70    
emb|CAG07957.1|  unnamed protein product                                232   3e-70    
ref|XP_004336877.1|  fumarate hydratase, class II, putative             233   3e-70    
emb|CDK25346.1|  unnamed protein product                                233   3e-70    
gb|EJT46017.1|  fumarate hydratase                                      233   3e-70    
ref|XP_007295218.1|  fumarate hydratase                                 234   4e-70    
gb|KIV90730.1|  fumarate hydratase, class II                            234   4e-70    
gb|KFZ17818.1|  hypothetical protein V502_04387                         234   4e-70    
ref|XP_004756941.1|  PREDICTED: fumarate hydratase, mitochondrial       234   4e-70    
dbj|GAC74043.1|  ferredoxin                                             233   4e-70    
ref|XP_006454439.1|  hypothetical protein AGABI2DRAFT_133137            232   4e-70    
gb|ETS64030.1|  hypothetical protein PaG_02367                          233   4e-70    
emb|CDQ03094.1|  Protein BM-FUM-1                                       233   4e-70    
gb|KFY86374.1|  hypothetical protein V500_07671                         234   4e-70    
ref|XP_001828833.2|  aspartate ammonia lyase                            233   4e-70    
gb|KDR85119.1|  hypothetical protein GALMADRAFT_233751                  232   5e-70    
ref|XP_006019062.1|  PREDICTED: fumarate hydratase, mitochondrial...    236   5e-70    
ref|XP_002989327.1|  hypothetical protein SELMODRAFT_129619             235   5e-70    
gb|KHN89095.1|  putative fumarate hydratase, mitochondrial              233   5e-70    
gb|KIK71159.1|  hypothetical protein GYMLUDRAFT_33293                   233   5e-70    
emb|CEF64732.1|  Fumarate hydratase, mitochondrial                      232   5e-70    
gb|KIW12454.1|  fumarate hydratase, class II                            232   6e-70    
gb|EFO24875.2|  fumarate hydratase                                      233   6e-70    
gb|EFW99152.1|  fumarate lyase                                          234   6e-70    
ref|XP_006668664.1|  fumarate hydratase                                 232   6e-70    



>gb|KJB09427.1| hypothetical protein B456_001G141300 [Gossypium raimondii]
 gb|KJB09428.1| hypothetical protein B456_001G141300 [Gossypium raimondii]
Length=496

 Score =   358 bits (918),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAM I +RR++ GST S    SLRY  CWR FSTSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMYIVSRRLSAGSTTSQLVTSLRYATCWRSFSTSFREERDTFGPINVPSDKLWGAQTQR  60

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPIIRAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  61   SLQNFEIGGERERMPEPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLND  120

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGH+RG+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  121  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHQRGDKFVHPNDHVNRSQSSNDTFPTVM  180

Query  598  HIAAAMEIN  624
            HIAAAMEIN
Sbjct  181  HIAAAMEIN  189



>ref|XP_007051015.1| Fumarase 1 isoform 1 [Theobroma cacao]
 gb|EOX95172.1| Fumarase 1 isoform 1 [Theobroma cacao]
Length=496

 Score =   358 bits (918),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAM I +RR++ GST S    SLRY  CWR +STSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMYIVSRRLSAGSTTSQLVTSLRYATCWRSYSTSFREERDTFGPINVPSDKLWGAQTQR  60

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPIIRAFGILKKCAAKVNM+YGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  61   SLQNFEIGGERERMPEPIIRAFGILKKCAAKVNMDYGLDPTIGKAIMQAAQEVAEGKLND  120

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  121  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPTVM  180

Query  598  HIAAAMEIN  624
            HIAAAMEIN
Sbjct  181  HIAAAMEIN  189



>ref|XP_007051016.1| Fumarase 1 isoform 2 [Theobroma cacao]
 gb|EOX95173.1| Fumarase 1 isoform 2 [Theobroma cacao]
Length=497

 Score =   358 bits (918),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAM I +RR++ GST S    SLRY  CWR +STSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMYIVSRRLSAGSTTSQLVTSLRYATCWRSYSTSFREERDTFGPINVPSDKLWGAQTQR  60

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPIIRAFGILKKCAAKVNM+YGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  61   SLQNFEIGGERERMPEPIIRAFGILKKCAAKVNMDYGLDPTIGKAIMQAAQEVAEGKLND  120

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  121  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPTVM  180

Query  598  HIAAAMEIN  624
            HIAAAMEIN
Sbjct  181  HIAAAMEIN  189



>ref|XP_009622148.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009622149.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009622150.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Nicotiana 
tomentosiformis]
Length=493

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 180/190 (95%), Gaps = 3/190 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAMLIAARR++ GS  S   +SLRYT CWR+FSTSFREE+DTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMLIAARRLSAGSALS---DSLRYTSCWRFFSTSFREEKDTFGPILVPSDKLWGAQTQR  57

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG+RERMPEPIIRAFGILKKCAAKVNMEYGL+ SIGKA+MQAA+EVAEGKLND
Sbjct  58   SLQNFDIGGERERMPEPIIRAFGILKKCAAKVNMEYGLDRSIGKAIMQAAEEVAEGKLND  117

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  118  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGDKHVHPNDHVNRSQSSNDTFPTVM  177

Query  598  HIAAAMEINK  627
            HIAAAME+NK
Sbjct  178  HIAAAMELNK  187



>ref|XP_009778286.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nicotiana 
sylvestris]
 ref|XP_009778287.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nicotiana 
sylvestris]
 ref|XP_009778288.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nicotiana 
sylvestris]
 ref|XP_009778289.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=493

 Score =   357 bits (916),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 180/190 (95%), Gaps = 3/190 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAMLIAARR++ GS  S   +SLRYT CWR+FSTSFREE+DTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMLIAARRLSAGSALS---DSLRYTSCWRFFSTSFREEKDTFGPILVPSDKLWGAQTQR  57

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG+RERMPEPIIRAFGILKKCAAKVNMEYGL+ SIGKA+MQAA+EVAEGKLND
Sbjct  58   SLQNFDIGGERERMPEPIIRAFGILKKCAAKVNMEYGLDRSIGKAIMQAAEEVAEGKLND  117

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  118  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGDKHVHPNDHVNRSQSSNDTFPTVM  177

Query  598  HIAAAMEINK  627
            HIAAAME+NK
Sbjct  178  HIAAAMELNK  187



>ref|NP_001275422.1| fumarate hydratase 1, mitochondrial-like [Solanum tuberosum]
 emb|CAA62817.1| fumarase [Solanum tuberosum]
Length=493

 Score =   347 bits (890),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 176/190 (93%), Gaps = 3/190 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAML AARR++ GS  S   +SLRYT  WR+FSTSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMLNAARRLSAGSALS---DSLRYTSSWRFFSTSFREERDTFGPILVPSDKLWGAQTQR  57

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGGDRERMPEPIIRAFGI+KKCAAKVNM+YGL+ SIGKA+MQAA+EVAEGKLND
Sbjct  58   SLQNFEIGGDRERMPEPIIRAFGIIKKCAAKVNMDYGLDQSIGKAIMQAAEEVAEGKLND  117

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGH RG+K VHPNDHVN+SQSSNDTF TVM
Sbjct  118  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHNRGDKHVHPNDHVNKSQSSNDTFSTVM  177

Query  598  HIAAAMEINK  627
            HIAAAME+NK
Sbjct  178  HIAAAMELNK  187



>ref|XP_006359871.1| PREDICTED: fumarate hydratase 1, mitochondrial-like isoform X2 
[Solanum tuberosum]
Length=493

 Score =   347 bits (889),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 175/190 (92%), Gaps = 3/190 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAML AARR++ GS  S   +SLRYT  WR+FSTSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMLNAARRLSAGSALS---DSLRYTSSWRFFSTSFREERDTFGPILVPSDKLWGAQTQR  57

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGGDRERMPEPIIRAFGI+KKCAAKVNM+YGL+ SIGKA+MQAA+EVAEG LND
Sbjct  58   SLQNFEIGGDRERMPEPIIRAFGIIKKCAAKVNMDYGLDQSIGKAIMQAAEEVAEGNLND  117

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGH RG+K VHPNDHVN+SQSSNDTFPTVM
Sbjct  118  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHNRGDKHVHPNDHVNKSQSSNDTFPTVM  177

Query  598  HIAAAMEINK  627
            HIA AME+NK
Sbjct  178  HIAGAMELNK  187



>ref|XP_002523133.1| aspartate ammonia lyase, putative [Ricinus communis]
 gb|EEF39318.1| aspartate ammonia lyase, putative [Ricinus communis]
Length=470

 Score =   345 bits (886),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAM   ARR++  ST + +  SLRY   WR +ST+FREERDTFGPIQVP+DKLWGAQTQR
Sbjct  1    MAMGTIARRISRESTTTRAVGSLRY-ASWRLYSTAFREERDTFGPIQVPNDKLWGAQTQR  59

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEVAEGKLND
Sbjct  60   SLQNFEIGGERERMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVAEGKLND  119

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  120  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKYVHPNDHVNRSQSSNDTFPTVM  179

Query  598  HIAAAMEINK  627
            HIAAA EINK
Sbjct  180  HIAAATEINK  189



>ref|XP_006480011.1| PREDICTED: fumarate hydratase 1, mitochondrial-like isoform X1 
[Citrus sinensis]
Length=522

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 178/195 (91%), Gaps = 1/195 (1%)
 Frame = +1

Query  43   IRETQMAMLIAARRVTCG-STRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLW  219
            + E QMA+ + +RR+  G ST S  + +LRY  CWR +STSFREE+DTFGPI VPSDKLW
Sbjct  21   LVEKQMAVYVISRRLLGGGSTTSQLAGTLRYGACWRSYSTSFREEKDTFGPILVPSDKLW  80

Query  220  GAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVA  399
            GAQTQRSLQNF+IGG+RERMPEPI+RAFGILKKCAAKVNMEYGL+P+IGKA+MQAAQEVA
Sbjct  81   GAQTQRSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVA  140

Query  400  EGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSND  579
            EGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSND
Sbjct  141  EGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSND  200

Query  580  TFPTVMHIAAAMEIN  624
            TFPTVMHIAAAME N
Sbjct  201  TFPTVMHIAAAMETN  215



>ref|XP_008235134.1| PREDICTED: LOW QUALITY PROTEIN: fumarate hydratase 1, mitochondrial 
[Prunus mume]
Length=490

 Score =   345 bits (885),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 173/189 (92%), Gaps = 3/189 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAM I +RRV  GST    S + RY  CWR +ST+FREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMYIISRRVVGGST---PSTAFRYATCWRPYSTAFREERDTFGPILVPSDKLWGAQTQR  57

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN 
Sbjct  58   SLQNFDIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNQ  117

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  118  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTVM  177

Query  598  HIAAAMEIN  624
            HIA+AMEIN
Sbjct  178  HIASAMEIN  186



>ref|XP_007200983.1| hypothetical protein PRUPE_ppa004758mg [Prunus persica]
 gb|EMJ02182.1| hypothetical protein PRUPE_ppa004758mg [Prunus persica]
Length=493

 Score =   344 bits (883),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 173/189 (92%), Gaps = 3/189 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAM I +RRV  GST    S + RY  CWR +STSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMYIISRRVVGGST---PSTAFRYATCWRPYSTSFREERDTFGPILVPSDKLWGAQTQR  57

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN 
Sbjct  58   SLQNFDIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNQ  117

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  118  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTVM  177

Query  598  HIAAAMEIN  624
            HIA+A+EIN
Sbjct  178  HIASAVEIN  186



>gb|KDO87115.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
 gb|KDO87116.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
Length=439

 Score =   342 bits (877),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCG-STRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            MA+ + +RR+  G ST S  + +LRY  CWR +STSFREE+DTFGPI VPSDKLWGAQTQ
Sbjct  1    MAVYVISRRLLGGGSTTSQLAGTLRYGACWRSYSTSFREEKDTFGPILVPSDKLWGAQTQ  60

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSLQNF+IGG+RERMPEPI+RAFGILKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN
Sbjct  61   RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLN  120

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTV  594
            DHFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  121  DHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTV  180

Query  595  MHIAAAMEIN  624
            MHIAAAME N
Sbjct  181  MHIAAAMETN  190



>ref|XP_004247395.1| PREDICTED: fumarate hydratase 1, mitochondrial [Solanum lycopersicum]
Length=494

 Score =   344 bits (882),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 177/191 (93%), Gaps = 4/191 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVC-WRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            MAML AARR++ GS  S   +SLRYT   WR+FSTSFREERDTFGPI VPSDKLWGAQTQ
Sbjct  1    MAMLNAARRLSAGSALS---DSLRYTSSSWRFFSTSFREERDTFGPILVPSDKLWGAQTQ  57

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSLQNFEIGGDRERMPEPIIRAFGI+KKCAAKVNM+YGL+ SIGKA+MQAA+EVAEGKLN
Sbjct  58   RSLQNFEIGGDRERMPEPIIRAFGIIKKCAAKVNMDYGLDQSIGKAIMQAAEEVAEGKLN  117

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTV  594
            DHFPLV+WQTGSGTQSNMNANEVIANRAAEILG+ RG+K VHPNDHVN+SQSSNDTFPTV
Sbjct  118  DHFPLVVWQTGSGTQSNMNANEVIANRAAEILGYNRGDKHVHPNDHVNKSQSSNDTFPTV  177

Query  595  MHIAAAMEINK  627
            MHIAAAME+NK
Sbjct  178  MHIAAAMELNK  188



>gb|KDO87114.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
Length=487

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCG-STRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            MA+ + +RR+  G ST S  + +LRY  CWR +STSFREE+DTFGPI VPSDKLWGAQTQ
Sbjct  1    MAVYVISRRLLGGGSTTSQLAGTLRYGACWRSYSTSFREEKDTFGPILVPSDKLWGAQTQ  60

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSLQNF+IGG+RERMPEPI+RAFGILKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN
Sbjct  61   RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLN  120

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTV  594
            DHFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  121  DHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTV  180

Query  595  MHIAAAMEIN  624
            MHIAAAME N
Sbjct  181  MHIAAAMETN  190



>gb|KDP28204.1| hypothetical protein JCGZ_13975 [Jatropha curcas]
Length=495

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 174/189 (92%), Gaps = 1/189 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA  + ARR++ GST S S  SLR+   WR +ST+FREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MATGVVARRLSHGSTSSQSIGSLRF-ASWRLYSTAFREERDTFGPIQVPSDKLWGAQTQR  59

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RE+MPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEVAEGKLND
Sbjct  60   SLQNFEIGGEREQMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVAEGKLND  119

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG K VHPNDHVNRSQSSNDTFPTVM
Sbjct  120  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGGKFVHPNDHVNRSQSSNDTFPTVM  179

Query  598  HIAAAMEIN  624
            HIAAA EIN
Sbjct  180  HIAAATEIN  188



>ref|XP_011079617.1| PREDICTED: fumarate hydratase 1, mitochondrial [Sesamum indicum]
Length=491

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 177/189 (94%), Gaps = 5/189 (3%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAMLIA+RR+   S+RS ++  L     +R++STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAMLIASRRL---SSRSTTTSCL--AASFRWYSTSFREERDTFGPIQVPSDKLWGAQTQR  55

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEVAEGKLND
Sbjct  56   SLQNFEIGGERERMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVAEGKLND  115

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  116  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSSNDTFPTVM  175

Query  598  HIAAAMEIN  624
            HIAAA+E+N
Sbjct  176  HIAAAVEMN  184



>ref|XP_006444417.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 gb|ESR57657.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
Length=494

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCG-STRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            MA+ + +RR+  G ST S  + +LRY  CWR +STSFREE+DTFGPI VPSDKLWGAQTQ
Sbjct  1    MAVYVISRRLLGGGSTTSQLAGTLRYGACWRSYSTSFREEKDTFGPILVPSDKLWGAQTQ  60

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSLQNF+IGG+RERMPEPI+RAFGILKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN
Sbjct  61   RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLN  120

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTV  594
            DHFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  121  DHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTV  180

Query  595  MHIAAAMEIN  624
            MHIAAAME N
Sbjct  181  MHIAAAMETN  190



>ref|XP_006444418.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 ref|XP_006444419.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 ref|XP_006480012.1| PREDICTED: fumarate hydratase 1, mitochondrial-like isoform X2 
[Citrus sinensis]
 ref|XP_006480013.1| PREDICTED: fumarate hydratase 1, mitochondrial-like isoform X3 
[Citrus sinensis]
 gb|ESR57658.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 gb|ESR57659.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 gb|KDO87112.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
 gb|KDO87113.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
Length=497

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCG-STRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            MA+ + +RR+  G ST S  + +LRY  CWR +STSFREE+DTFGPI VPSDKLWGAQTQ
Sbjct  1    MAVYVISRRLLGGGSTTSQLAGTLRYGACWRSYSTSFREEKDTFGPILVPSDKLWGAQTQ  60

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSLQNF+IGG+RERMPEPI+RAFGILKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN
Sbjct  61   RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLN  120

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTV  594
            DHFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  121  DHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTV  180

Query  595  MHIAAAMEIN  624
            MHIAAAME N
Sbjct  181  MHIAAAMETN  190



>gb|EYU46762.1| hypothetical protein MIMGU_mgv1a005258mg [Erythranthe guttata]
Length=491

 Score =   340 bits (873),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 174/189 (92%), Gaps = 5/189 (3%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAMLI +RR+   S RS  + S+   + W  +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAMLIISRRL---SGRSPMTSSIAANLRW--YSTSFREERDTFGPIQVPSDKLWGAQTQR  55

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGGDRERMPEPI+RAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEVA+GKLND
Sbjct  56   SLQNFEIGGDRERMPEPIVRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVADGKLND  115

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  116  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKVVHPNDHVNRSQSSNDTFPTVM  175

Query  598  HIAAAMEIN  624
            HIAAAMEIN
Sbjct  176  HIAAAMEIN  184



>ref|XP_006397946.1| hypothetical protein EUTSA_v10001422mg [Eutrema salsugineum]
 gb|ESQ39399.1| hypothetical protein EUTSA_v10001422mg [Eutrema salsugineum]
Length=492

 Score =   340 bits (872),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 174/189 (92%), Gaps = 4/189 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA+ +A+RR++ G+T    + +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAIYVASRRLSGGTT----AAALRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  56

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  57   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLND  116

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  117  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVM  176

Query  598  HIAAAMEIN  624
            HIAAA EIN
Sbjct  177  HIAAATEIN  185



>ref|XP_011458750.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X2 [Fragaria 
vesca subsp. vesca]
Length=492

 Score =   340 bits (872),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 172/191 (90%), Gaps = 8/191 (4%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRY--TVCWRYFSTSFREERDTFGPIQVPSDKLWGAQT  231
            MAM + +RRVT GST        RY  T CWR +STSFREERDTFGPI VPSDKLWGAQT
Sbjct  1    MAMYVISRRVTAGST------PFRYAATTCWRNYSTSFREERDTFGPILVPSDKLWGAQT  54

Query  232  QRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKL  411
            QRSLQNF+IGG+RERMPEPIIRAFG+LKKCAAKVNMEYGL+ SIGKA+MQAAQEVAEGKL
Sbjct  55   QRSLQNFDIGGERERMPEPIIRAFGVLKKCAAKVNMEYGLDQSIGKAIMQAAQEVAEGKL  114

Query  412  NDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPT  591
            N HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPT
Sbjct  115  NQHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPT  174

Query  592  VMHIAAAMEIN  624
            VMHIA+AMEIN
Sbjct  175  VMHIASAMEIN  185



>ref|XP_011458749.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Fragaria 
vesca subsp. vesca]
Length=492

 Score =   340 bits (872),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 172/191 (90%), Gaps = 8/191 (4%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRY--TVCWRYFSTSFREERDTFGPIQVPSDKLWGAQT  231
            MAM + +RRVT GST        RY  T CWR +STSFREERDTFGPI VPSDKLWGAQT
Sbjct  1    MAMYVISRRVTAGST------PFRYAATTCWRNYSTSFREERDTFGPILVPSDKLWGAQT  54

Query  232  QRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKL  411
            QRSLQNF+IGG+RERMPEPIIRAFG+LKKCAAKVNMEYGL+ SIGKA+MQAAQEVAEGKL
Sbjct  55   QRSLQNFDIGGERERMPEPIIRAFGVLKKCAAKVNMEYGLDQSIGKAIMQAAQEVAEGKL  114

Query  412  NDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPT  591
            N HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPT
Sbjct  115  NQHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPT  174

Query  592  VMHIAAAMEIN  624
            VMHIA+AMEIN
Sbjct  175  VMHIASAMEIN  185



>emb|CDY57717.1| BnaC04g51900D [Brassica napus]
Length=483

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 174/189 (92%), Gaps = 4/189 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA+ +A+RR++ G+    ++ +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAIYVASRRLSSGT----AAATLRYATAMRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  56

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  57   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLND  116

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  117  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVM  176

Query  598  HIAAAMEIN  624
            HIAAA EIN
Sbjct  177  HIAAATEIN  185



>ref|XP_010259454.1| PREDICTED: fumarate hydratase 1, mitochondrial [Nelumbo nucifera]
Length=495

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 175/190 (92%), Gaps = 3/190 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCW-RYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            MAML A+RR++C ST S    +LR    W R FSTSFREERDTFGPI VPSDKLWGAQTQ
Sbjct  1    MAMLTASRRLSCASTTSPLVWNLR--AAWLRSFSTSFREERDTFGPILVPSDKLWGAQTQ  58

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSLQNF+IGG+RE+MPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEV+EGKLN
Sbjct  59   RSLQNFDIGGEREQMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVSEGKLN  118

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTV  594
            DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  119  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKLVHPNDHVNRSQSSNDTFPTV  178

Query  595  MHIAAAMEIN  624
            MHIAAA+EIN
Sbjct  179  MHIAAAVEIN  188



>ref|XP_010245463.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nelumbo 
nucifera]
Length=553

 Score =   340 bits (872),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 172/190 (91%), Gaps = 1/190 (1%)
 Frame = +1

Query  55   QMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            +MAM   +RR+ C ST   S  +LR   C R  STSFREERDTFGPI VPSDKLWGAQTQ
Sbjct  58   EMAMFTVSRRLPCASTTLRSVWALR-AACLRSISTSFREERDTFGPILVPSDKLWGAQTQ  116

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSLQNF+IGGDRE+MPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEV+EGKLN
Sbjct  117  RSLQNFDIGGDREQMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVSEGKLN  176

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTV  594
            DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  177  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSSNDTFPTV  236

Query  595  MHIAAAMEIN  624
            MHIAAA+EIN
Sbjct  237  MHIAAAVEIN  246



>ref|XP_002880309.1| hypothetical protein ARALYDRAFT_483931 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56568.1| hypothetical protein ARALYDRAFT_483931 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   338 bits (867),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 174/189 (92%), Gaps = 4/189 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA+ +A+RR++ G+T    + +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAIYVASRRLSGGTT----ATALRYATSLRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  56

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEG+LND
Sbjct  57   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGQLND  116

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  117  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVM  176

Query  598  HIAAAMEIN  624
            HIAAA EIN
Sbjct  177  HIAAATEIN  185



>ref|XP_008386708.1| PREDICTED: fumarate hydratase 1, mitochondrial [Malus domestica]
Length=571

 Score =   340 bits (873),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 173/196 (88%), Gaps = 3/196 (2%)
 Frame = +1

Query  37   SSIRETQMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKL  216
            S +   QMAM I +RR   GST      +LRY    R +ST FREERDTFGPI VPSDKL
Sbjct  72   SELNHLQMAMYIVSRRAAGGST---PMAALRYATSLRPYSTKFREERDTFGPINVPSDKL  128

Query  217  WGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEV  396
            WGAQTQRSLQNF+IGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKAVMQAAQEV
Sbjct  129  WGAQTQRSLQNFDIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAVMQAAQEV  188

Query  397  AEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSN  576
            AEGKLN+HFPLVIWQTGSGTQSNMNANEVIANRAAEILGH+RGEK VHPNDHVNRSQSSN
Sbjct  189  AEGKLNEHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHQRGEKFVHPNDHVNRSQSSN  248

Query  577  DTFPTVMHIAAAMEIN  624
            DTFPTVMHIA+AMEIN
Sbjct  249  DTFPTVMHIASAMEIN  264



>ref|NP_182273.1| fumarate hydratase 1 [Arabidopsis thaliana]
 ref|NP_001078075.1| fumarate hydratase 1 [Arabidopsis thaliana]
 sp|P93033.2|FUM1_ARATH RecName: Full=Fumarate hydratase 1, mitochondrial; Short=Fumarase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB71399.1| fumarase [Arabidopsis thaliana]
 gb|AAC62859.1| putative fumarase [Arabidopsis thaliana]
 gb|AAL06911.1| At2g47510/T30B22.19 [Arabidopsis thaliana]
 gb|AAL32538.1| putative fumarase [Arabidopsis thaliana]
 gb|AAO29979.1| putative fumarase [Arabidopsis thaliana]
 gb|AEC10852.1| fumarate hydratase 1 [Arabidopsis thaliana]
 gb|AEC10853.1| fumarate hydratase 1 [Arabidopsis thaliana]
Length=492

 Score =   338 bits (866),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 174/189 (92%), Gaps = 4/189 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            M++ +A+RR++ G+T +    +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MSIYVASRRLSGGTTVT----ALRYATSLRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  56

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  57   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLND  116

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  117  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVM  176

Query  598  HIAAAMEIN  624
            HIAAA EIN
Sbjct  177  HIAAATEIN  185



>ref|XP_009142525.1| PREDICTED: fumarate hydratase 1, mitochondrial [Brassica rapa]
Length=492

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 173/189 (92%), Gaps = 4/189 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA+ +A+RR++  +T    + +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAIYVASRRLSARTT----AATLRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  56

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  57   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLND  116

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  117  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVM  176

Query  598  HIAAAMEIN  624
            HIAAA EIN
Sbjct  177  HIAAATEIN  185



>ref|XP_010069886.1| PREDICTED: fumarate hydratase 1, mitochondrial [Eucalyptus grandis]
 gb|KCW58394.1| hypothetical protein EUGRSUZ_H01081 [Eucalyptus grandis]
Length=497

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 173/190 (91%), Gaps = 1/190 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTR-SISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            MA  + +RR++ GS   S  + +LRY  CWR +ST FREERDTFGPI VPSD+LWGAQTQ
Sbjct  1    MAAYVVSRRLSSGSAAPSHLAGALRYAACWRSYSTGFREERDTFGPILVPSDRLWGAQTQ  60

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSLQNF+IGG+RERMPEPI+RAFG+LKKCAAKVN+EYGL+PSIG+A+MQAAQEVAEGKLN
Sbjct  61   RSLQNFDIGGERERMPEPIVRAFGVLKKCAAKVNLEYGLDPSIGEAIMQAAQEVAEGKLN  120

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTV  594
            DHFPLVIWQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  121  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGRKRGEKFVHPNDHVNRSQSSNDTFPTV  180

Query  595  MHIAAAMEIN  624
            MHIAAAMEIN
Sbjct  181  MHIAAAMEIN  190



>ref|XP_010523964.1| PREDICTED: fumarate hydratase 1, mitochondrial [Tarenaya hassleriana]
 ref|XP_010523965.1| PREDICTED: fumarate hydratase 1, mitochondrial [Tarenaya hassleriana]
Length=493

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 173/189 (92%), Gaps = 3/189 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA+ + +RR++ GST    + +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAIYVLSRRLSGGST---PAAALRYANALRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  57

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  58   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLND  117

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  118  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKFVHPNDHVNRSQSSNDTFPTVM  177

Query  598  HIAAAMEIN  624
            HIAAA EIN
Sbjct  178  HIAAATEIN  186



>dbj|BAH19491.1| AT2G47510 [Arabidopsis thaliana]
Length=492

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 174/189 (92%), Gaps = 4/189 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            M++ +A+RR++ G+T +    +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MSIYVASRRLSGGTTVT----ALRYATSLRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  56

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  57   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLND  116

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  117  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVM  176

Query  598  HIAAAMEIN  624
            HIAAA EIN
Sbjct  177  HIAAATEIN  185



>emb|CDX80112.1| BnaA05g00440D [Brassica napus]
Length=487

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 173/189 (92%), Gaps = 4/189 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA+ +A+RR++  +T    + +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAIYVASRRLSARTT----AATLRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  56

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+M+AAQEVAEGKLND
Sbjct  57   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMEAAQEVAEGKLND  116

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  117  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVM  176

Query  598  HIAAAMEIN  624
            HIAAA EIN
Sbjct  177  HIAAATEIN  185



>ref|XP_010507880.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Camelina 
sativa]
 ref|XP_010507881.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X2 [Camelina 
sativa]
Length=493

 Score =   336 bits (861),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 171/185 (92%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   IAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  249
            +A+RR++ G+T +    +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQRSLQN
Sbjct  6    VASRRLSGGTTAT----ALRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  61

Query  250  FEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPL  429
            FEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPL
Sbjct  62   FEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPL  121

Query  430  VIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAA  609
            V+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVMHIAA
Sbjct  122  VVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVMHIAA  181

Query  610  AMEIN  624
            A EIN
Sbjct  182  ATEIN  186



>gb|KHG29130.1| Fumarate hydratase 1, mitochondrial -like protein [Gossypium 
arboreum]
Length=461

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAM I +RR++ GST S    SLRY  CWR F TSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMYIVSRRLSAGSTTSQLVTSLRYATCWRSFFTSFREERDTFGPINVPSDKLWGAQTQR  60

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPIIRAFG+LKKCAAKVNMEYGL+P+IGKA+MQAA+EVAEGKLND
Sbjct  61   SLQNFEIGGERERMPEPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAEEVAEGKLND  120

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTV  594
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGH+RGEK VHPNDHVNRSQSSNDTFPT+
Sbjct  121  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHQRGEKFVHPNDHVNRSQSSNDTFPTL  179



>ref|XP_006296086.1| hypothetical protein CARUB_v10025236mg [Capsella rubella]
 gb|EOA28984.1| hypothetical protein CARUB_v10025236mg [Capsella rubella]
Length=493

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 170/185 (92%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   IAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  249
            +A+RR+  G+T +    +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQRSLQN
Sbjct  6    VASRRLPGGTTAT----ALRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  61

Query  250  FEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPL  429
            FEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPL
Sbjct  62   FEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPL  121

Query  430  VIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAA  609
            V+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVMHIAA
Sbjct  122  VVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVMHIAA  181

Query  610  AMEIN  624
            A EIN
Sbjct  182  ATEIN  186



>ref|XP_010506787.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Camelina 
sativa]
Length=493

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 170/185 (92%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   IAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  249
            +A+RR++ G T +    +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQRSLQN
Sbjct  6    VASRRLSGGKTAT----ALRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  61

Query  250  FEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPL  429
            FEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPL
Sbjct  62   FEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPL  121

Query  430  VIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAA  609
            V+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVMHIAA
Sbjct  122  VVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVMHIAA  181

Query  610  AMEIN  624
            A EIN
Sbjct  182  ATEIN  186



>ref|XP_010507882.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X3 [Camelina 
sativa]
Length=493

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 171/185 (92%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   IAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  249
            +A+RR++ G+T    + +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQRSLQN
Sbjct  6    VASRRLSGGTT----ATALRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  61

Query  250  FEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPL  429
            FEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPL
Sbjct  62   FEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPL  121

Query  430  VIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAA  609
            V+WQTGSGTQSNMNANEVIANRAAEILG +RGEK VHPNDHVNRSQSSNDTFPTVMHIAA
Sbjct  122  VVWQTGSGTQSNMNANEVIANRAAEILGRRRGEKCVHPNDHVNRSQSSNDTFPTVMHIAA  181

Query  610  AMEIN  624
            A EIN
Sbjct  182  ATEIN  186



>ref|XP_010518455.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Camelina 
sativa]
Length=493

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 171/185 (92%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   IAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  249
            +A+RR++ G+T    + +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQRSLQN
Sbjct  6    VASRRLSGGTT----ATALRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  61

Query  250  FEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPL  429
            FEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPL
Sbjct  62   FEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPL  121

Query  430  VIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAA  609
            V+WQTGSGTQSNMNANEVIANRAAEILG +RGEK VHPNDHVNRSQSSNDTFPTVMHIAA
Sbjct  122  VVWQTGSGTQSNMNANEVIANRAAEILGRRRGEKCVHPNDHVNRSQSSNDTFPTVMHIAA  181

Query  610  AMEIN  624
            A EIN
Sbjct  182  ATEIN  186



>ref|XP_010680310.1| PREDICTED: fumarate hydratase 1, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=490

 Score =   333 bits (855),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 172/189 (91%), Gaps = 6/189 (3%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAM +A RR+T GS     S +LR    +R++S+SFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMYLANRRLTTGS-----SAALR-CAWFRFYSSSFREERDTFGPIHVPSDKLWGAQTQR  54

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPI+RAFGILKKCAAKVNMEYGL+P+IG AVMQAAQEVAEGKLND
Sbjct  55   SLQNFEIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPTIGNAVMQAAQEVAEGKLND  114

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG K VHPNDHVNRSQSSNDTFPTVM
Sbjct  115  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGGKFVHPNDHVNRSQSSNDTFPTVM  174

Query  598  HIAAAMEIN  624
            HIAAAMEIN
Sbjct  175  HIAAAMEIN  183



>emb|CDP17101.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   333 bits (855),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 173/189 (92%), Gaps = 7/189 (4%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAML+A+RR++ GS R+++      T  +R FSTSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMLVASRRLSIGS-RTVT------TSLFRCFSTSFREERDTFGPILVPSDKLWGAQTQR  53

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPIIRAFGILKKCAAKVNMEYGL+P I KA+MQAAQEVAEGKLND
Sbjct  54   SLQNFEIGGERERMPEPIIRAFGILKKCAAKVNMEYGLDPVIAKAIMQAAQEVAEGKLND  113

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG K VHPNDHVNRSQSSNDTFPTVM
Sbjct  114  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGGKFVHPNDHVNRSQSSNDTFPTVM  173

Query  598  HIAAAMEIN  624
            HIAAA+E+N
Sbjct  174  HIAAAVEVN  182



>ref|XP_009346608.1| PREDICTED: fumarate hydratase 1, mitochondrial [Pyrus x bretschneideri]
Length=493

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 170/189 (90%), Gaps = 3/189 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA+ + +RR   GST      +LRY    R +ST FREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAVYLVSRRAAGGST---PLAALRYATSLRPYSTKFREERDTFGPINVPSDKLWGAQTQR  57

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG+RERMPEPI+RAFG+LKKCAA+VNMEYGL+P+IGKAVMQAAQEVAEGKLN+
Sbjct  58   SLQNFDIGGERERMPEPIVRAFGVLKKCAAEVNMEYGLDPTIGKAVMQAAQEVAEGKLNE  117

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLVIWQTGSGTQSNMNANEVIANRAAEILGH+RGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  118  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHQRGEKFVHPNDHVNRSQSSNDTFPTVM  177

Query  598  HIAAAMEIN  624
            HIA+AMEIN
Sbjct  178  HIASAMEIN  186



>ref|XP_002302734.1| Fumarate hydratase 1 family protein [Populus trichocarpa]
 gb|EEE82007.1| Fumarate hydratase 1 family protein [Populus trichocarpa]
Length=490

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 170/189 (90%), Gaps = 6/189 (3%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAM I +RR++ GST      + RY    R +ST+FREERDTFGPI VP+DKLWGAQTQR
Sbjct  1    MAMYIVSRRLSTGST------TWRYGNWLRSYSTAFREERDTFGPISVPADKLWGAQTQR  54

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGGDRERMPEPIIRAFGILKKCAAKVNM+YGL+PSIGKA+MQAA EVAEGKL+D
Sbjct  55   SLQNFDIGGDRERMPEPIIRAFGILKKCAAKVNMQYGLDPSIGKAIMQAAHEVAEGKLSD  114

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  115  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSSNDTFPTVM  174

Query  598  HIAAAMEIN  624
            HIAAA EIN
Sbjct  175  HIAAATEIN  183



>ref|XP_002273033.1| PREDICTED: fumarate hydratase 1, mitochondrial [Vitis vinifera]
 emb|CBI36898.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 168/187 (90%), Gaps = 1/187 (1%)
 Frame = +1

Query  64   MLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSL  243
            M+ AA R  CG +       LRY +C R  STSFREE+DTFGPI VPSDKLWGAQTQRSL
Sbjct  2    MMYAASRRLCGGSAGSPLLGLRY-MCLRSLSTSFREEKDTFGPILVPSDKLWGAQTQRSL  60

Query  244  QNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHF  423
            QNF+IGG+RE+MPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEV+EGKLNDHF
Sbjct  61   QNFDIGGEREQMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVSEGKLNDHF  120

Query  424  PLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHI  603
            PLVIWQTGSGTQSNMNANEVIANRAAEILGH+RGEK VHPNDHVNRSQSSNDTFPTVMHI
Sbjct  121  PLVIWQTGSGTQSNMNANEVIANRAAEILGHQRGEKYVHPNDHVNRSQSSNDTFPTVMHI  180

Query  604  AAAMEIN  624
            AAA EIN
Sbjct  181  AAATEIN  187



>ref|XP_011007799.1| PREDICTED: fumarate hydratase 1, mitochondrial [Populus euphratica]
Length=490

 Score =   331 bits (849),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 170/189 (90%), Gaps = 6/189 (3%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAM I +RR++ GST      + RY    R +ST+FREERDTFGPI VP+DKLWGAQTQR
Sbjct  1    MAMYIVSRRLSTGST------TWRYGNWLRSYSTAFREERDTFGPINVPADKLWGAQTQR  54

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGGDRERMPEPIIRAFGILKKCAAKVN+EYGL+PSIGKA+MQAA EVAEGKL+D
Sbjct  55   SLQNFDIGGDRERMPEPIIRAFGILKKCAAKVNIEYGLDPSIGKAIMQAAHEVAEGKLSD  114

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  115  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSSNDTFPTVM  174

Query  598  HIAAAMEIN  624
            HIAAA EIN
Sbjct  175  HIAAATEIN  183



>gb|AAB39989.1| fumarase [Arabidopsis thaliana]
Length=491

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +1

Query  121  SLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRA  300
            +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGG+RERMPEPI+RA
Sbjct  17   ALRYATSLRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGERERMPEPIVRA  76

Query  301  FGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANE  480
            FG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANE
Sbjct  77   FGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANE  136

Query  481  VIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            VIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN
Sbjct  137  VIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVMHIAAATEIN  184



>ref|XP_004240578.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Solanum 
lycopersicum]
Length=488

 Score =   329 bits (844),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 173/190 (91%), Gaps = 8/190 (4%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAML+A+RR        +S+  +RY+   R+ STSFREERDTFGPI VP DKLWGAQTQR
Sbjct  1    MAMLVASRR--------LSTIIVRYSSSSRFCSTSFREERDTFGPILVPDDKLWGAQTQR  52

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPIIRAFGILKKCAAKVNMEYGL+PSIGKAVMQAAQEVAEGKLND
Sbjct  53   SLQNFEIGGERERMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAVMQAAQEVAEGKLND  112

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRA+EILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  113  HFPLVVWQTGSGTQSNMNANEVIANRASEILGHKRGEKHVHPNDHVNRSQSSNDTFPTVM  172

Query  598  HIAAAMEINK  627
            HIAAAMEINK
Sbjct  173  HIAAAMEINK  182



>ref|XP_007145184.1| hypothetical protein PHAVU_007G217600g [Phaseolus vulgaris]
 gb|ESW17178.1| hypothetical protein PHAVU_007G217600g [Phaseolus vulgaris]
Length=495

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 174/189 (92%), Gaps = 1/189 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA+  A+RR++ GS  S +  +LR+    R +S+SFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MALYAASRRLSTGS-NSTTLLALRFASSSRSYSSSFREERDTFGPIQVPSDKLWGAQTQR  59

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG RERMPEPI+RAFG+LKKCAAKVNMEYGL+P++GKA+MQAAQEVAEGKLND
Sbjct  60   SLQNFDIGGPRERMPEPIVRAFGVLKKCAAKVNMEYGLDPNVGKAIMQAAQEVAEGKLND  119

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  120  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKVVHPNDHVNRSQSSNDTFPTVM  179

Query  598  HIAAAMEIN  624
            HIAAAMEIN
Sbjct  180  HIAAAMEIN  188



>ref|XP_002283168.2| PREDICTED: fumarate hydratase 1, mitochondrial [Vitis vinifera]
 emb|CBI39552.3| unnamed protein product [Vitis vinifera]
Length=496

 Score =   329 bits (843),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 169/192 (88%), Gaps = 7/192 (4%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISS---ESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQ  228
            MAML A R   CGS RS+     E LRY  C R FSTSFREE+DT G + VP DKLWGAQ
Sbjct  1    MAMLRAYR---CGSYRSLMPQFMEMLRYD-CLRAFSTSFREEKDTLGTVLVPDDKLWGAQ  56

Query  229  TQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGK  408
            TQRSLQNFEIGG+ ERMPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEVAEGK
Sbjct  57   TQRSLQNFEIGGESERMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVAEGK  116

Query  409  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFP  588
            LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFP
Sbjct  117  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSSNDTFP  176

Query  589  TVMHIAAAMEIN  624
            TVMHIAA +EIN
Sbjct  177  TVMHIAAGVEIN  188



>gb|AAL62385.1| fumarate hydratase [Arabidopsis thaliana]
Length=214

 Score =   318 bits (816),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  145  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  324
            R +ST FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPI+RAFG+LKKCA
Sbjct  33   RSYSTPFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIVRAFGVLKKCA  92

Query  325  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  504
            AKVNMEYGL+P IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPMIGEAIMEAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAE  152

Query  505  ILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI
Sbjct  153  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEI  191



>ref|XP_009378742.1| PREDICTED: LOW QUALITY PROTEIN: fumarate hydratase 1, mitochondrial-like 
[Pyrus x bretschneideri]
Length=566

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 169/196 (86%), Gaps = 3/196 (2%)
 Frame = +1

Query  37   SSIRETQMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKL  216
            S     QMAM + +RR   G T      + RY    R +STSFREERDTFGPI VPSDKL
Sbjct  67   SEFYHQQMAMYVVSRRAAGGLT---PLAAFRYATSLRAYSTSFREERDTFGPINVPSDKL  123

Query  217  WGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEV  396
            WGAQTQRSLQNF+IGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEV
Sbjct  124  WGAQTQRSLQNFDIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEV  183

Query  397  AEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSN  576
            AEGKLN HFPLVIWQTGSGTQSNMNANEVI+NRAAEILGH+RGEK VHPNDHVNRSQSSN
Sbjct  184  AEGKLNQHFPLVIWQTGSGTQSNMNANEVISNRAAEILGHQRGEKFVHPNDHVNRSQSSN  243

Query  577  DTFPTVMHIAAAMEIN  624
            DTFPTVMHIA+A EIN
Sbjct  244  DTFPTVMHIASAKEIN  259



>ref|XP_008345222.1| PREDICTED: fumarate hydratase 1, mitochondrial [Malus domestica]
Length=495

 Score =   327 bits (839),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 168/190 (88%), Gaps = 3/190 (2%)
 Frame = +1

Query  55   QMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            QMAM I +RR   G    +++   RY    R +STSFREERDTFGPI VPSDKLWGAQTQ
Sbjct  2    QMAMYIVSRRA-AGELTPLAA--FRYATSSRAYSTSFREERDTFGPINVPSDKLWGAQTQ  58

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSLQNF+IGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN
Sbjct  59   RSLQNFDIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLN  118

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTV  594
             HFPLVIWQTGSGTQSNMN NEVIANRAAEILGH+RGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  119  QHFPLVIWQTGSGTQSNMNVNEVIANRAAEILGHQRGEKFVHPNDHVNRSQSSNDTFPTV  178

Query  595  MHIAAAMEIN  624
            MHIA+A EIN
Sbjct  179  MHIASAKEIN  188



>ref|XP_008790868.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=498

 Score =   325 bits (834),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 171/192 (89%), Gaps = 4/192 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSIS---SESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQ  228
            MAM++ A R   G + + S   +  LR  +C R  ST+FREERDTFGPI VP+DKLWGAQ
Sbjct  1    MAMMVGASRRLAGRSNAASMLVAGMLRSALC-RPISTAFREERDTFGPIMVPADKLWGAQ  59

Query  229  TQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGK  408
            TQRSLQNF+IGG+RE+MPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEVAEGK
Sbjct  60   TQRSLQNFDIGGEREQMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVAEGK  119

Query  409  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFP  588
            LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK GEK VHPNDHVNR+QSSNDTFP
Sbjct  120  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKHGEKFVHPNDHVNRAQSSNDTFP  179

Query  589  TVMHIAAAMEIN  624
            TVMHIAAA+EIN
Sbjct  180  TVMHIAAAVEIN  191



>ref|XP_008454312.1| PREDICTED: fumarate hydratase 1, mitochondrial [Cucumis melo]
Length=494

 Score =   325 bits (834),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 159/167 (95%), Gaps = 1/167 (1%)
 Frame = +1

Query  127  RY-TVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  303
            RY T   R +STSFREERDTFGPI VPSD+LWGAQTQRSLQNFEIGGDRERMPEPIIRAF
Sbjct  21   RYATTSLRSYSTSFREERDTFGPINVPSDRLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  80

Query  304  GILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  483
            G+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEV
Sbjct  81   GVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEV  140

Query  484  IANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            IANRA+EILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN
Sbjct  141  IANRASEILGHKRGEKFVHPNDHVNRSQSSNDTFPTVMHIAAATEIN  187



>ref|XP_010938348.1| PREDICTED: fumarate hydratase 1, mitochondrial [Elaeis guineensis]
Length=498

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 171/192 (89%), Gaps = 4/192 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISS---ESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQ  228
            MAM++ A R   G + + S+     LR  +C R  ST+FREERDTFGPI VP+DKLWGAQ
Sbjct  1    MAMMVGASRRLAGRSNAASALLAGMLRSALC-RPISTAFREERDTFGPIMVPADKLWGAQ  59

Query  229  TQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGK  408
            TQRSLQNF+IGG+RE+MPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEVAEGK
Sbjct  60   TQRSLQNFDIGGEREQMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVAEGK  119

Query  409  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFP  588
            LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK GEK VHPNDHVNR+QSSNDTFP
Sbjct  120  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKCGEKFVHPNDHVNRAQSSNDTFP  179

Query  589  TVMHIAAAMEIN  624
            TVMHIAAA+EIN
Sbjct  180  TVMHIAAAVEIN  191



>ref|XP_004152237.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004156827.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN52832.1| hypothetical protein Csa_4G001990 [Cucumis sativus]
Length=495

 Score =   323 bits (829),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 149/167 (89%), Positives = 159/167 (95%), Gaps = 1/167 (1%)
 Frame = +1

Query  127  RY-TVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  303
            RY T   R +STSFREERDTFGPI VPSD+LWGAQTQRSLQNFEIGGDRERMPEPIIRAF
Sbjct  21   RYATTSLRSYSTSFREERDTFGPINVPSDRLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  80

Query  304  GILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  483
            G+LKKCAAKVNM+YGL+P+IGKA+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEV
Sbjct  81   GVLKKCAAKVNMDYGLDPTIGKAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEV  140

Query  484  IANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            IANRA+EILGHKRG+K VHPNDHVNRSQSSNDTFPTVMHIAAA EIN
Sbjct  141  IANRASEILGHKRGDKFVHPNDHVNRSQSSNDTFPTVMHIAAATEIN  187



>ref|XP_006280350.1| hypothetical protein CARUB_v10026277mg [Capsella rubella]
 gb|EOA13248.1| hypothetical protein CARUB_v10026277mg [Capsella rubella]
Length=498

 Score =   323 bits (829),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  330
            +STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG+LKKCAAK
Sbjct  34   YSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGVLKKCAAK  93

Query  331  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  510
            VNMEYGL+P+IG+A+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAEIL
Sbjct  94   VNMEYGLDPTIGEAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAEIL  153

Query  511  GHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            GH+RGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN
Sbjct  154  GHERGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEIN  191



>ref|XP_010442577.1| PREDICTED: fumarate hydratase 2, chloroplastic-like isoform X2 
[Camelina sativa]
Length=491

 Score =   323 bits (828),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +1

Query  145  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  324
            RY+STSFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGGDRERMPEPI+RAFG+LKKCA
Sbjct  33   RYYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGDRERMPEPIVRAFGVLKKCA  92

Query  325  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  504
            AKVNMEYGL+P+IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQ+NMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPTIGEAIMKAAQEVAEGKLNDHFPLVVWQTGSGTQTNMNANEVIANRAAE  152

Query  505  ILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI
Sbjct  153  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEI  191



>ref|XP_010442576.1| PREDICTED: fumarate hydratase 2, chloroplastic-like isoform X1 
[Camelina sativa]
Length=499

 Score =   323 bits (828),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +1

Query  145  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  324
            RY+STSFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGGDRERMPEPI+RAFG+LKKCA
Sbjct  33   RYYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGDRERMPEPIVRAFGVLKKCA  92

Query  325  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  504
            AKVNMEYGL+P+IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQ+NMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPTIGEAIMKAAQEVAEGKLNDHFPLVVWQTGSGTQTNMNANEVIANRAAE  152

Query  505  ILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI
Sbjct  153  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEI  191



>ref|XP_010482421.1| PREDICTED: fumarate hydratase 2, chloroplastic-like [Camelina 
sativa]
Length=499

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +1

Query  145  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  324
            RY+S+SFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGGDRERMPEPIIRAFG+LKKCA
Sbjct  33   RYYSSSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGDRERMPEPIIRAFGVLKKCA  92

Query  325  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  504
            AKVNMEYGL+P+IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQ+NMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPTIGEAIMKAAQEVAEGKLNDHFPLVVWQTGSGTQTNMNANEVIANRAAE  152

Query  505  ILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI
Sbjct  153  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEI  191



>ref|XP_010442609.1| PREDICTED: fumarate hydratase 2, chloroplastic-like isoform X1 
[Camelina sativa]
Length=499

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +1

Query  145  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  324
            RY+STSFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGGDRERMPEPIIRAFG+LKKCA
Sbjct  33   RYYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGDRERMPEPIIRAFGVLKKCA  92

Query  325  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  504
            AKVNMEYGL+P+IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQ+NMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPTIGEAIMKAAQEVAEGKLNDHFPLVVWQTGSGTQTNMNANEVIANRAAE  152

Query  505  ILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            ILG+KRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI
Sbjct  153  ILGYKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEI  191



>ref|XP_010442613.1| PREDICTED: fumarate hydratase 2, chloroplastic-like isoform X2 
[Camelina sativa]
Length=491

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +1

Query  145  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  324
            RY+STSFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGGDRERMPEPIIRAFG+LKKCA
Sbjct  33   RYYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGDRERMPEPIIRAFGVLKKCA  92

Query  325  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  504
            AKVNMEYGL+P+IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQ+NMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPTIGEAIMKAAQEVAEGKLNDHFPLVVWQTGSGTQTNMNANEVIANRAAE  152

Query  505  ILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            ILG+KRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI
Sbjct  153  ILGYKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEI  191



>ref|XP_009384520.1| PREDICTED: fumarate hydratase 1, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=498

 Score =   321 bits (822),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 174/192 (91%), Gaps = 4/192 (2%)
 Frame = +1

Query  58   MAMLIAA-RRVT--CGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQ  228
            MAM++AA RR+    G+  ++S+  LR +   +  + +FREERDTFGPI VP+D+LWGAQ
Sbjct  1    MAMMVAAARRLAGRSGAAPALSNVVLR-SATLQTMAGAFREERDTFGPIMVPADRLWGAQ  59

Query  229  TQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGK  408
            TQRSLQNF+IGG+RE+MPEPIIRAFG+LKKCAAKVNMEYGL+P++GKA+MQAAQEVAEGK
Sbjct  60   TQRSLQNFDIGGEREQMPEPIIRAFGVLKKCAAKVNMEYGLDPTVGKAIMQAAQEVAEGK  119

Query  409  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFP  588
            LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFP
Sbjct  120  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSSNDTFP  179

Query  589  TVMHIAAAMEIN  624
            TVMHIAAA+EIN
Sbjct  180  TVMHIAAAVEIN  191



>gb|ACJ85812.1| unknown [Medicago truncatula]
Length=352

 Score =   315 bits (808),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 167/191 (87%), Gaps = 9/191 (5%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFS--TSFREERDTFGPIQVPSDKLWGAQT  231
            MA+ + +RR+   ST+S S     +    RYFS  T+FREERDTFGPIQ PSDKLWGAQT
Sbjct  1    MALYVLSRRL---STKSTSPTPFTF----RYFSSTTTFREERDTFGPIQAPSDKLWGAQT  53

Query  232  QRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKL  411
            QRSLQNF+IGG RERMPEPIIR+FGILKKCAAKVNMEYGL+P+IGKA+M+AAQEVA+GK 
Sbjct  54   QRSLQNFDIGGPRERMPEPIIRSFGILKKCAAKVNMEYGLDPTIGKAIMKAAQEVADGKH  113

Query  412  NDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPT  591
            NDHFPLV+WQTGSGTQSNMNANEVIANRA+EILGHKRGEK VHPNDHVN SQSSNDTFPT
Sbjct  114  NDHFPLVVWQTGSGTQSNMNANEVIANRASEILGHKRGEKFVHPNDHVNMSQSSNDTFPT  173

Query  592  VMHIAAAMEIN  624
            VMHIAA  EIN
Sbjct  174  VMHIAAGTEIN  184



>ref|XP_004495932.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Cicer arietinum]
Length=493

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  148  YFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAA  327
            Y S+SFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGG RERMPEPI+RAFGILKKCAA
Sbjct  28   YSSSSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGPRERMPEPIVRAFGILKKCAA  87

Query  328  KVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEI  507
            KVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRA+EI
Sbjct  88   KVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRASEI  147

Query  508  LGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            LGH RGEK VHPNDHVNRSQSSNDTFPTVMHIAA MEIN
Sbjct  148  LGHMRGEKFVHPNDHVNRSQSSNDTFPTVMHIAAGMEIN  186



>ref|NP_199908.1| fumarate hydratase 2 [Arabidopsis thaliana]
 sp|Q9FI53.1|FUM2_ARATH RecName: Full=Fumarate hydratase 2, chloroplastic; Short=Fumarase 
2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08741.1| fumarate hydratase [Arabidopsis thaliana]
 gb|AAK97668.1| AT5g50950/K3K7_11 [Arabidopsis thaliana]
 gb|AAM47378.1| AT5g50950/K3K7_11 [Arabidopsis thaliana]
 gb|AED96015.1| fumarate hydratase 2 [Arabidopsis thaliana]
Length=499

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  145  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  324
            R +ST FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPI+RAFG+LKKCA
Sbjct  33   RSYSTPFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIVRAFGVLKKCA  92

Query  325  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  504
            AKVNMEYGL+P IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPMIGEAIMEAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAE  152

Query  505  ILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI
Sbjct  153  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEI  191



>emb|CDY27481.1| BnaC04g51220D [Brassica napus]
Length=487

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 170/190 (89%), Gaps = 11/190 (6%)
 Frame = +1

Query  58   MAMLIAARRVTCGST-RSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            MA+ +A+RR++ G+  R++ S          Y ++SFREERDTFGPIQVPSDKLWGAQTQ
Sbjct  1    MAIYVASRRLSSGTALRAMRS----------YSTSSFREERDTFGPIQVPSDKLWGAQTQ  50

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+M+AAQEVAEGKL+
Sbjct  51   RSLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMEAAQEVAEGKLS  110

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTV  594
             HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  111  HHFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTV  170

Query  595  MHIAAAMEIN  624
            MHIAAA EIN
Sbjct  171  MHIAAATEIN  180



>ref|XP_010442599.1| PREDICTED: fumarate hydratase 2, chloroplastic [Camelina sativa]
Length=498

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 155/157 (99%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  330
            +STSFREERDTFGPIQVPSDKLWGAQTQRSL+NFEIGG+RERMPEPIIRAFG+LKKCAAK
Sbjct  34   YSTSFREERDTFGPIQVPSDKLWGAQTQRSLRNFEIGGNRERMPEPIIRAFGVLKKCAAK  93

Query  331  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  510
            VNMEYGL+P+IG+A+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAEIL
Sbjct  94   VNMEYGLDPTIGEAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAEIL  153

Query  511  GHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            GHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI
Sbjct  154  GHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEI  190



>ref|NP_851166.1| fumarate hydratase 2 [Arabidopsis thaliana]
 dbj|BAH19582.1| AT5G50950 [Arabidopsis thaliana]
 gb|AED96014.1| fumarate hydratase 2 [Arabidopsis thaliana]
Length=510

 Score =   318 bits (816),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  145  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  324
            R +ST FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPI+RAFG+LKKCA
Sbjct  33   RSYSTPFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIVRAFGVLKKCA  92

Query  325  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  504
            AKVNMEYGL+P IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPMIGEAIMEAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAE  152

Query  505  ILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI
Sbjct  153  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEI  191



>ref|XP_003591472.1| Fumarate hydratase [Medicago truncatula]
 gb|AES61723.1| fumarate hydratase [Medicago truncatula]
Length=491

 Score =   318 bits (814),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 169/191 (88%), Gaps = 9/191 (5%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFS--TSFREERDTFGPIQVPSDKLWGAQT  231
            MA+ + +RR++  ST    S +L     +RYFS  T+FREERDTFGPIQVPSDKLWGAQT
Sbjct  1    MALYVLSRRLSTKST----SPTL---FTFRYFSSTTTFREERDTFGPIQVPSDKLWGAQT  53

Query  232  QRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKL  411
            QRSLQNF+IGG RERMPEPIIR+FGILKKCAAKVNMEYGL+P+IGKA+M+AAQEVA+GK 
Sbjct  54   QRSLQNFDIGGPRERMPEPIIRSFGILKKCAAKVNMEYGLDPTIGKAIMKAAQEVADGKH  113

Query  412  NDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPT  591
            NDHFPLV+WQTGSGTQSNMNANEVIANRA+EILGHKRGEK VHPNDHVN SQSSNDTFPT
Sbjct  114  NDHFPLVVWQTGSGTQSNMNANEVIANRASEILGHKRGEKFVHPNDHVNMSQSSNDTFPT  173

Query  592  VMHIAAAMEIN  624
            VMHIAA  EIN
Sbjct  174  VMHIAAGTEIN  184



>ref|XP_002864085.1| hypothetical protein ARALYDRAFT_495160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40344.1| hypothetical protein ARALYDRAFT_495160 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score =   318 bits (814),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  145  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  324
            R +STSFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGGDRERMPEPI+RAFG+LKKCA
Sbjct  33   RSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFKIGGDRERMPEPIVRAFGVLKKCA  92

Query  325  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  504
            AKVNMEYGL+P IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPMIGEAIMEAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAE  152

Query  505  ILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIA A EI
Sbjct  153  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAVATEI  191



>ref|XP_003518952.1| PREDICTED: fumarate hydratase 1, mitochondrial [Glycine max]
 gb|KHN08664.1| Fumarate hydratase 1, mitochondrial [Glycine soja]
Length=495

 Score =   317 bits (813),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 171/189 (90%), Gaps = 1/189 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA+ + +RR++ GS  S +  +LR+    R +S+SFREERDTFG IQVPS+KLWGAQTQR
Sbjct  1    MALYVLSRRLSAGSN-STTLLALRFVSSTRSYSSSFREERDTFGAIQVPSEKLWGAQTQR  59

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG RERMPEPIIRAFG+LKKCAAKVNMEYGL+P++GKA+MQAAQEVAEGKLND
Sbjct  60   SLQNFDIGGPRERMPEPIIRAFGVLKKCAAKVNMEYGLDPAVGKAIMQAAQEVAEGKLND  119

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEIL HKRG K VHPNDHVNRSQSSNDTFPTVM
Sbjct  120  HFPLVVWQTGSGTQSNMNANEVIANRAAEILWHKRGGKLVHPNDHVNRSQSSNDTFPTVM  179

Query  598  HIAAAMEIN  624
            HIAAAMEIN
Sbjct  180  HIAAAMEIN  188



>ref|XP_003557953.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Brachypodium 
distachyon]
Length=494

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 172/190 (91%), Gaps = 4/190 (2%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRY-TVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            MAM++  RR+  G++ S S+ +L +     R  ST FREERDTFGPI+VPSDKLWGAQTQ
Sbjct  1    MAMVL--RRL-AGASGSPSAAALLFRPALTRPISTGFREERDTFGPIRVPSDKLWGAQTQ  57

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSLQNF+IGG+RERMP PIIRAFG+LKKCAAKVNMEYGL+P+IGKA+MQAA+EVAEGKL+
Sbjct  58   RSLQNFDIGGERERMPVPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAEEVAEGKLD  117

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTV  594
            DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPTV
Sbjct  118  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPTV  177

Query  595  MHIAAAMEIN  624
            MHIAAA+EIN
Sbjct  178  MHIAAAVEIN  187



>ref|XP_006281482.1| hypothetical protein CARUB_v10027566mg [Capsella rubella]
 gb|EOA14380.1| hypothetical protein CARUB_v10027566mg [Capsella rubella]
Length=481

 Score =   314 bits (805),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +1

Query  145  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  324
            RY STSFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGGDRER+PEPIIRAFG+LKKCA
Sbjct  21   RYDSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGDRERVPEPIIRAFGVLKKCA  80

Query  325  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  504
            AKVNMEYGL+P+IG+A+M+AAQEVAEGKLN+HFPLV+WQTGSGTQ+NMNANEVIANR AE
Sbjct  81   AKVNMEYGLDPTIGEAIMEAAQEVAEGKLNEHFPLVVWQTGSGTQTNMNANEVIANRTAE  140

Query  505  ILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIA A EI
Sbjct  141  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAVATEI  179



>gb|EMS52788.1| Fumarate hydratase 2, chloroplastic [Triticum urartu]
Length=494

 Score =   313 bits (801),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 167/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAM++  RR+   S    ++  L      R  ST FREERDTFGPI+VP+DKLWGAQTQR
Sbjct  1    MAMVL--RRLAGASGSPSAAALLLRPALTRPISTGFREERDTFGPIRVPNDKLWGAQTQR  58

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG+RERMP PIIRAFG+LKKCAAKVNMEYGL+P+IGKA+MQAA+EVAEGKL+D
Sbjct  59   SLQNFDIGGERERMPVPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAEEVAEGKLDD  118

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  119  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPTVM  178

Query  598  HIAAAMEIN  624
            HIAAA+EIN
Sbjct  179  HIAAAVEIN  187



>ref|XP_004984441.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Setaria 
italica]
Length=496

 Score =   313 bits (801),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 166/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  64   MLIAARRV--TCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            M +A RR+    GS  + ++  L      R  ST FREERDTFGPIQVP+DKLWGAQTQR
Sbjct  1    MAMALRRLAGVSGSPSAAAAALLLRPALTRPISTGFREERDTFGPIQVPNDKLWGAQTQR  60

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG+RERMP PIIRAFG+LKKCAAKVNMEYGL+P+IGKA+MQAA+EVAEGKL+D
Sbjct  61   SLQNFDIGGERERMPVPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAEEVAEGKLDD  120

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG K VHPNDHVNRSQSSNDTFPTVM
Sbjct  121  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGGKFVHPNDHVNRSQSSNDTFPTVM  180

Query  598  HIAAAMEIN  624
            HIAAA+EIN
Sbjct  181  HIAAAVEIN  189



>gb|EMT27288.1| Fumarate hydratase 2, chloroplastic [Aegilops tauschii]
Length=494

 Score =   313 bits (801),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 167/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAM++  RR+   S    ++  L      R  ST FREERDTFGPI+VP+DKLWGAQTQR
Sbjct  1    MAMVL--RRLAGASGSPSAAALLLRPALTRPISTGFREERDTFGPIRVPNDKLWGAQTQR  58

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG+RERMP PIIRAFG+LKKCAAKVNMEYGL+P+IGKA+MQAA+EVAEGKL+D
Sbjct  59   SLQNFDIGGERERMPVPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAEEVAEGKLDD  118

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  119  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPTVM  178

Query  598  HIAAAMEIN  624
            HIAAA+EIN
Sbjct  179  HIAAAVEIN  187



>ref|XP_009802913.1| PREDICTED: fumarate hydratase 1, mitochondrial [Nicotiana sylvestris]
Length=465

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +1

Query  151  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  330
             +TSFREE+DTFGPI VPSDKLWGAQTQRSLQNF+IGG+RERMPEPIIRAFGILKKCAAK
Sbjct  1    MATSFREEKDTFGPILVPSDKLWGAQTQRSLQNFDIGGERERMPEPIIRAFGILKKCAAK  60

Query  331  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  510
            VNMEYGL+ SIGKA+MQAA+EVAEGKLNDHFPLV+WQTGSGT SNMNANEVIANRAAEIL
Sbjct  61   VNMEYGLDRSIGKAIMQAAEEVAEGKLNDHFPLVVWQTGSGTHSNMNANEVIANRAAEIL  120

Query  511  GHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            GHKRG+K VHPNDHVNRSQSSNDTFPTVMHIA AME+NK
Sbjct  121  GHKRGDKHVHPNDHVNRSQSSNDTFPTVMHIAVAMELNK  159



>ref|XP_010103413.1| Fumarate hydratase 1 [Morus notabilis]
 gb|EXB95732.1| Fumarate hydratase 1 [Morus notabilis]
Length=494

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 167/189 (88%), Gaps = 2/189 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MAM   +RR+  GS+  + S     ++  RY +TSFREERDTFGPI VPSDK WGAQTQR
Sbjct  1    MAMYTISRRIQNGSSTVVVSR-FATSLNLRY-ATSFREERDTFGPILVPSDKYWGAQTQR  58

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RERMPEPII+AFG LKKCAAKVN+EYGL+P+IGKA++QAAQEVA+GKLND
Sbjct  59   SLQNFEIGGERERMPEPIIQAFGTLKKCAAKVNLEYGLDPTIGKAIIQAAQEVADGKLND  118

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG K G+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  119  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKCGDKFVHPNDHVNRSQSSNDTFPTVM  178

Query  598  HIAAAMEIN  624
            HIAAA+EIN
Sbjct  179  HIAAALEIN  187



>ref|XP_010482423.1| PREDICTED: fumarate hydratase 2, chloroplastic-like [Camelina 
sativa]
Length=498

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  330
            ++TSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGG+RERMPEPIIRAFG+LKKCAAK
Sbjct  34   YATSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGNRERMPEPIIRAFGVLKKCAAK  93

Query  331  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  510
            VNMEYGL+P+IG+A+ QAAQEVAEGKLN HFPLV+WQTGSGTQSNMNANEVIANRAAEIL
Sbjct  94   VNMEYGLDPTIGEAIRQAAQEVAEGKLNGHFPLVVWQTGSGTQSNMNANEVIANRAAEIL  153

Query  511  GHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            G+KRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI
Sbjct  154  GYKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEI  190



>gb|EEC75213.1| hypothetical protein OsI_11478 [Oryza sativa Indica Group]
Length=502

 Score =   310 bits (795),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  330
             ST FREERDTFGPI+VP+DKLWGAQTQRSLQNF+IGG+RERMP PIIRAFG+LKKCAAK
Sbjct  38   ISTGFREERDTFGPIRVPNDKLWGAQTQRSLQNFDIGGERERMPVPIIRAFGVLKKCAAK  97

Query  331  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  510
            VNMEYGL+P+IGKA+MQAAQEVAEG+L+DHFPLVIWQTGSGTQSNMNANEVIANRAAEIL
Sbjct  98   VNMEYGLDPTIGKAIMQAAQEVAEGQLDDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  157

Query  511  GHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            GHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN
Sbjct  158  GHKRGEKFVHPNDHVNRSQSSNDTFPTVMHIAAATEIN  195



>gb|ABF95833.1| Fumarate hydratase 1, mitochondrial precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAH01638.1| unnamed protein product [Oryza sativa Japonica Group]
Length=502

 Score =   310 bits (795),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  330
             ST FREERDTFGPI+VP+DKLWGAQTQRSLQNF+IGG+RERMP PIIRAFG+LKKCAAK
Sbjct  38   ISTGFREERDTFGPIRVPNDKLWGAQTQRSLQNFDIGGERERMPVPIIRAFGVLKKCAAK  97

Query  331  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  510
            VNMEYGL+P+IGKA+MQAAQEVAEG+L+DHFPLVIWQTGSGTQSNMNANEVIANRAAEIL
Sbjct  98   VNMEYGLDPTIGKAIMQAAQEVAEGQLDDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  157

Query  511  GHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            GHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN
Sbjct  158  GHKRGEKFVHPNDHVNRSQSSNDTFPTVMHIAAATEIN  195



>ref|XP_003518957.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Glycine 
max]
Length=465

 Score =   309 bits (792),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  330
             + SFREERDTFG IQVPS+KLWGAQTQRSLQNF+IGG RERMPEPIIRAFG+LKKCAAK
Sbjct  1    MALSFREERDTFGAIQVPSEKLWGAQTQRSLQNFDIGGPRERMPEPIIRAFGVLKKCAAK  60

Query  331  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  510
            VNMEYGL+P++G+A+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAEIL
Sbjct  61   VNMEYGLDPNVGEAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAEIL  120

Query  511  GHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            GHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN
Sbjct  121  GHKRGEKFVHPNDHVNRSQSSNDTFPTVMHIAAATEIN  158



>gb|KHN08665.1| Fumarate hydratase 2, chloroplastic [Glycine soja]
Length=466

 Score =   309 bits (792),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  330
             + SFREERDTFG IQVPS+KLWGAQTQRSLQNF+IGG RERMPEPIIRAFG+LKKCAAK
Sbjct  1    MALSFREERDTFGAIQVPSEKLWGAQTQRSLQNFDIGGPRERMPEPIIRAFGVLKKCAAK  60

Query  331  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  510
            VNMEYGL+P++G+A+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAEIL
Sbjct  61   VNMEYGLDPNVGEAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAEIL  120

Query  511  GHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            GHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN
Sbjct  121  GHKRGEKFVHPNDHVNRSQSSNDTFPTVMHIAAATEIN  158



>gb|KCW58396.1| hypothetical protein EUGRSUZ_H01083 [Eucalyptus grandis]
Length=478

 Score =   310 bits (793),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +1

Query  154  STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKV  333
            ST FREERDTFGPI VP++KLWGAQTQRSLQNF+IGG+RERMPEPIIRAFG+LKKCAAKV
Sbjct  15   STGFREERDTFGPILVPANKLWGAQTQRSLQNFDIGGERERMPEPIIRAFGVLKKCAAKV  74

Query  334  NMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  513
            NMEYGL+PSIG A+MQAA+EVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG
Sbjct  75   NMEYGLDPSIGGAIMQAAEEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  134

Query  514  HKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
             KRGEK VHPNDHVNRSQSSNDTFPTVMHIAA MEIN
Sbjct  135  RKRGEKSVHPNDHVNRSQSSNDTFPTVMHIAAVMEIN  171



>ref|XP_010026118.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Eucalyptus 
grandis]
Length=479

 Score =   310 bits (793),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +1

Query  154  STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKV  333
            ST FREERDTFGPI VP++KLWGAQTQRSLQNF+IGG+RERMPEPIIRAFG+LKKCAAKV
Sbjct  15   STGFREERDTFGPILVPANKLWGAQTQRSLQNFDIGGERERMPEPIIRAFGVLKKCAAKV  74

Query  334  NMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  513
            NMEYGL+PSIG A+MQAA+EVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG
Sbjct  75   NMEYGLDPSIGGAIMQAAEEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  134

Query  514  HKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
             KRGEK VHPNDHVNRSQSSNDTFPTVMHIAA MEIN
Sbjct  135  RKRGEKSVHPNDHVNRSQSSNDTFPTVMHIAAVMEIN  171



>ref|XP_006651566.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Oryza brachyantha]
Length=491

 Score =   310 bits (793),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  145  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  324
            R  ST FREERDTFGPI+VP DKLWGAQTQRSLQNF+IGG+RERMP PIIRAFG+LKKCA
Sbjct  25   RPISTGFREERDTFGPIRVPDDKLWGAQTQRSLQNFDIGGERERMPVPIIRAFGVLKKCA  84

Query  325  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  504
            AKVNMEYGL+P IGKA++QAAQEVAEG+L+DHFPLVIWQTGSGTQSNMNANEVIANRAAE
Sbjct  85   AKVNMEYGLDPKIGKAIIQAAQEVAEGQLDDHFPLVIWQTGSGTQSNMNANEVIANRAAE  144

Query  505  ILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN
Sbjct  145  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEIN  184



>ref|XP_003536023.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Glycine 
max]
Length=495

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA  + +RR++ GS  S +  +LR+    R FS+SFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAFYVLSRRLSAGS-NSTTLLALRFASSSRSFSSSFREERDTFGPIQVPSDKLWGAQTQR  59

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG RERMPEPIIRAFG+LKKCAAKVNMEYGL+P +G+A+MQAAQEVAEGKLN+
Sbjct  60   SLQNFDIGGPRERMPEPIIRAFGVLKKCAAKVNMEYGLDPIVGEAIMQAAQEVAEGKLNE  119

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG K VHPNDHVNRSQSSNDTFPTVM
Sbjct  120  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGGKFVHPNDHVNRSQSSNDTFPTVM  179

Query  598  HIAAAMEIN  624
            HIAA MEIN
Sbjct  180  HIAATMEIN  188



>ref|XP_008795801.1| PREDICTED: LOW QUALITY PROTEIN: fumarate hydratase 1, mitochondrial-like 
[Phoenix dactylifera]
Length=474

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 155/167 (93%), Gaps = 1/167 (1%)
 Frame = +1

Query  124  LRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  303
            L+  +C R  ST FREER  FGP+ VP+DKLWGAQTQRSLQNF+IGG RE+MPEPIIRAF
Sbjct  2    LQSALC-RPLSTVFREERXPFGPMMVPADKLWGAQTQRSLQNFDIGGQREQMPEPIIRAF  60

Query  304  GILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  483
            GILKKCAAKVNMEYGL+PSIG+A+MQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV
Sbjct  61   GILKKCAAKVNMEYGLDPSIGRAIMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  120

Query  484  IANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            IANRAAEILGHK GEK VHPNDHVNR+QSSNDTFPTVMHIAAA+EIN
Sbjct  121  IANRAAEILGHKHGEKFVHPNDHVNRAQSSNDTFPTVMHIAAAVEIN  167



>gb|ABK24782.1| unknown [Picea sitchensis]
 gb|ABR17637.1| unknown [Picea sitchensis]
Length=495

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA++ A RR    ST S    ++ +T   R  ST+FREERDTFGPI VP+DKLWGAQTQR
Sbjct  1    MAIISAYRRHLSISTASSLMHNISFTYS-RSLSTAFREERDTFGPINVPADKLWGAQTQR  59

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNFEIGG+RE+MPE II++FG+LKKCAAKVNM+YGL+P+IGKA+MQAAQEVAEGKLN 
Sbjct  60   SLQNFEIGGEREQMPEQIIQSFGVLKKCAAKVNMDYGLDPTIGKAIMQAAQEVAEGKLNS  119

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLVIWQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVN SQSSNDTFPTVM
Sbjct  120  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNMSQSSNDTFPTVM  179

Query  598  HIAAAMEIN  624
            HIAAA+E+N
Sbjct  180  HIAAAVEMN  188



>gb|KHN30668.1| Fumarate hydratase 1, mitochondrial [Glycine soja]
Length=495

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA  + +RR++ GS  S +  +LR+    R FS+SFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAFYVLSRRLSAGS-NSTTLLALRFASSSRSFSSSFREERDTFGPIQVPSDKLWGAQTQR  59

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG RERMPEPIIRAFG+LKKCAAKVNMEYGL+P +G+A+MQAAQEVAEGKLN+
Sbjct  60   SLQNFDIGGPRERMPEPIIRAFGVLKKCAAKVNMEYGLDPIVGEAIMQAAQEVAEGKLNE  119

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLV+WQTGSGTQSNMNANEVIANRAAEI+GHKRG K VHPNDHVNRSQSSNDTFPTVM
Sbjct  120  HFPLVVWQTGSGTQSNMNANEVIANRAAEIIGHKRGGKFVHPNDHVNRSQSSNDTFPTVM  179

Query  598  HIAAAMEIN  624
            HIAA MEIN
Sbjct  180  HIAATMEIN  188



>ref|XP_008359427.1| PREDICTED: LOW QUALITY PROTEIN: fumarate hydratase 1, mitochondrial-like 
[Malus domestica]
Length=499

 Score =   308 bits (788),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 166/195 (85%), Gaps = 9/195 (5%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA+ I +R     ST      +LR+    R +ST FREERDTFGP  VPSDKLWGAQTQR
Sbjct  1    MAIYIVSRWAAGVST---PLPALRFATSLRPYSTKFREERDTFGPXNVPSDKLWGAQTQR  57

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG+RERMP+PI+ AFG+LKKCAAKVNMEYGL+P+IGKAVMQAAQEVAEGKLN+
Sbjct  58   SLQNFDIGGERERMPQPIVCAFGVLKKCAAKVNMEYGLDPTIGKAVMQAAQEVAEGKLNE  117

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPT--  591
            HFPLVIWQTGSGTQSNMNANEVIANRAAEILGH+RGEK VHPNDH+N+SQSSNDTFPT  
Sbjct  118  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHQRGEKFVHPNDHINKSQSSNDTFPTVV  177

Query  592  ----VMHIAAAMEIN  624
                VMHIA+A+EIN
Sbjct  178  CYFQVMHIASAVEIN  192



>gb|ACL53645.1| unknown [Zea mays]
Length=498

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  124  LRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  303
            L  +   R  ST FREERDTFGPIQVP+DKLWGAQTQRSLQNF+IGG+RERMP PIIRAF
Sbjct  25   LLRSALTRPISTGFREERDTFGPIQVPNDKLWGAQTQRSLQNFDIGGERERMPVPIIRAF  84

Query  304  GILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  483
            G+LKKCAAKVNM+YGL+P+IGKA++QAA+EVAEGKL+DHFPLVIWQTGSGTQSNMNANEV
Sbjct  85   GVLKKCAAKVNMDYGLDPTIGKAIIQAAEEVAEGKLDDHFPLVIWQTGSGTQSNMNANEV  144

Query  484  IANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            IANRA+EILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIA A+EI+
Sbjct  145  IANRASEILGHKRGEKFVHPNDHVNRSQSSNDTFPTVMHIATAVEIH  191



>ref|NP_001146296.1| uncharacterized protein LOC100279871 [Zea mays]
 gb|ACN32151.1| unknown [Zea mays]
 tpg|DAA45270.1| TPA: hypothetical protein ZEAMMB73_835410 [Zea mays]
Length=498

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +1

Query  124  LRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  303
            L  +   R  ST FREERDTFGPIQVP+DKLWGAQTQRSLQNF+IGG+RERMP PIIRAF
Sbjct  25   LLRSALTRPISTGFREERDTFGPIQVPNDKLWGAQTQRSLQNFDIGGERERMPVPIIRAF  84

Query  304  GILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  483
            G+LKKCAAKVNM+YGL+P+IGKA++QAA+EVAEGKL+DHFPLVIWQTGSGTQSNMNANEV
Sbjct  85   GVLKKCAAKVNMDYGLDPTIGKAIIQAAEEVAEGKLDDHFPLVIWQTGSGTQSNMNANEV  144

Query  484  IANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            IANRA+EILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIA A+EI+
Sbjct  145  IANRASEILGHKRGEKFVHPNDHVNRSQSSNDTFPTVMHIATAVEIH  191



>gb|KFK37522.1| hypothetical protein AALP_AA4G268000 [Arabis alpina]
Length=487

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +1

Query  154  STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKV  333
            S+ FREERDTFGPIQVPSDKLWGAQTQRSL+NF+IGG+RERMPEPI+RAFG+LKKCAAKV
Sbjct  24   SSLFREERDTFGPIQVPSDKLWGAQTQRSLENFDIGGERERMPEPIVRAFGVLKKCAAKV  83

Query  334  NMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  513
            NMEYGL+ +IG+A+M+AAQEVAEGKLN+HFPLV+WQTGSGTQSNMNANEVIANRAAEILG
Sbjct  84   NMEYGLDSTIGEAIMEAAQEVAEGKLNEHFPLVVWQTGSGTQSNMNANEVIANRAAEILG  143

Query  514  HKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            HKRGEK VHPNDHVNRSQSSNDTFPTVMHIAA  EI
Sbjct  144  HKRGEKCVHPNDHVNRSQSSNDTFPTVMHIAAVTEI  179



>ref|XP_004290822.2| PREDICTED: fumarate hydratase 1, mitochondrial isoform X3 [Fragaria 
vesca subsp. vesca]
Length=469

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 150/158 (95%), Gaps = 1/158 (1%)
 Frame = +1

Query  154  STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKV  333
            S SFREERDTFGPI VPSDKLWGAQTQRSLQNF+IGG+RERMPEPIIRAFGILKKCAAKV
Sbjct  5    SGSFREERDTFGPINVPSDKLWGAQTQRSLQNFDIGGERERMPEPIIRAFGILKKCAAKV  64

Query  334  NMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  513
            NMEYGL+ SIGKA+M+AAQEVAEGKLN HFPLV+WQTGSGTQSNMNANEVIANRAAEILG
Sbjct  65   NMEYGLDQSIGKAIMEAAQEVAEGKLNQHFPLVVWQTGSGTQSNMNANEVIANRAAEILG  124

Query  514  HKRGEKGVHPNDHVNRSQSSNDTFPTV-MHIAAAMEIN  624
            HKRGEK VHPNDHVN+SQSSNDTFPTV  +IA AME+N
Sbjct  125  HKRGEKFVHPNDHVNKSQSSNDTFPTVHCYIATAMELN  162



>ref|XP_006840369.1| hypothetical protein AMTR_s00045p00124970 [Amborella trichopoda]
 gb|ERN02044.1| hypothetical protein AMTR_s00045p00124970 [Amborella trichopoda]
Length=494

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 161/189 (85%), Gaps = 2/189 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            M ML + RR+            LR T  +    +SFREE+DTFG I VP+DKLWGAQTQR
Sbjct  1    MTMLSSTRRIPHQLLAGPLVGLLRST--YSRLISSFREEKDTFGSILVPADKLWGAQTQR  58

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG+ E+MPEPIIRAFG+LKKC+AKVNMEYGL+PSIGKA+MQAAQEVA+G+LND
Sbjct  59   SLQNFDIGGECEQMPEPIIRAFGVLKKCSAKVNMEYGLDPSIGKAIMQAAQEVADGQLND  118

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVM  597
            HFPLVIWQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  119  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGKKRGEKFVHPNDHVNRSQSSNDTFPTVM  178

Query  598  HIAAAMEIN  624
            HIAAA+E N
Sbjct  179  HIAAAVETN  187



>ref|XP_007145185.1| hypothetical protein PHAVU_007G217700g [Phaseolus vulgaris]
 gb|ESW17179.1| hypothetical protein PHAVU_007G217700g [Phaseolus vulgaris]
Length=461

 Score =   293 bits (751),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +1

Query  163  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  342
             REE D+FG ++VPSDKLWGAQTQRSL NF+IGG  ERMP+PIIRAFGILKKCAAKVNME
Sbjct  1    MREETDSFGSVEVPSDKLWGAQTQRSLHNFDIGGLSERMPQPIIRAFGILKKCAAKVNME  60

Query  343  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  522
            YGL+P++G+A+MQAAQEVAEGKLN+HFPLV+WQTGSGTQ+NMNANEVIANRAAEILGHKR
Sbjct  61   YGLDPNVGEAIMQAAQEVAEGKLNEHFPLVVWQTGSGTQTNMNANEVIANRAAEILGHKR  120

Query  523  GEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            GEK VHPNDHVNRSQSSNDTFPTVMHIAAA+EIN
Sbjct  121  GEKFVHPNDHVNRSQSSNDTFPTVMHIAAAIEIN  154



>gb|KJB22510.1| hypothetical protein B456_004G051500 [Gossypium raimondii]
Length=436

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFREERDTFGPI VPSDKLWGAQTQRSLQNF+IGG+RERMPEPIIRAFG+LKKCAAKVNM
Sbjct  3    SFREERDTFGPINVPSDKLWGAQTQRSLQNFDIGGERERMPEPIIRAFGVLKKCAAKVNM  62

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            EYGL+ SIGKA+MQAAQEVAEGKLNDHFPL++WQTGSGTQSNMNANEVI+NRAAEI+GHK
Sbjct  63   EYGLDQSIGKAIMQAAQEVAEGKLNDHFPLLVWQTGSGTQSNMNANEVISNRAAEIMGHK  122

Query  520  RGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            RGEK VHPNDHVN+SQSSNDTFPT +     ++I +
Sbjct  123  RGEKSVHPNDHVNKSQSSNDTFPTSVEFKDIVKIGR  158



>gb|EPS58214.1| hypothetical protein M569_16601, partial [Genlisea aurea]
Length=302

 Score =   271 bits (693),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +1

Query  214  LWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQE  393
            LWGAQTQRSLQNFEIGG+RERMPE IIRAFGILKKCAAKVN+EYGL+PSIGKA+M+AAQE
Sbjct  1    LWGAQTQRSLQNFEIGGERERMPEQIIRAFGILKKCAAKVNIEYGLDPSIGKAIMEAAQE  60

Query  394  VAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSS  573
            VAEGKL++HFPLV+WQTGSGTQSNMNANEVIANRAAE+LGHKRGEK VHPNDHVNRSQSS
Sbjct  61   VAEGKLSEHFPLVVWQTGSGTQSNMNANEVIANRAAELLGHKRGEKFVHPNDHVNRSQSS  120

Query  574  NDTFPTVMHIAAAMEIN  624
            NDTFPTVMHIAAA+EIN
Sbjct  121  NDTFPTVMHIAAALEIN  137



>gb|EEE59021.1| hypothetical protein OsJ_10766 [Oryza sativa Japonica Group]
Length=480

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  214  LWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQE  393
            LWGAQTQRSLQNF+IGG+RERMP PIIRAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQE
Sbjct  20   LWGAQTQRSLQNFDIGGERERMPVPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQE  79

Query  394  VAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSS  573
            VAEG+L+DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSS
Sbjct  80   VAEGQLDDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSS  139

Query  574  NDTFPTVMHIAAAMEIN  624
            NDTFPTVMHIAAA EIN
Sbjct  140  NDTFPTVMHIAAATEIN  156



>emb|CDW80164.1| fumarate mitochondrial-like [Stylonychia lemnae]
Length=498

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  166  REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEY  345
            R+E+DTFGPI+VP DK WGAQTQRSLQNF+IGG+RERMP P++RAFG+LKK AA+ NM Y
Sbjct  36   RQEKDTFGPIEVPGDKYWGAQTQRSLQNFKIGGERERMPIPVVRAFGLLKKAAAQANMSY  95

Query  346  GLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG  525
            GLE  + KA++QA+ EVA+GKL++HFPLV+WQTGSGTQSNMNANEVIANRA EILG   G
Sbjct  96   GLEEKVAKAIIQASDEVAQGKLDEHFPLVVWQTGSGTQSNMNANEVIANRAIEILGGDLG  155

Query  526  EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
             K VHPNDHVNRSQSSND+FPTVMH+A  ME+N
Sbjct  156  SKLVHPNDHVNRSQSSNDSFPTVMHVATVMEVN  188



>ref|XP_001761516.1| predicted protein [Physcomitrella patens]
 gb|EDQ73584.1| predicted protein [Physcomitrella patens]
Length=500

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +1

Query  163  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  342
            FREERDTFG IQVP+D+ WGAQTQRS+QNFEIGG+ ERMP+ ++ A GILKKCAA VNME
Sbjct  41   FREERDTFGLIQVPNDRYWGAQTQRSVQNFEIGGESERMPKQLVEALGILKKCAAIVNME  100

Query  343  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  522
            YGL+   G+A+++AA EVA+GKL DHFPLV+WQTGSGTQSNMNANEVIANRA EI+G   
Sbjct  101  YGLDKKFGEAIVKAASEVAQGKLTDHFPLVVWQTGSGTQSNMNANEVIANRAGEIIGIPI  160

Query  523  GEKGVHPNDHVNRSQSSNDTFPTVMHIAAAME  618
            G KGVHPNDHVN SQSSNDTFPT MHIAAA+E
Sbjct  161  GSKGVHPNDHVNMSQSSNDTFPTAMHIAAAIE  192



>gb|EJY71120.1| Fumarate hydratase [Oxytricha trifallax]
Length=498

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  166  REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEY  345
            R+E+DTFGPI+VP DK WGAQTQRSLQNF+IGG+RERMP P++RAFG+LKK AA+ N  +
Sbjct  36   RQEKDTFGPIEVPGDKYWGAQTQRSLQNFKIGGERERMPVPVVRAFGLLKKAAAQANTSF  95

Query  346  GLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG  525
            GLE  + +A++QA+ EVA+GKL++HFPLV+WQTGSGTQSNMNANEVIANRA EILG   G
Sbjct  96   GLEAKVAQAIIQASDEVAQGKLDEHFPLVVWQTGSGTQSNMNANEVIANRAIEILGGDLG  155

Query  526  EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
             K VHPNDHVNRSQSSND+FPTVMH+A  +E+N
Sbjct  156  SKLVHPNDHVNRSQSSNDSFPTVMHVATVIEVN  188



>ref|XP_003037573.1| hypothetical protein SCHCODRAFT_81011 [Schizophyllum commune 
H4-8]
 gb|EFJ02671.1| hypothetical protein SCHCODRAFT_81011 [Schizophyllum commune 
H4-8]
Length=498

 Score =   251 bits (640),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 150/197 (76%), Gaps = 17/197 (9%)
 Frame = +1

Query  58   MAMLIAARRVTCGST--RSISSESLRYTVCWRYFSTSF------REERDTFGPIQVPSDK  213
            M+ L  +RR+ C +   R++ S+        R FST+F      R ERDTFG +QVPSD+
Sbjct  1    MSTLHLSRRILCRAPIRRAVPSQ--------RLFSTTFMAAQQHRIERDTFGELQVPSDR  52

Query  214  LWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQE  393
             WGAQTQRSLQNF+IGG  ER+P P+I+AFG+LKK AA VNM YG++P +GKA+ QAA +
Sbjct  53   YWGAQTQRSLQNFDIGGPTERLPPPLIKAFGVLKKAAATVNMTYGMDPKLGKAIQQAADD  112

Query  394  VAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQS  570
            V  GKL DHFPLV++QTGSGTQSNMNANEVI+NRA EILG + G +K VHPNDHVN SQS
Sbjct  113  VISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGELGSKKPVHPNDHVNMSQS  172

Query  571  SNDTFPTVMHIAAAMEI  621
            SNDTFPTVMHIAA  EI
Sbjct  173  SNDTFPTVMHIAAVTEI  189



>emb|CDS07604.1| Putative Fumarase [Absidia idahoensis var. thermophila]
Length=492

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 136/166 (82%), Gaps = 7/166 (4%)
 Frame = +1

Query  145  RYFSTSF------REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  306
            R FSTSF      R ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG RERMPEP+I+AFG
Sbjct  20   RVFSTSFTAMQKFRSERDTFGDLQVPADRYWGAQTQRSLQNFDIGGPRERMPEPLIQAFG  79

Query  307  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            +LKK AA+VNM YGL+P +G+A+ +AA EV +G L DHFPLV+WQTGSGTQSNMN NEVI
Sbjct  80   VLKKAAAQVNMTYGLDPKVGEAIQKAADEVIDGTLLDHFPLVVWQTGSGTQSNMNVNEVI  139

Query  487  ANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            +NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA  EI
Sbjct  140  SNRAIELLGGELGSKNPVHPNDHVNMSQSSNDTFPTAMHVAAVTEI  185



>emb|CDH55360.1| fumarate hydratase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=492

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 136/166 (82%), Gaps = 7/166 (4%)
 Frame = +1

Query  145  RYFSTSF------REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  306
            R FSTSF      R ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG RERMPEP+I+AFG
Sbjct  20   RAFSTSFIAMQKFRSERDTFGDLQVPADRYWGAQTQRSLQNFDIGGPRERMPEPLIQAFG  79

Query  307  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            +LKK AA+VNM YGL+P +G+A+ +AA EV +G L DHFPLV+WQTGSGTQSNMN NEVI
Sbjct  80   VLKKAAAQVNMTYGLDPKVGEAIQKAADEVIDGTLLDHFPLVVWQTGSGTQSNMNVNEVI  139

Query  487  ANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            +NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA  EI
Sbjct  140  SNRAIELLGGELGSKNPVHPNDHVNMSQSSNDTFPTAMHVAAVTEI  185



>ref|XP_005850869.1| hypothetical protein CHLNCDRAFT_34079 [Chlorella variabilis]
 gb|EFN58767.1| hypothetical protein CHLNCDRAFT_34079 [Chlorella variabilis]
Length=490

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 145/185 (78%), Gaps = 4/185 (2%)
 Frame = +1

Query  79   RRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEI  258
            R+ T   +  +S   +      R   T  R E DTFGP++VP DKLWGAQTQRS+QNF+I
Sbjct  3    RKTTQSLSSKLSGGQVALPALVRAMGT--RTEYDTFGPLEVPEDKLWGAQTQRSIQNFKI  60

Query  259  GGDRERMPEPIIRAFGILKKCAAKVNMEYG-LEPSIGKAVMQAAQEVAEGKLNDHFPLVI  435
            GG  ERMPEP++RAFG+LK  AAKVNM+ G L+P IG AV+QAAQEVAEGKL+D+FPLV+
Sbjct  61   GGPTERMPEPVVRAFGVLKGAAAKVNMDLGVLDPKIGNAVVQAAQEVAEGKLSDNFPLVV  120

Query  436  WQTGSGTQSNMNANEVIANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAA  612
            WQTGSGTQSNMNANEVIANRA ++LG   G+KG VHPNDHVN+ QSSNDTFPTVM+IA  
Sbjct  121  WQTGSGTQSNMNANEVIANRAIQLLGGSLGDKGVVHPNDHVNKGQSSNDTFPTVMYIAGV  180

Query  613  MEINK  627
             EI++
Sbjct  181  TEIHE  185



>ref|XP_006958376.1| fumarate hydratase [Wallemia sebi CBS 633.66]
 gb|EIM21689.1| fumarate hydratase [Wallemia sebi CBS 633.66]
Length=470

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  157  TSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVN  336
            + FREE+DTFGP++VP D+ WGAQTQRSLQNFEIGG++ RMP P+ RAFG+LKK AA VN
Sbjct  7    SEFREEKDTFGPLRVPLDRYWGAQTQRSLQNFEIGGEQARMPVPLTRAFGVLKKAAAAVN  66

Query  337  MEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGH  516
            M YGL+  IGKA+M+AA EVA GKL+ HFPLV++QTGSGTQ+NMN+NEVI+NRA EILG 
Sbjct  67   MTYGLDERIGKAIMEAADEVATGKLDSHFPLVVFQTGSGTQTNMNSNEVISNRAIEILGG  126

Query  517  KRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            K G K  VHPNDHVN SQSSNDTFPT MH+AA +E+N
Sbjct  127  KLGSKDPVHPNDHVNMSQSSNDTFPTAMHVAAVLELN  163



>emb|CCG81126.1| Fumarate hydratase, mitochondrial [Taphrina deformans PYCC 5710]
Length=469

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            S+REE DTFGP++V SD+ WGAQTQRSL NF+IGGD ER+P P+I+AFGILKK AA VNM
Sbjct  6    SYREEADTFGPLKVASDRYWGAQTQRSLMNFDIGGDTERLPPPLIKAFGILKKAAATVNM  65

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            EYGL+P +GKA+ +AA EV  GKL  HFPLV++QTGSGTQSNMNANEVI+NRA EILG +
Sbjct  66   EYGLDPKVGKAIQEAADEVISGKLLSHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGE  125

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
             G +K VHPNDHVN SQSSNDTFPT MHIAA MEI
Sbjct  126  LGSKKPVHPNDHVNMSQSSNDTFPTAMHIAAVMEI  160



>emb|CCA67859.1| probable FUM1-fumarate hydratase [Piriformospora indica DSM 11827]
Length=500

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 148/195 (76%), Gaps = 5/195 (3%)
 Frame = +1

Query  43   IRETQMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWG  222
            +R +  ++ +A   V    T + +  + R T+     +  FR+ERDTFG +QVP+D+ WG
Sbjct  2    LRTSARSLQLARHHVAASRTVTRTFATTRITMS----NQKFRQERDTFGDLQVPADRYWG  57

Query  223  AQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAE  402
            AQTQRSL NF+IGG  ER+P P+I+AFG+LKK AA VNM YGL+P IG A+ QAA EV E
Sbjct  58   AQTQRSLMNFDIGGPSERLPPPLIKAFGVLKKAAAHVNMTYGLDPKIGNAISQAATEVIE  117

Query  403  GKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSND  579
            GKL DHFPLV++QTGSGTQSNMNANEVI+NRA EILG + G +K VHPNDHVN SQSSND
Sbjct  118  GKLTDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGELGSKKPVHPNDHVNMSQSSND  177

Query  580  TFPTVMHIAAAMEIN  624
            TFPTVMHIAA  EI+
Sbjct  178  TFPTVMHIAAVSEIH  192



>ref|XP_001753417.1| predicted protein [Physcomitrella patens]
 gb|EDQ81640.1| predicted protein [Physcomitrella patens]
Length=470

 Score =   247 bits (631),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  157  TSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVN  336
            T   EERDTFGPIQVP D+ WGAQTQRS+QNFEIG + ERMP+ ++ A GILKK AA VN
Sbjct  5    TKMAEERDTFGPIQVPDDRYWGAQTQRSVQNFEIGDESERMPKQLVEALGILKKAAAIVN  64

Query  337  MEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGH  516
            MEYGL+   G+A+++AA EVAEGKL DHFPLV+WQTGSGTQ+NMN+NEVIANRA EILG 
Sbjct  65   MEYGLDKKYGEAIVKAASEVAEGKLTDHFPLVVWQTGSGTQTNMNSNEVIANRAGEILGI  124

Query  517  KRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAME  618
              G KGVHPNDHVN SQSSNDTFPT MHIAAA E
Sbjct  125  PIGSKGVHPNDHVNMSQSSNDTFPTAMHIAAARE  158



>ref|XP_005650930.1| fumarate hydratase [Coccomyxa subellipsoidea C-169]
 gb|EIE26386.1| fumarate hydratase [Coccomyxa subellipsoidea C-169]
Length=489

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 138/164 (84%), Gaps = 4/164 (2%)
 Frame = +1

Query  136  VCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILK  315
            V  R+F+T  R+E DTFGP+ VP+D+ WGAQTQRSLQNF+IGG  ERMPEP++ AFG+LK
Sbjct  20   VTVRFFAT--RQESDTFGPLDVPADRYWGAQTQRSLQNFKIGGRAERMPEPVVCAFGVLK  77

Query  316  KCAAKVNMEYG-LEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIAN  492
            + AAKVNME G L+   GKA+MQAA EVAEGKL +HFPLV+WQTGSGTQSNMNANEVIAN
Sbjct  78   RAAAKVNMESGYLDEKRGKAIMQAAGEVAEGKLLEHFPLVVWQTGSGTQSNMNANEVIAN  137

Query  493  RAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            RA EILG + G+K  VHPNDHVN+ QSSNDTFPTVMHIAA  EI
Sbjct  138  RAVEILGGELGDKSVVHPNDHVNKGQSSNDTFPTVMHIAAIQEI  181



>gb|EPZ35407.1| Fumarate hydratase, mitochondrial [Rozella allomycis CSF55]
Length=468

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 136/156 (87%), Gaps = 1/156 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR ERDTFG IQVPSDK WGAQTQRSLQNF+IGG  ERMPE +IRAFGI+KK AA VNM
Sbjct  15   TFRIERDTFGEIQVPSDKYWGAQTQRSLQNFDIGGPNERMPEELIRAFGIVKKAAAIVNM  74

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
             +GL  SIGK++++A++EV +GKL DHFPLV+WQTGSGTQSNMNANEVI+NRA EILG +
Sbjct  75   NHGLNESIGKSIIEASEEVYQGKLMDHFPLVVWQTGSGTQSNMNANEVISNRAIEILGGE  134

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
             G +K VHPNDHVNRSQSSNDTFPTVMH+A A+ ++
Sbjct  135  LGSKKPVHPNDHVNRSQSSNDTFPTVMHVAGALSLH  170



>gb|EIE78369.1| fumarate hydratase [Rhizopus delemar RA 99-880]
Length=479

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 136/167 (81%), Gaps = 7/167 (4%)
 Frame = +1

Query  145  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  306
            R FS++      FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ERMPEP+IRAFG
Sbjct  6    RLFSSASAALQKFRAERDTFGDLQVPADRYWGAQTQRSLQNFDIGGPTERMPEPLIRAFG  65

Query  307  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            +LKK AA VNM YGL+P +G+A+ +AA EV +G L DHFPLV+WQTGSGTQ+NMN NEVI
Sbjct  66   VLKKAAATVNMTYGLDPKVGEAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTNMNVNEVI  125

Query  487  ANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            +NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA +EI+
Sbjct  126  SNRAIELLGGELGSKAPVHPNDHVNMSQSSNDTFPTAMHVAAVVEIH  172



>pir||JC4293 fumarate hydratase (EC 4.2.1.2) precursor - Rhizopus oryzae
 gb|ADG65260.1| fumarase [Rhizopus oryzae]
Length=494

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 136/167 (81%), Gaps = 7/167 (4%)
 Frame = +1

Query  145  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  306
            R FS++      FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ERMPEP+IRAFG
Sbjct  21   RLFSSASAALQKFRAERDTFGDLQVPADRYWGAQTQRSLQNFDIGGPTERMPEPLIRAFG  80

Query  307  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            +LKK AA VNM YGL+P +G+A+ +AA EV +G L DHFPLV+WQTGSGTQ+NMN NEVI
Sbjct  81   VLKKAAATVNMTYGLDPKVGEAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTNMNVNEVI  140

Query  487  ANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            +NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA +EI+
Sbjct  141  SNRAIELLGGELGSKAPVHPNDHVNMSQSSNDTFPTAMHVAAVVEIH  187



>emb|CEP15950.1| hypothetical protein [Parasitella parasitica]
Length=494

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 134/166 (81%), Gaps = 7/166 (4%)
 Frame = +1

Query  145  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  306
            R FS++      FR ERDTFG +QVP+DK WGAQTQRSLQNF+IGG  ERMPEP+IRAFG
Sbjct  21   RLFSSASIALQKFRAERDTFGDLQVPADKYWGAQTQRSLQNFDIGGKNERMPEPLIRAFG  80

Query  307  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            +LKK AA VNM YG++P +G A+ +AA EV +G L DHFPLV+WQTGSGTQ+NMN NEVI
Sbjct  81   VLKKAAATVNMTYGMDPKVGDAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTNMNVNEVI  140

Query  487  ANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            +NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA +EI
Sbjct  141  SNRAIELLGGELGSKTPVHPNDHVNMSQSSNDTFPTAMHVAAVVEI  186



>ref|XP_007861040.1| fumarate hydratase [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ60690.1| fumarate hydratase [Gloeophyllum trabeum ATCC 11539]
Length=498

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = +1

Query  58   MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  237
            MA +  +RR+     RS     L  +  +R  S S+R ERDTFG +QVP+D+ WGAQTQR
Sbjct  1    MAGIRLSRRLHLAHPRSALYPRLFSSSAFRMSSQSYRVERDTFGELQVPADRYWGAQTQR  60

Query  238  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  417
            SLQNF+IGG  ER+P P+I+AFG+LKK A+ VN+ YG++P IG+A+ QAA EV  GKL D
Sbjct  61   SLQNFDIGGPTERLPPPLIKAFGVLKKAASVVNVSYGMDPKIGQAIQQAADEVISGKLLD  120

Query  418  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTV  594
            HFPLV++QTGSGTQSNMN NEVI+NRA EILG + G +K VHPNDHVN SQSSNDTFPT 
Sbjct  121  HFPLVVFQTGSGTQSNMNVNEVISNRAIEILGGELGSKKPVHPNDHVNMSQSSNDTFPTA  180

Query  595  MHIAAAMEI  621
            MH+AA +EI
Sbjct  181  MHVAAVVEI  189



>emb|CEG73219.1| Putative AaceriACR013Cp [Rhizopus microsporus]
Length=494

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 135/166 (81%), Gaps = 7/166 (4%)
 Frame = +1

Query  145  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  306
            R FS++      FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ERMPEP+IRAFG
Sbjct  21   RLFSSASAVLQKFRTERDTFGDLQVPADRYWGAQTQRSLQNFDIGGPGERMPEPLIRAFG  80

Query  307  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            +LKK AA VNM YGL+P IG+A+ +AA EV +G L DHFPLV+WQTGSGTQ+NMN NEVI
Sbjct  81   VLKKAAATVNMTYGLDPKIGEAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTNMNVNEVI  140

Query  487  ANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            +NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA +EI
Sbjct  141  SNRAIELLGGELGTKTPVHPNDHVNMSQSSNDTFPTAMHVAAVVEI  186



>ref|XP_009701525.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Cariama 
cristata]
Length=265

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  13   AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  72

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  73   DYGLDPKIANAIIKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  132

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  133  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  169



>gb|KFP59440.1| hypothetical protein N322_00331, partial [Cariama cristata]
Length=258

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIIKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  125  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  161



>ref|XP_008369102.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Malus domestica]
Length=143

 Score =   235 bits (600),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 3/143 (2%)
 Frame = +1

Query  55   QMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            QMAM I +RR   G    +++   RY    R +STSFREERDTFGPI VPSDKLWGAQTQ
Sbjct  2    QMAMYIVSRRA-AGELTPLAA--FRYATSSRAYSTSFREERDTFGPINVPSDKLWGAQTQ  58

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSLQNF+IGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN
Sbjct  59   RSLQNFDIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLN  118

Query  415  DHFPLVIWQTGSGTQSNMNANEV  483
             HFPLVIWQTGSGTQSNMN NEV
Sbjct  119  QHFPLVIWQTGSGTQSNMNVNEV  141



>ref|XP_008333578.1| PREDICTED: fumarate hydratase, mitochondrial [Cynoglossus semilaevis]
Length=499

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 151/210 (72%), Gaps = 19/210 (9%)
 Frame = +1

Query  1    RSVRLLSGFGCGSSIRETQMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERD  180
            RS+RL+  F C           L+ ++R T  S   +S+         R  ST +R ERD
Sbjct  3    RSLRLVQQFNC----------TLLTSQRFTLNSKVLLSTS--------RMASTEYRIERD  44

Query  181  TFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPS  360
            TFG ++VP+DK +GAQT RS  NF+IGG  ERMP  +I+AFGILKK AA+VN +YGL PS
Sbjct  45   TFGELKVPADKYYGAQTVRSTMNFKIGGPSERMPIQVIKAFGILKKAAAEVNKDYGLSPS  104

Query  361  IGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKG-V  537
            I  A++QAA EV+ GKL+DHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG K G K  V
Sbjct  105  IADAIIQAADEVSAGKLDDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGKLGSKDPV  164

Query  538  HPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            HPNDHVN+SQSSNDTFPT MHIAAA E+++
Sbjct  165  HPNDHVNKSQSSNDTFPTAMHIAAATEVHQ  194



>ref|XP_009489604.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Pelecanus 
crispus]
Length=257

 Score =   238 bits (608),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = +1

Query  163  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  342
            FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN +
Sbjct  6    FRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQD  65

Query  343  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  522
            YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K 
Sbjct  66   YGLDPKIANAIVKAATEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGKL  125

Query  523  GEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  126  GSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  161



>gb|KFQ55579.1| hypothetical protein N334_00310, partial [Pelecanus crispus]
Length=259

 Score =   238 bits (608),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = +1

Query  163  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  342
            FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN +
Sbjct  7    FRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQD  66

Query  343  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  522
            YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K 
Sbjct  67   YGLDPKIANAIVKAATEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGKL  126

Query  523  GEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  127  GSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  162



>gb|KIK60394.1| hypothetical protein GYMLUDRAFT_244393 [Gymnopus luxurians FD-317 
M1]
Length=484

 Score =   245 bits (625),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = +1

Query  163  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  342
            FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ER+P P+I+AFG+LKK A+ VN+ 
Sbjct  7    FRIERDTFGELQVPADRYWGAQTQRSLQNFDIGGPTERLPPPLIKAFGLLKKAASIVNVG  66

Query  343  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  522
            YGL+P IG+A+ QAA +V  GKLNDHFPLV++QTGSGTQSNMNANEVI+NRA EILG + 
Sbjct  67   YGLDPKIGQAIQQAADDVISGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGEL  126

Query  523  G-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            G +K VHPND VNRSQSSNDTFPT MH+AA MEIN+
Sbjct  127  GSKKPVHPNDDVNRSQSSNDTFPTAMHVAAVMEINQ  162



>ref|XP_008595655.1| fumarate hydratase [Beauveria bassiana ARSEF 2860]
 gb|EJP68334.1| fumarate hydratase [Beauveria bassiana ARSEF 2860]
Length=532

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 152/217 (70%), Gaps = 17/217 (8%)
 Frame = +1

Query  10   RLLSGFGCGSSIRETQMAMLIAARRVTC----------GSTRSISSESLR--YTVCWRYF  153
            R L+  G  SS   +++A   AA   TC           S  S+SS   R   T   R  
Sbjct  7    RRLAATGLASSRSYSRLAA--AATAPTCRPAAIVPPQLASNHSLSSLQQRGFRTTTLRMA  64

Query  154  STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKV  333
            ST  R E D FG IQVPSDK WGAQT+RSL+NF I   ++RMP PII+AFGILK  AA V
Sbjct  65   ST--RSESDAFGEIQVPSDKYWGAQTERSLENFRINQPQDRMPPPIIKAFGILKGAAATV  122

Query  334  NMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  513
            NM YGL+P IG+A+ QAA+EVA+GKL DHFPLV+WQTGSGTQSNMNANEVI+NRA EILG
Sbjct  123  NMRYGLDPKIGQAIQQAAKEVADGKLMDHFPLVVWQTGSGTQSNMNANEVISNRAIEILG  182

Query  514  HKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
             K G K  VHPNDHVNRS SSNDTFPTVMHIAA +++
Sbjct  183  GKMGSKSPVHPNDHVNRSASSNDTFPTVMHIAAVLDL  219



>gb|ACY91850.1| fumarase [Rhizopus oryzae]
Length=479

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 135/167 (81%), Gaps = 7/167 (4%)
 Frame = +1

Query  145  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  306
            R FS++      FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ERMPEP+IRAFG
Sbjct  6    RLFSSASAALQKFRAERDTFGDLQVPADRYWGAQTQRSLQNFDIGGPTERMPEPLIRAFG  65

Query  307  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            +LKK AA VNM YGL+P +G+A+ +AA EV +G L DHFPLV+WQTGSGTQ+ MN NEVI
Sbjct  66   VLKKAAATVNMTYGLDPKVGEAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTKMNVNEVI  125

Query  487  ANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            +NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA +EI+
Sbjct  126  SNRAIELLGGELGSKAPVHPNDHVNMSQSSNDTFPTAMHVAAVVEIH  172



>sp|P55250.1|FUMH_RHIOR RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
Flags: Precursor [Rhizopus oryzae]
 emb|CAA55314.1| fumarase [Rhizopus oryzae]
Length=494

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 135/167 (81%), Gaps = 7/167 (4%)
 Frame = +1

Query  145  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  306
            R FS++      FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ERMPEP+IRAFG
Sbjct  21   RLFSSASAALQKFRAERDTFGDLQVPADRYWGAQTQRSLQNFDIGGPTERMPEPLIRAFG  80

Query  307  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            +LKK AA VNM YGL+P +G+A+ +AA EV +G L DHFPLV+WQTGSGTQ+ MN NEVI
Sbjct  81   VLKKAAATVNMTYGLDPKVGEAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTKMNVNEVI  140

Query  487  ANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            +NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA +EI+
Sbjct  141  SNRAIELLGGELGSKAPVHPNDHVNMSQSSNDTFPTAMHVAAVVEIH  187



>ref|XP_008635756.1| PREDICTED: fumarate hydratase, mitochondrial [Corvus brachyrhynchos]
Length=492

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 145/186 (78%), Gaps = 4/186 (2%)
 Frame = +1

Query  82   RVTCGSTRSISSESLRYTVCWRYFSTS---FREERDTFGPIQVPSDKLWGAQTQRSLQNF  252
            R+    TR +  + L  T+   ++++S   FR E DTFG ++VPSDK +GAQT RS  NF
Sbjct  2    RLHAVGTRGLQPQGLPVTMGQLWYTSSQEAFRIEYDTFGELKVPSDKYYGAQTVRSTMNF  61

Query  253  EIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLV  432
            +IGG  ERMP  +IRAFGILK+ AA+VN +YGL+P I KA++QAA EVAEGKLNDHFPLV
Sbjct  62   KIGGVSERMPVQVIRAFGILKRAAAEVNQDYGLDPKIAKAIVQAANEVAEGKLNDHFPLV  121

Query  433  IWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAA  609
            +WQTGSGTQ+NMN NEVI+NRA EI+G   G +K VHPNDHVN+SQSSNDTFPT MHIAA
Sbjct  122  VWQTGSGTQTNMNVNEVISNRAIEIMGGTLGSKKPVHPNDHVNKSQSSNDTFPTAMHIAA  181

Query  610  AMEINK  627
            A E+N+
Sbjct  182  AQEVNE  187



>gb|KGQ09969.1| Fumarate hydratase [Beauveria bassiana D1-5]
Length=532

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 151/217 (70%), Gaps = 17/217 (8%)
 Frame = +1

Query  10   RLLSGFGCGSSIRETQMAMLIAARRVTC----------GSTRSISSESLR--YTVCWRYF  153
            R L+  G  SS   +++A   AA   TC           S  S+SS   R   T   R  
Sbjct  7    RRLAATGLASSRSYSRLAA--AATAPTCRPAAIVPPQLASNHSLSSLQQRGFRTTTLRMA  64

Query  154  STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKV  333
            ST  R E D FG IQVPSDK WGAQT+RSL+NF I    +RMP PII+AFGILK  AA V
Sbjct  65   ST--RSESDAFGEIQVPSDKYWGAQTERSLENFRINQPHDRMPPPIIKAFGILKGAAATV  122

Query  334  NMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  513
            NM YGL+P IG+A+ QAA+EVA+GKL DHFPLV+WQTGSGTQSNMNANEVI+NRA EILG
Sbjct  123  NMRYGLDPKIGQAIQQAAKEVADGKLMDHFPLVVWQTGSGTQSNMNANEVISNRAIEILG  182

Query  514  HKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
             K G K  VHPNDHVNRS SSNDTFPTVMHIAA +++
Sbjct  183  GKMGSKSPVHPNDHVNRSASSNDTFPTVMHIAAVLDL  219



>emb|CDH51516.1| fumarate hydratase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=466

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  166  REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEY  345
            R ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ERMP P+I+AFGILKK AA VNM Y
Sbjct  7    RVERDTFGELQVPADRYWGAQTQRSLQNFDIGGPGERMPAPLIQAFGILKKAAATVNMTY  66

Query  346  GLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG  525
            GL+P IG+A+ +AA EV  GKL DHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG + G
Sbjct  67   GLDPKIGEAIQKAADEVINGKLMDHFPLVVWQTGSGTQTNMNVNEVISNRAIELLGGELG  126

Query  526  EKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
             K  VHPNDHVN SQSSNDTFPT MHIAAAMEI
Sbjct  127  SKNPVHPNDHVNMSQSSNDTFPTAMHIAAAMEI  159



>dbj|GAN02812.1| fumarate hydratase [Mucor ambiguus]
Length=494

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 136/166 (82%), Gaps = 7/166 (4%)
 Frame = +1

Query  145  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  306
            R FS++      FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG+ ERMPEP+IRAFG
Sbjct  21   RLFSSASIALQKFRAERDTFGDLQVPADRYWGAQTQRSLQNFDIGGEHERMPEPLIRAFG  80

Query  307  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            +LKK AA VNM YG++ ++G+A+ +AA EV +G L DHFPLV+WQTGSGTQ+NMN NEVI
Sbjct  81   VLKKAAATVNMTYGMDTTVGEAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTNMNVNEVI  140

Query  487  ANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            +NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA +EI
Sbjct  141  SNRAIELLGGELGSKTPVHPNDHVNMSQSSNDTFPTAMHVAAVVEI  186



>ref|XP_008530562.1| PREDICTED: fumarate hydratase, mitochondrial [Equus przewalskii]
Length=233

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  35   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  94

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLN+HFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  95   DYGLDPKIANAIMKAADEVAEGKLNEHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  154

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  155  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHE  191



>ref|XP_008847403.1| PREDICTED: fumarate hydratase, mitochondrial [Nannospalax galili]
Length=508

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRVEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGPTERMPIPVIKAFGILKRAAAEVNQ  106

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  107  DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  166

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAAME+N+
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAMEVNE  203



>ref|XP_006998748.1| PREDICTED: fumarate hydratase, mitochondrial-like, partial [Peromyscus 
maniculatus bairdii]
Length=366

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  105

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHE  202



>gb|KIK06867.1| hypothetical protein K443DRAFT_129452 [Laccaria amethystina LaAM-08-1]
Length=489

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 142/183 (78%), Gaps = 5/183 (3%)
 Frame = +1

Query  82   RVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIG  261
            R+T  S +++ +   RY+         FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IG
Sbjct  5    RITAASPKALCTR--RYSALMS--QQKFRVERDTFGELQVPADRYWGAQTQRSLQNFDIG  60

Query  262  GDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQ  441
            G  ER+P P+I+AFG+LKK A+ VN+ YGL+P IG A+ +AA +V  GKL DHFPLV++Q
Sbjct  61   GPTERLPPPLIKAFGVLKKAASIVNIGYGLDPQIGDAIQKAADDVISGKLIDHFPLVVFQ  120

Query  442  TGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAME  618
            TGSGTQSNMNANEVI+NRA EILG   G +K VHPNDHVN SQSSNDTFPTVMHIAA  E
Sbjct  121  TGSGTQSNMNANEVISNRAIEILGGNLGSKKPVHPNDHVNMSQSSNDTFPTVMHIAAVTE  180

Query  619  INK  627
            IN+
Sbjct  181  INR  183



>ref|XP_003008083.1| fumarate hydratase [Verticillium alfalfae VaMs.102]
 gb|EEY16162.1| fumarate hydratase [Verticillium alfalfae VaMs.102]
Length=375

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 143/185 (77%), Gaps = 5/185 (3%)
 Frame = +1

Query  73   AARRVTCGSTRS--ISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQ  246
            A  R    ++RS   ++ +L  T+     S+S R E D FG +QVP+D+ WGAQT+RSL+
Sbjct  14   ALARAAANTSRSQVCTTRTLHTTIA--RMSSSTRTETDAFGALQVPADRYWGAQTERSLE  71

Query  247  NFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFP  426
            NF+I   ++RMP PII+AFGILK  AA VNM YGL+ +IGKA+ QAA EVAEGKL DHFP
Sbjct  72   NFKINQPQDRMPPPIIKAFGILKGAAATVNMRYGLDETIGKAIQQAAAEVAEGKLLDHFP  131

Query  427  LVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHI  603
            LV+WQTGSGTQSNMNANEVI+NRA EILG + G +K VHPNDHVNRS SSNDTFPTVMHI
Sbjct  132  LVVWQTGSGTQSNMNANEVISNRAIEILGGEMGSKKPVHPNDHVNRSASSNDTFPTVMHI  191

Query  604  AAAME  618
            AA +E
Sbjct  192  AAVLE  196



>gb|KFH63115.1| fumarate hydratase, mitochondrial [Mortierella verticillata NRRL 
6337]
Length=497

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = +1

Query  130  YTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGI  309
            ++     ++  FR+E DTFG ++VP+D+ WGAQTQRSLQNF+IGG  ERMPEP+I+AFG+
Sbjct  22   FSAAPSVWAQKFRQEADTFGNLEVPADRYWGAQTQRSLQNFDIGGATERMPEPLIKAFGV  81

Query  310  LKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIA  489
            LK+ AA VNM YGL+ ++G A+++A+ EV EGKL DHFPLV+WQTGSGTQ+NMN NEVI+
Sbjct  82   LKRAAATVNMTYGLDQTVGDAIVKASNEVIEGKLLDHFPLVVWQTGSGTQTNMNVNEVIS  141

Query  490  NRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            NRA E+LG + G +K VHPNDHVN SQSSNDTFPT MH+AAA+EIN+
Sbjct  142  NRAIELLGGELGSKKPVHPNDHVNMSQSSNDTFPTAMHVAAAIEINQ  188



>emb|CDS05044.1| Putative Fumarate hydratase, mitochondrial [Absidia idahoensis 
var. thermophila]
Length=466

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  166  REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEY  345
            R ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ERMP P+I+AFGILKK AA VNM Y
Sbjct  7    RVERDTFGELQVPTDRYWGAQTQRSLQNFDIGGAGERMPAPLIQAFGILKKAAATVNMTY  66

Query  346  GLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG  525
            GL+P IG+A+ +AA EV  GKL DHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG + G
Sbjct  67   GLDPKIGEAIQKAADEVISGKLLDHFPLVVWQTGSGTQTNMNVNEVISNRAIELLGGELG  126

Query  526  EKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
             K  VHPNDHVN SQSSNDTFPT MHIAA MEI
Sbjct  127  SKNPVHPNDHVNMSQSSNDTFPTAMHIAAVMEI  159



>ref|XP_001442829.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK75432.1| unnamed protein product [Paramecium tetraurelia]
Length=484

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 135/173 (78%), Gaps = 1/173 (1%)
 Frame = +1

Query  109  ISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEP  288
            +S +S  +  C   F  SFREE DTFGPI+V SD+LWGAQTQRS+QNF+I  D ++MP P
Sbjct  2    LSRKSFLFNPCLYRFC-SFREEYDTFGPIKVKSDRLWGAQTQRSIQNFDICRDTDKMPLP  60

Query  289  IIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNM  468
            +I+AFGILKK AA VN  Y L+P I  A+ +AA EV  GKLNDHFPLV+WQTGSGTQSNM
Sbjct  61   VIKAFGILKKSAAIVNKRYALKPEISDAIAKAADEVIAGKLNDHFPLVVWQTGSGTQSNM  120

Query  469  NANEVIANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            NANEVIANRA +ILG + G K VHPNDHVN SQSSNDTFPT MHIA  ++ N+
Sbjct  121  NANEVIANRAIQILGGQIGGKLVHPNDHVNMSQSSNDTFPTAMHIATVIQTNQ  173



>ref|XP_009087608.1| PREDICTED: fumarate hydratase, mitochondrial [Serinus canaria]
Length=485

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 143/188 (76%), Gaps = 13/188 (7%)
 Frame = +1

Query  67   LIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQ  246
            L A RR+ C +   +SS+             +FR E DTFG ++VPSDK +GAQT RS  
Sbjct  5    LRACRRLGCSAGLLLSSQE------------AFRIEYDTFGELKVPSDKYYGAQTVRSTM  52

Query  247  NFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFP  426
            NF+IGG  ERMP  +IRAFGILK+ AA+VN +YGL+P I KA++QAA EVAEGKLNDHFP
Sbjct  53   NFKIGGVSERMPVQVIRAFGILKRAAAEVNQDYGLDPKIAKAIVQAANEVAEGKLNDHFP  112

Query  427  LVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHI  603
            LV+WQTGSGTQ+NMN NEVI+NRA EI+G   G +K VHPNDHVN+SQSSNDTFPT MHI
Sbjct  113  LVVWQTGSGTQTNMNVNEVISNRAIEIMGGTLGSKKPVHPNDHVNKSQSSNDTFPTAMHI  172

Query  604  AAAMEINK  627
            AAA E+N+
Sbjct  173  AAAQEVNE  180



>gb|ESA01861.1| hypothetical protein GLOINDRAFT_337726 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX65785.1| fumarase FUM1 [Rhizophagus irregularis DAOM 197198w]
Length=467

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = +1

Query  163  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  342
            +R ERDTFG I+VP+D+ WGAQTQRSL+NF+IGG  ERMPEP+I+AFGI+K+ AA VN  
Sbjct  7    YRIERDTFGDIEVPADRYWGAQTQRSLKNFDIGGPTERMPEPLIKAFGIIKRAAATVNAT  66

Query  343  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  522
            YGL+  IG+A+++AA EV++G L DHFPLV+WQTGSGTQ+NMNANEVIANRA EILG + 
Sbjct  67   YGLDQKIGEAIVKAANEVSKGDLLDHFPLVVWQTGSGTQTNMNANEVIANRAIEILGGQL  126

Query  523  GEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            G K  VHPNDHVN SQSSNDTFPT MH++AA+EIN+
Sbjct  127  GSKSPVHPNDHVNMSQSSNDTFPTAMHVSAAIEINE  162



>ref|XP_004450319.1| PREDICTED: fumarate hydratase, mitochondrial isoform 1 [Dasypus 
novemcinctus]
Length=508

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGAAERMPIPVIKAFGILKRAAAEVNQ  106

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  107  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  166

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAAME+++
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAMEVHE  203



>gb|KFX93722.1| hypothetical protein V490_04713, partial [Pseudogymnoascus pannorum 
VKM F-3557]
Length=289

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = +1

Query  103  RSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMP  282
            RSI S    +T   R  + + R E D FG + VP+DK WGAQT+RSL+NF+I   ++RMP
Sbjct  56   RSIPSLHRYFTSTTRAMAET-RAETDAFGEVHVPADKYWGAQTERSLENFKINQPQDRMP  114

Query  283  EPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQS  462
             PI+RAFGILK  AA VNM++GL+P+IGKA+ QAA EVA+ KL DHFPLV+WQTGSGTQS
Sbjct  115  PPIVRAFGILKGAAATVNMQFGLDPTIGKAIQQAAAEVADLKLLDHFPLVVWQTGSGTQS  174

Query  463  NMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            NMNANEVI+NRA EILG   G +K VHPNDHVN S SSNDTFPTVMHIAA +E+ +
Sbjct  175  NMNANEVISNRAIEILGGTMGSKKPVHPNDHVNMSASSNDTFPTVMHIAAVLELEE  230



>ref|XP_001873245.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR15037.1| predicted protein [Laccaria bicolor S238N-H82]
Length=489

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 142/183 (78%), Gaps = 5/183 (3%)
 Frame = +1

Query  82   RVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIG  261
            R+T  S +++ +   RYT         FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IG
Sbjct  5    RITAASPKALWTR--RYTALMS--QQKFRVERDTFGELQVPADRYWGAQTQRSLQNFDIG  60

Query  262  GDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQ  441
            G  ER+P P+I+AFG+LKK A+ VN+ YGL+P IG+A+ +AA +V  GKL DHFPLV++Q
Sbjct  61   GPTERLPPPLIKAFGVLKKAASIVNVGYGLDPQIGEAIQKAADDVISGKLIDHFPLVVFQ  120

Query  442  TGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAME  618
            TGSGTQSNMNANEVI+NRA EILG   G +K VHPNDHVN SQSSNDTFPT MHIAA  E
Sbjct  121  TGSGTQSNMNANEVISNRAIEILGGNLGSKKPVHPNDHVNMSQSSNDTFPTAMHIAAVTE  180

Query  619  INK  627
            IN+
Sbjct  181  INR  183



>ref|XP_011272281.1| fumarate hydratase [Wickerhamomyces ciferrii]
 emb|CCH45889.1| fumarate hydratase [Wickerhamomyces ciferrii]
Length=486

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 146/187 (78%), Gaps = 11/187 (6%)
 Frame = +1

Query  67   LIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQ  246
            +++AR +   S RSI + +++ +         FR E D FG +QVP+DK WGAQTQRSLQ
Sbjct  1    MLSARLLNT-SKRSIHTSTIKMS--------QFRTESDAFGELQVPNDKYWGAQTQRSLQ  51

Query  247  NFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYG-LEPSIGKAVMQAAQEVAEGKLNDHF  423
            NF+IGG+RE++PEP+I+AFG+LKK  A VN ++G L+P + +A+ QAA EVA GKL DHF
Sbjct  52   NFKIGGEREKLPEPLIKAFGVLKKSTAIVNEKFGTLKPELAQAIQQAADEVASGKLKDHF  111

Query  424  PLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMH  600
            PLV++QTGSGTQSNMNANEVI+NRA EILG K G K  VHPNDHVN+SQSSNDTFPTVMH
Sbjct  112  PLVVFQTGSGTQSNMNANEVISNRAIEILGGKLGSKTPVHPNDHVNQSQSSNDTFPTVMH  171

Query  601  IAAAMEI  621
            IAA  EI
Sbjct  172  IAAVQEI  178



>ref|XP_006102845.1| PREDICTED: fumarate hydratase, mitochondrial [Myotis lucifugus]
Length=510

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 140/174 (80%), Gaps = 2/174 (1%)
 Frame = +1

Query  112  SSESLRYTVCWRYFS-TSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEP  288
            +S   R  V  R  S  SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P
Sbjct  32   ASLPFRPPVAARMASQNSFRVEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIP  91

Query  289  IIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNM  468
            +I+AFGILK+ AA+VN +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NM
Sbjct  92   VIKAFGILKRAAAEVNQDYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNM  151

Query  469  NANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            N NEVI+NRA E+LG + G +K VHPNDHVN+SQSSNDTFPT MHIAAAME+++
Sbjct  152  NVNEVISNRAIEMLGGELGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAMEVHE  205



>ref|NP_034339.2| fumarate hydratase, mitochondrial precursor [Mus musculus]
 sp|P97807.3|FUMH_MOUSE RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
AltName: Full=EF-3; Flags: Precursor [Mus musculus]
 dbj|BAE27597.1| unnamed protein product [Mus musculus]
 gb|EDL13210.1| fumarate hydratase 1 [Mus musculus]
Length=507

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRVEFDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIQAFGILKRAAAEVNQ  105

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            EYGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  EYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E++K
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHK  202



>gb|AAH06048.1| Fumarate hydratase 1 [Mus musculus]
Length=507

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRVEFDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIQAFGILKRAAAEVNQ  105

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            EYGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  EYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E++K
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHK  202



>ref|XP_009278489.1| PREDICTED: fumarate hydratase, mitochondrial [Aptenodytes forsteri]
Length=489

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 139/184 (76%), Gaps = 2/184 (1%)
 Frame = +1

Query  79   RRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEI  258
             R+ C S  S     LRYT        +FR E DTFG ++VPSDK +GAQT RS  NF+I
Sbjct  2    HRLLCRSALSERDWCLRYTTAGST-QEAFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKI  60

Query  259  GGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIW  438
            GG  ERMP  +IRAFGILK+ AA+VN +YGL+P I  A+++AA EV EGKLNDHFPLV+W
Sbjct  61   GGVSERMPVQVIRAFGILKRAAAEVNQDYGLDPKIANAIIKAANEVTEGKLNDHFPLVVW  120

Query  439  QTGSGTQSNMNANEVIANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAM  615
            QTGSGTQ+NMN NEVI+NRA EI+G K G K  VHPNDHVN+SQSSNDTFPT MHIAAA 
Sbjct  121  QTGSGTQTNMNVNEVISNRAIEIMGGKLGSKNPVHPNDHVNKSQSSNDTFPTAMHIAAAQ  180

Query  616  EINK  627
            E+N+
Sbjct  181  EVNE  184



>ref|XP_007807229.1| fumarate hydratase precursor [Metarhizium acridum CQMa 102]
 gb|EFY93106.1| fumarate hydratase precursor [Metarhizium acridum CQMa 102]
Length=547

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 144/190 (76%), Gaps = 11/190 (6%)
 Frame = +1

Query  55   QMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            Q+ + + +R  +C S  S +S   + T          R E D FG IQVP+DK WGAQT+
Sbjct  44   QLQVQLKSRIPSCRSIHSTASNMAQAT----------RTESDAFGEIQVPADKYWGAQTE  93

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSL+NF I   ++RMP PI++AFGILK  AA VNM YGL+P IG+A+ QAA+EVA+GKL 
Sbjct  94   RSLENFRINQPQDRMPPPIVKAFGILKGAAATVNMRYGLDPKIGQAIQQAAKEVADGKLM  153

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPT  591
            DHFPLV+WQTGSGTQSNMNANEVI+NRA EILG ++G +K VHPNDHVNRS SSNDTFPT
Sbjct  154  DHFPLVVWQTGSGTQSNMNANEVISNRAIEILGGEKGSKKPVHPNDHVNRSASSNDTFPT  213

Query  592  VMHIAAAMEI  621
            VMHIAA +E+
Sbjct  214  VMHIAAVLEL  223



>emb|CCO37210.1| fumarate hydratase, class II [Rhizoctonia solani AG-1 IB]
Length=243

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +1

Query  163  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  342
            FR E+DTFG +QVP+D  WGAQTQRSL NF+IGG  ER+P P+I+AFG+LKK AA+VN+ 
Sbjct  6    FRTEKDTFGELQVPADVYWGAQTQRSLMNFDIGGPAERLPHPLIKAFGVLKKAAAEVNVT  65

Query  343  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  522
            YGL+P IG+A+ QAA EV  GKL DHFPLV++QTGSGTQSNMN NEVI+NRA +ILG + 
Sbjct  66   YGLDPKIGQAISQAADEVISGKLVDHFPLVVFQTGSGTQSNMNTNEVISNRAIQILGGEL  125

Query  523  G-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            G +K VHPNDHVN SQSSND+FPT MHIAA  E+
Sbjct  126  GSKKPVHPNDHVNMSQSSNDSFPTAMHIAAVTEL  159



>ref|XP_005884158.1| PREDICTED: fumarate hydratase, mitochondrial [Myotis brandtii]
Length=473

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  12   SFRVEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  71

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  72   DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  131

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAAME+++
Sbjct  132  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAMEVHE  168



>ref|XP_747830.1| fumarate hydratase [Aspergillus fumigatus Af293]
 gb|EAL85792.1| fumarate hydratase, putative [Aspergillus fumigatus Af293]
 gb|EDP47735.1| fumarate hydratase, putative [Aspergillus fumigatus A1163]
Length=582

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 136/170 (80%), Gaps = 4/170 (2%)
 Frame = +1

Query  124  LRYTVCWRYF---STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPII  294
            LRY +C + F   +++ R E D FG IQVP+DK WGAQTQRSL NF+I   ++RMP P+I
Sbjct  103  LRYPLCSQDFVIAASATRTESDAFGEIQVPADKYWGAQTQRSLTNFDINQPQDRMPAPVI  162

Query  295  RAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNA  474
            +AFGILK  AA+VNM YGL+P IG+A+ QAA EVAEGKL DHFPLV+WQTGSGTQSNMNA
Sbjct  163  KAFGILKAAAAEVNMRYGLDPKIGEAIKQAATEVAEGKLMDHFPLVVWQTGSGTQSNMNA  222

Query  475  NEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            NEVI+NRA EILG   G +K VHPNDHVN S SSND+FPT MHIAA +E+
Sbjct  223  NEVISNRAIEILGGTMGTKKPVHPNDHVNMSASSNDSFPTAMHIAAVLEL  272



>ref|XP_011396762.1| Fumarate hydratase 2, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM23884.1| Fumarate hydratase 2, chloroplastic [Auxenochlorella protothecoides]
Length=465

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 134/158 (85%), Gaps = 2/158 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            S R ERDTFGP++VPSD+ WGAQTQRS+QNF+IGG  ERMPEP++RAFG+LK+ AA+VNM
Sbjct  2    STRTERDTFGPLEVPSDRYWGAQTQRSIQNFKIGGPAERMPEPVVRAFGVLKRAAARVNM  61

Query  340  EYG-LEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGH  516
            + G L+   G+A++ AA EVAEG+L DHFPLV+WQTGSGTQSNMNANEVIANRA EILG 
Sbjct  62   QMGVLDRRQGEAIVSAAGEVAEGRLTDHFPLVVWQTGSGTQSNMNANEVIANRAIEILGG  121

Query  517  KRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            + G+K  VHPNDHVN+ QSSNDTFPTVMHIA   EI +
Sbjct  122  ELGDKSLVHPNDHVNKGQSSNDTFPTVMHIAGVTEIER  159



>prf||1709138A fumarase
Length=507

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  105

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            EYGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  EYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAALEVHQ  202



>sp|P14408.1|FUMH_RAT RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
Flags: Precursor [Rattus norvegicus]
 gb|AAA41177.1| fumarase precursor (EC 4.2.1.2) [Rattus norvegicus]
Length=507

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  105

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            EYGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  EYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAALEVHQ  202



>ref|XP_010164262.1| PREDICTED: fumarate hydratase, mitochondrial-like, partial [Caprimulgus 
carolinensis]
Length=305

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  108  AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  167

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  168  DYGLDPKIANAIIKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  227

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  228  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  264



>gb|KIO08161.1| hypothetical protein M404DRAFT_14265 [Pisolithus tinctorius Marx 
270]
Length=492

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 141/181 (78%), Gaps = 6/181 (3%)
 Frame = +1

Query  100  TRSISSESLRYTVCWRYFSTS-----FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGG  264
            T S+    L +    R FS S     FR+ERDTFG IQVP+D+ WGAQTQRSLQNF+IGG
Sbjct  4    TTSLRLPRLLHVARQRRFSVSHSVMAFRQERDTFGDIQVPADRYWGAQTQRSLQNFDIGG  63

Query  265  DRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQT  444
              ER+P P+I+AFG+LKK A+ VN+ YGL+P IG+A+ +AA EV  GKL DHFPLV++QT
Sbjct  64   PAERLPAPLIKAFGVLKKAASIVNVSYGLDPKIGEAIQKAADEVISGKLIDHFPLVVFQT  123

Query  445  GSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            GSGTQSNMNANEVI+NRA E+LG + G +K VHPNDHVN SQSSND+FPT MH+AA  EI
Sbjct  124  GSGTQSNMNANEVISNRAIELLGGELGSKKPVHPNDHVNMSQSSNDSFPTAMHVAAVTEI  183

Query  622  N  624
            +
Sbjct  184  H  184



>gb|KFH43308.1| Fumarate hydratase-like protein [Acremonium chrysogenum ATCC 
11550]
Length=556

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = +1

Query  103  RSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMP  282
            RS+ S    ++      + + R E D FG I+VP DK WGAQTQRSL NF+I   ++RMP
Sbjct  70   RSVYSYRSFHSTSSVMAANAVRAESDAFGEIEVPGDKYWGAQTQRSLGNFDINQPQDRMP  129

Query  283  EPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQS  462
             PI++AFGILK  AA VNM YGL+P IGKA+ QAAQEVA+GKL DHFPLV+WQTGSGTQS
Sbjct  130  PPIVKAFGILKGAAATVNMRYGLDPQIGKAIQQAAQEVADGKLMDHFPLVVWQTGSGTQS  189

Query  463  NMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            NMNANEVI+NRA EILG K G +K VHPNDHVNRS SSNDTFPTVMHIA  +E+ +
Sbjct  190  NMNANEVISNRAIEILGGKMGSKKPVHPNDHVNRSASSNDTFPTVMHIAGVLELER  245



>ref|NP_058701.2| fumarate hydratase, mitochondrial precursor [Rattus norvegicus]
 gb|AAH87598.1| Fumarate hydratase 1 [Rattus norvegicus]
 gb|EDL94769.1| fumarate hydratase 1 [Rattus norvegicus]
Length=507

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  105

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            EYGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  EYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAALEVHQ  202



>ref|XP_004895657.1| PREDICTED: fumarate hydratase, mitochondrial isoform X5 [Heterocephalus 
glaber]
 ref|XP_004853527.1| PREDICTED: fumarate hydratase, mitochondrial isoform X4 [Heterocephalus 
glaber]
Length=428

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS+ NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRIEYDTFGELKVPNDKYYGAQTVRSMMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  106

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  107  DYGLDPKIATAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGCE  166

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHE  203



>ref|XP_004036528.1| hypothetical protein IMG5_078680 [Ichthyophthirius multifiliis]
 gb|EGR32542.1| hypothetical protein IMG5_078680 [Ichthyophthirius multifiliis]
Length=486

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  148  YFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAA  327
            YFS  FR E D+FG ++VP+D+LWGAQTQRS+QNFEI  D ++MP+ II+AFGILKKCAA
Sbjct  17   YFSQGFRLEYDSFGEMKVPNDRLWGAQTQRSVQNFEICQDVDKMPKSIIKAFGILKKCAA  76

Query  328  KVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEI  507
            KVN EY L+    K +  AA EV +GKLNDHFPLVIWQTGSGTQSNMNANEVIANRA ++
Sbjct  77   KVNKEYALDSEKSKYIQMAADEVIQGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAIQL  136

Query  508  LGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAME  618
            +G ++G K +HPNDHVN SQSSNDTFP+VMHIA  +E
Sbjct  137  MGGEQGSKAIHPNDHVNMSQSSNDTFPSVMHIATVLE  173



>gb|AAY59704.1| fumarate hydratase [Cricetulus griseus]
Length=467

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  6    SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGPTERMPIPVIKAFGILKRAAAEVNQ  65

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  66   DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  125

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  126  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHE  162



>emb|CEJ82858.1| Putative Fumarase [Torrubiella hemipterigena]
Length=528

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 142/193 (74%), Gaps = 14/193 (7%)
 Frame = +1

Query  61   AMLIAARRVTCGST------RSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWG  222
            A L AARR     T      RS  S S++        S S R E D FG IQVP DK WG
Sbjct  31   ASLNAARRHASSPTATQQLLRSFHSSSIK-------MSASTRTESDAFGEIQVPGDKYWG  83

Query  223  AQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAE  402
            AQT+RSL+NF+I   ++RMP PI++AFGILK  AA VNM++GL+P IG+A+ QAA+EVA+
Sbjct  84   AQTERSLENFKINQPQDRMPPPIVKAFGILKGAAATVNMKFGLDPKIGEAIQQAAKEVAD  143

Query  403  GKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKG-VHPNDHVNRSQSSND  579
            GKL DHFPLV+WQTGSGTQSNMNANEVI+NRA EILG   G K  VHPNDHVNRS SSND
Sbjct  144  GKLMDHFPLVVWQTGSGTQSNMNANEVISNRAIEILGGTMGSKSPVHPNDHVNRSASSND  203

Query  580  TFPTVMHIAAAME  618
            TFPTVMHIAA +E
Sbjct  204  TFPTVMHIAAVLE  216



>emb|CCF51284.1| probable FUM1-fumarate hydratase [Ustilago hordei]
Length=516

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 149/210 (71%), Gaps = 9/210 (4%)
 Frame = +1

Query  1    RSVRLLSGFGCGSSIRETQMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERD  180
            RSV L S    G+S R     + IA       +TR+ +S +   +   +     FR E+D
Sbjct  4    RSVALRS---IGASTRVAPPRLAIAFASAIPTATRAFASSAFIMSQQAK-----FRSEKD  55

Query  181  TFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPS  360
            TFGP+QVP+D+ WGAQTQRSLQNF+IGG +ERMPEP+I AFG+LKK AA VN  YGL+P 
Sbjct  56   TFGPLQVPADRYWGAQTQRSLQNFDIGGPQERMPEPLIEAFGVLKKAAATVNKSYGLDPK  115

Query  361  IGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK-GV  537
            +  A+ QAA EV  GKL+ HFPLV++QTGSGTQ+NMN NEVI+NRA EILG + G K  V
Sbjct  116  VADAICQAADEVIAGKLHAHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQLGSKEPV  175

Query  538  HPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            HPNDHVN SQSSNDTFPT MH+A+  +I K
Sbjct  176  HPNDHVNMSQSSNDTFPTAMHVASVTQITK  205



>ref|XP_006993784.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Peromyscus 
maniculatus bairdii]
Length=466

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  5    SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  64

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  65   DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  124

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  125  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHE  161



>ref|XP_005041811.1| PREDICTED: fumarate hydratase, mitochondrial-like isoform X2 
[Ficedula albicollis]
Length=467

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  65

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  66   DYGLDPKIAKAIVQAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  125

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  126  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  162



>ref|XP_004578565.1| PREDICTED: fumarate hydratase, mitochondrial [Ochotona princeps]
Length=508

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 145/188 (77%), Gaps = 5/188 (3%)
 Frame = +1

Query  79   RRVTCGSTRSISSESL---RYTVCWRYFS-TSFREERDTFGPIQVPSDKLWGAQTQRSLQ  246
            R  TC S   +S  ++   R     R  S  SFR E DTFG ++VP+DK +GAQT RS  
Sbjct  16   RAPTCASAPGVSGLAVLPTRLPHAARMASQNSFRTEYDTFGELKVPNDKYYGAQTVRSTM  75

Query  247  NFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFP  426
            NF+IGG  ERMP P+I+AFGILK+ AA+VN +YGL+P I  A+M+AA EVAEGKLNDHFP
Sbjct  76   NFKIGGVTERMPIPVIKAFGILKRAAAEVNQDYGLDPKIADAIMKAANEVAEGKLNDHFP  135

Query  427  LVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHI  603
            LVIWQTGSGTQ+NMN NEVI+NRA E+LG + G +K VHPNDHVN+SQSSNDTFPT MHI
Sbjct  136  LVIWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKKPVHPNDHVNKSQSSNDTFPTAMHI  195

Query  604  AAAMEINK  627
            AAA+E+++
Sbjct  196  AAAVEVHE  203



>emb|CAY86698.1| Fum1p [Saccharomyces cerevisiae EC1118]
 gb|EGA80358.1| Fum1p [Saccharomyces cerevisiae Lalvin QA23]
Length=488

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = +1

Query  130  YTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGI  309
            Y +  R  ++SFR E D FG I VP+DK WGAQTQRS QNF+IGG RERMP P++ AFG+
Sbjct  17   YKLNIRRLNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGV  76

Query  310  LKKCAAKVNMEYG-LEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            LKK AA VN   G L+P I KA+ QAA EVA GKL+DHFPLV++QTGSGTQSNMNANEVI
Sbjct  77   LKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVI  136

Query  487  ANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            +NRA EILG K G K VHPN+H N+SQSSNDTFPTVMHIAA+++I
Sbjct  137  SNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQI  181



>gb|KIK28430.1| hypothetical protein PISMIDRAFT_7450 [Pisolithus microcarpus 
441]
Length=511

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 143/182 (79%), Gaps = 1/182 (1%)
 Frame = +1

Query  82   RVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIG  261
            R+   S + ++    R+++     S +FR+ERDTFG +QVP+D+ WGAQTQRSLQNF+IG
Sbjct  22   RLPARSLQHLAHRHRRFSISHIAMSQAFRQERDTFGDVQVPADRYWGAQTQRSLQNFDIG  81

Query  262  GDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQ  441
            G  ER+P P+I+AFG+LKK A+ VN+ YGL+P IG+A+ +AA EV  GKL DHFPLV++Q
Sbjct  82   GAAERLPAPLIKAFGVLKKAASIVNVGYGLDPKIGEAIQEAADEVISGKLIDHFPLVVFQ  141

Query  442  TGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAME  618
            TGSGTQSNMN NEVI+NRA E+LG + G +K VHPNDHVN SQSSND+FPT MH+AA  E
Sbjct  142  TGSGTQSNMNVNEVISNRAIELLGGELGSKKPVHPNDHVNMSQSSNDSFPTAMHVAAVTE  201

Query  619  IN  624
            I+
Sbjct  202  IH  203



>ref|XP_010392198.1| PREDICTED: fumarate hydratase, mitochondrial [Corvus cornix cornix]
Length=467

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  65

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  66   DYGLDPKIAKAIVQAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  125

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  126  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  162



>ref|XP_009651690.1| fumarate hydratase [Verticillium dahliae VdLs.17]
 gb|EGY21218.1| fumarate hydratase [Verticillium dahliae VdLs.17]
Length=511

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = +1

Query  151  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  330
             S+S R E D FG +QVP+D+ WGAQT+RSL+NF+I   ++RMP PII+AFGILK  AA 
Sbjct  41   MSSSTRTETDAFGALQVPADRYWGAQTERSLENFKINQPQDRMPPPIIKAFGILKGAAAT  100

Query  331  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  510
            VNM YGL+ +IGKA+ QAA EVAEGKL DHFPLV+WQTGSGTQSNMNANEVI+NRA EIL
Sbjct  101  VNMRYGLDETIGKAIQQAAAEVAEGKLLDHFPLVVWQTGSGTQSNMNANEVISNRAIEIL  160

Query  511  GHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            G + G +K VHPNDHVNRS SSNDTFPTVMHIAA +EI
Sbjct  161  GGEMGSKKPVHPNDHVNRSASSNDTFPTVMHIAAVLEI  198



>gb|KFO62089.1| hypothetical protein N302_14449, partial [Corvus brachyrhynchos]
Length=467

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  65

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  66   DYGLDPKIAKAIVQAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  125

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  126  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  162



>gb|AAA52483.1| fumarase precursor (EC 4.2.1.2) [Homo sapiens]
Length=468

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  6    SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  65

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  66   DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  125

Query  520  RGEK-GVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  126  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHE  162



>gb|KFW87389.1| hypothetical protein N305_02194, partial [Manacus vitellinus]
Length=467

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  65

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  66   DYGLDPKIAKAIVQAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  125

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  126  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  162



>gb|KID89475.1| fumarate hydratase [Metarhizium guizhouense ARSEF 977]
Length=536

 Score =   241 bits (616),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 144/190 (76%), Gaps = 11/190 (6%)
 Frame = +1

Query  55   QMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            Q+ + + +R  +C S  S +          R  + + R E D FG IQVP+D+ WGAQT+
Sbjct  44   QLQVQLNSRISSCASIHSTA----------RNMAQATRTESDAFGEIQVPADRYWGAQTE  93

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSL+NF I   ++RMP P+++AFGILK  AA VNM YGL+P IG+A+ QAA+EVA+GKL 
Sbjct  94   RSLENFRINQPQDRMPPPVVKAFGILKGAAATVNMRYGLDPKIGQAIQQAAKEVADGKLM  153

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPT  591
            DHFPLV+WQTGSGTQSNMNANEVI+NRA EILG ++G +K VHPNDHVNRS SSNDTFPT
Sbjct  154  DHFPLVVWQTGSGTQSNMNANEVISNRAIEILGGEKGSKKPVHPNDHVNRSASSNDTFPT  213

Query  592  VMHIAAAMEI  621
            VMHIAA +E+
Sbjct  214  VMHIAAVLEL  223



>gb|KIL70702.1| hypothetical protein M378DRAFT_6637 [Amanita muscaria Koide BX008]
Length=494

 Score =   240 bits (613),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 137/169 (81%), Gaps = 8/169 (5%)
 Frame = +1

Query  142  WRYFSTS-------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRA  300
             R FS+S       +R ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ER+P P+I+A
Sbjct  14   LRLFSSSSPLMAQKYRVERDTFGEVQVPADRYWGAQTQRSLQNFDIGGPSERLPPPLIKA  73

Query  301  FGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANE  480
            FGILKK AA +NM YGL+P++G+A+ +A  +V  G+L DHFPLV++QTGSGTQSNMNANE
Sbjct  74   FGILKKAAATINMTYGLDPNVGEAIQKATDDVISGELIDHFPLVVFQTGSGTQSNMNANE  133

Query  481  VIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            VI+NRA E+LG + G +K VHPNDHVN SQSSNDTFPTVMHIAA  EI+
Sbjct  134  VISNRAIELLGGQLGSKKPVHPNDHVNMSQSSNDTFPTVMHIAAVTEIH  182



>ref|XP_005041810.1| PREDICTED: fumarate hydratase, mitochondrial-like isoform X1 
[Ficedula albicollis]
Length=477

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  16   AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  75

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  76   DYGLDPKIAKAIVQAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  135

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  136  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  172



>gb|KIM34410.1| hypothetical protein M408DRAFT_325817 [Serendipita vermifera 
MAFF 305830]
Length=468

 Score =   239 bits (611),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = +1

Query  163  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  342
            FR+ERDTFG +QVP+DK WGAQTQRSL NF+IGG  ER+P P+I+AFG+LKK AA VNM 
Sbjct  6    FRQERDTFGDLQVPADKYWGAQTQRSLLNFDIGGPTERLPPPLIKAFGVLKKAAAHVNMT  65

Query  343  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  522
            YGL+P IGKA+  AA EV +GKL  HFPLV++QTGSGTQSNMN NEVI+NRA E+LG + 
Sbjct  66   YGLDPKIGKAISDAATEVIDGKLMSHFPLVVFQTGSGTQSNMNVNEVISNRAIEMLGGQL  125

Query  523  G-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            G +K VHPNDHVN SQSSNDTFPT MHIAA  EI +
Sbjct  126  GSKKPVHPNDHVNMSQSSNDTFPTAMHIAAVTEITR  161



>ref|XP_005419421.1| PREDICTED: fumarate hydratase, mitochondrial-like [Geospiza fortis]
Length=529

 Score =   241 bits (615),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  68   AFRTEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  127

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  128  DYGLDPKIAKAIVQAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  187

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  188  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  224



>gb|EPE08450.1| fumarate hydratase [Ophiostoma piceae UAMH 11346]
Length=533

 Score =   241 bits (615),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 141/176 (80%), Gaps = 5/176 (3%)
 Frame = +1

Query  97   STRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRER  276
            STR+  + ++R +      S++ R E D FG IQVP+DK WGAQT+RSL+NF I   ++R
Sbjct  49   STRAFHASTIRMSSD----SSNTRTESDAFGEIQVPADKYWGAQTERSLENFRINQPQDR  104

Query  277  MPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGT  456
            MP PI++AFGILK  AA VNM +GL+P++GKA+ QAA+EVA+ KL DHFPLV+WQTGSGT
Sbjct  105  MPPPIVKAFGILKGAAATVNMNFGLDPTVGKAIQQAAKEVADLKLLDHFPLVVWQTGSGT  164

Query  457  QSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            QSNMNANEVI+NRA EILG K G +K VHPNDHVNRS SSNDTFPTVMHIAA +EI
Sbjct  165  QSNMNANEVISNRAIEILGGKMGSKKPVHPNDHVNRSASSNDTFPTVMHIAAVLEI  220



>ref|NP_015061.1| fumarase FUM1 [Saccharomyces cerevisiae S288c]
 sp|P08417.2|FUMH_YEAST RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
Flags: Precursor [Saccharomyces cerevisiae S288c]
 emb|CAA97997.1| FUM1 [Saccharomyces cerevisiae]
 gb|EDN60886.1| fumarase [Saccharomyces cerevisiae YJM789]
 gb|EDV10969.1| fumarase [Saccharomyces cerevisiae RM11-1a]
 gb|EEU06257.1| Fum1p [Saccharomyces cerevisiae JAY291]
 tpg|DAA11174.1| TPA: fumarase FUM1 [Saccharomyces cerevisiae S288c]
 gb|EIW06971.1| Fum1p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|EWG85452.1| Fum1p [Saccharomyces cerevisiae R008]
 gb|EWG88322.1| Fum1p [Saccharomyces cerevisiae P301]
 gb|EWG95315.1| Fum1p [Saccharomyces cerevisiae R103]
 gb|EWH15651.1| Fum1p [Saccharomyces cerevisiae P283]
 gb|AHY77924.1| Fum1p [Saccharomyces cerevisiae YJM993]
 gb|AJP41892.1| Fum1p [Saccharomyces cerevisiae YJM1078]
Length=488

 Score =   240 bits (612),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = +1

Query  130  YTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGI  309
            Y +  R  ++SFR E D FG I VP+DK WGAQTQRS QNF+IGG RERMP P++ AFG+
Sbjct  17   YKLNIRRMNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGV  76

Query  310  LKKCAAKVNMEYG-LEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            LKK AA VN   G L+P I KA+ QAA EVA GKL+DHFPLV++QTGSGTQSNMNANEVI
Sbjct  77   LKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVI  136

Query  487  ANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            +NRA EILG K G K VHPN+H N+SQSSNDTFPTVMHIAA+++I
Sbjct  137  SNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQI  181



>ref|XP_005969001.1| PREDICTED: fumarate hydratase, mitochondrial [Pantholops hodgsonii]
Length=510

 Score =   240 bits (613),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGMTERMPIPVIKAFGILKRAAAEVNQ  108

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGE  168

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHE  205



>dbj|GAA26717.1| K7_Fum1p [Saccharomyces cerevisiae Kyokai no. 7]
Length=488

 Score =   240 bits (612),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = +1

Query  130  YTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGI  309
            Y +  R  ++SFR E D FG I VP+DK WGAQTQRS QNF+IGG RERMP P++ AFG+
Sbjct  17   YKLNIRRMNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGV  76

Query  310  LKKCAAKVNMEYG-LEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            LKK AA VN   G L+P I KA+ QAA EVA GKL+DHFPLV++QTGSGTQSNMNANEVI
Sbjct  77   LKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVI  136

Query  487  ANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            +NRA EILG K G K VHPN+H N+SQSSNDTFPTVMHIAA+++I
Sbjct  137  SNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQI  181



>pdb|1YFM|A Chain A, Recombinant Yeast Fumarase
Length=488

 Score =   240 bits (612),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = +1

Query  130  YTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGI  309
            Y +  R  ++SFR E D FG I VP+DK WGAQTQRS QNF+IGG RERMP P++ AFG+
Sbjct  17   YKLNIRRMNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGV  76

Query  310  LKKCAAKVNMEYG-LEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            LKK AA VN   G L+P I KA+ QAA EVA GKL+DHFPLV++QTGSGTQSNMNANEVI
Sbjct  77   LKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVI  136

Query  487  ANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            +NRA EILG K G K VHPN+H N+SQSSNDTFPTVMHIAA+++I
Sbjct  137  SNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQI  181



>ref|XP_004895654.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Heterocephalus 
glaber]
 ref|XP_004853525.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Heterocephalus 
glaber]
Length=473

 Score =   239 bits (611),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS+ NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  12   SFRIEYDTFGELKVPNDKYYGAQTVRSMMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  71

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  72   DYGLDPKIATAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGCE  131

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  132  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHE  168



>ref|XP_007441617.1| PREDICTED: fumarate hydratase, mitochondrial-like, partial [Python 
bivittatus]
Length=297

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 130/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG + VP+DK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA++N 
Sbjct  45   SFRIEYDTFGELSVPNDKYYGAQTVRSTMNFKIGGATERMPVQVIRAFGILKRAAAEINQ  104

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGLE  I  A+++AA EV+EGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG K
Sbjct  105  DYGLEAKIANAIIKAADEVSEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGK  164

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  165  LGSKDPVHPNDHVNKSQSSNDTFPTAMHIAAALEVHE  201



>gb|KDN71424.1| putative fumarate hydratase [Colletotrichum sublineola]
Length=470

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  166  REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEY  345
            R E D FG IQVP+DK WGAQT+RSL+NF+I   ++RMP PII+AFGILK  AA VNM Y
Sbjct  5    RTESDAFGEIQVPADKYWGAQTERSLENFKINQPQDRMPPPIIKAFGILKGAAATVNMRY  64

Query  346  GLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG  525
            GL+  IGKA+ QAA EVAEGKL DHFPLV+WQTGSGTQSNMNANEVI+NRA EILG  +G
Sbjct  65   GLDEKIGKAIQQAAAEVAEGKLLDHFPLVVWQTGSGTQSNMNANEVISNRAIEILGGVKG  124

Query  526  -EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
             +K VHPNDHVNRS SSNDTFPTVMHIAA +EI
Sbjct  125  SKKPVHPNDHVNRSASSNDTFPTVMHIAAVLEI  157



>ref|XP_007532622.1| PREDICTED: fumarate hydratase, mitochondrial [Erinaceus europaeus]
Length=510

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 157/215 (73%), Gaps = 18/215 (8%)
 Frame = +1

Query  1    RSVRLLSGFGCGSSIRETQMAMLI-----AARRVTCGSTRSISSESLRYTVCWRYFSTSF  165
            R++RLL+   C S    + +A        A  R+ C ++  ++S++            SF
Sbjct  3    RALRLLARSVCHSQALGSYLASAPGFGGPAVLRIRCPNSARMASQN------------SF  50

Query  166  REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEY  345
            R E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN +Y
Sbjct  51   RIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQDY  110

Query  346  GLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG  525
            GL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG + G
Sbjct  111  GLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELG  170

Query  526  -EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  171  SKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHE  205



>gb|KHN98805.1| fumarate hydratase [Metarhizium album ARSEF 1941]
Length=541

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = +1

Query  166  REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEY  345
            R E D FG IQVP+DK WGAQT+RSL+NF I   ++RMP PI++AFGILK  AA VNM Y
Sbjct  76   RTESDAFGEIQVPADKYWGAQTERSLENFRINQPQDRMPPPIVKAFGILKGAAATVNMRY  135

Query  346  GLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG  525
            GL+P IG+A+ QAA+EVA+GKL DHFPLV+WQTGSGTQSNMNANEVI+NRA EILG ++G
Sbjct  136  GLDPKIGQAIQQAAKEVADGKLMDHFPLVVWQTGSGTQSNMNANEVISNRAIEILGGEKG  195

Query  526  -EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
             +K VHPNDHVNRS SSNDTFPTVMHIAA +E+
Sbjct  196  TKKPVHPNDHVNRSASSNDTFPTVMHIAAVLEL  228



>ref|NP_001069271.1| fumarate hydratase, mitochondrial [Bos taurus]
 gb|AAI18451.1| Fumarate hydratase [Bos taurus]
 tpg|DAA21383.1| TPA: fumarate hydratase, mitochondrial [Bos taurus]
Length=510

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGMTERMPIPVIKAFGILKRAAAEVNQ  108

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGE  168

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHE  205



>ref|XP_004711822.1| PREDICTED: fumarate hydratase, mitochondrial-like [Echinops telfairi]
Length=503

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILKK AA VN 
Sbjct  42   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGMTERMPVPVIKAFGILKKAAADVNQ  101

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            EYGL+P +  A+M+AA EVAEGKLNDHFPLVIWQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  102  EYGLDPKVASAIMKAADEVAEGKLNDHFPLVIWQTGSGTQTNMNVNEVISNRAIEMLGGE  161

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+++
Sbjct  162  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAATEVHE  198



>ref|XP_005897261.1| PREDICTED: fumarate hydratase, mitochondrial [Bos mutus]
 gb|ELR55340.1| Fumarate hydratase, mitochondrial [Bos mutus]
Length=510

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGMTERMPIPVIKAFGILKRAAAEVNQ  108

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGE  168

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHE  205



>gb|KID72552.1| fumarate hydratase, partial [Metarhizium brunneum ARSEF 3297]
Length=536

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 146/190 (77%), Gaps = 11/190 (6%)
 Frame = +1

Query  55   QMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            Q+ + + +R  +C   RSI S +       R  + + R E D FG IQVP+D+ WGAQT+
Sbjct  44   QLQVQLNSRISSC---RSIHSTA-------RNMAQATRTESDAFGEIQVPADRYWGAQTE  93

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSL+NF I   ++RMP P+++AFGILK  AA VNM YGL+P IG+A+ QAA+EVA+GKL 
Sbjct  94   RSLENFRINQPQDRMPPPVVKAFGILKGAAATVNMRYGLDPKIGQAIQQAAKEVADGKLM  153

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPT  591
            DHFPLV+WQTGSGTQSNMNANEVI+NRA EILG ++G +K VHPNDHVNRS SSNDTFPT
Sbjct  154  DHFPLVVWQTGSGTQSNMNANEVISNRAIEILGGEKGSKKPVHPNDHVNRSASSNDTFPT  213

Query  592  VMHIAAAMEI  621
            VMHIAA +E+
Sbjct  214  VMHIAAVLEL  223



>ref|XP_004330338.1| PREDICTED: fumarate hydratase, mitochondrial-like [Tursiops truncatus]
Length=419

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFG+LK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGVLKRAAAEVNQ  108

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHE  205



>ref|XP_002717380.1| PREDICTED: fumarate hydratase, mitochondrial [Oryctolagus cuniculus]
 ref|XP_002722110.1| PREDICTED: fumarate hydratase, mitochondrial [Oryctolagus cuniculus]
Length=508

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRTEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  106

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLVIWQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  107  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVIWQTGSGTQTNMNVNEVISNRAIEMLGGE  166

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHE  203



>pdb|3E04|A Chain A, Crystal Structure Of Human Fumarate Hydratase
 pdb|3E04|B Chain B, Crystal Structure Of Human Fumarate Hydratase
 pdb|3E04|C Chain C, Crystal Structure Of Human Fumarate Hydratase
 pdb|3E04|D Chain D, Crystal Structure Of Human Fumarate Hydratase
Length=490

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  29   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  88

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  89   DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  148

Query  520  RGEK-GVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  149  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHE  185



>gb|KIM67197.1| hypothetical protein SCLCIDRAFT_14296 [Scleroderma citrinum Foug 
A]
Length=467

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 131/158 (83%), Gaps = 1/158 (1%)
 Frame = +1

Query  151  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  330
             S SFR ERDTFG IQVP+D+ WGAQTQRSLQNF+IGG+ ER+P P+I+AFG+LKK A+ 
Sbjct  1    MSQSFRNERDTFGDIQVPADRYWGAQTQRSLQNFDIGGEAERLPAPLIKAFGVLKKAASV  60

Query  331  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  510
            VN+ YGL+P +G A+ +AA EV  GKL DHFPLV++QTGSGTQSNMN NEVI+NRA ++L
Sbjct  61   VNVSYGLDPMVGDAIQKAADEVISGKLLDHFPLVVFQTGSGTQSNMNVNEVISNRAIQLL  120

Query  511  GHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            G + G +K VHPNDHVN SQSSNDTFPT MH+AA  EI
Sbjct  121  GGELGSKKPVHPNDHVNMSQSSNDTFPTAMHVAAVTEI  158



>gb|KFP81385.1| hypothetical protein N311_05316, partial [Apaloderma vittatum]
Length=439

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  IIRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQIIRAFGILKRAAAEVNQ  65

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G +
Sbjct  66   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGQ  125

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  126  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  162



>gb|EPB87937.1| fumarate hydratase, mitochondrial [Mucor circinelloides f. circinelloides 
1006PhL]
Length=495

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 134/167 (80%), Gaps = 8/167 (5%)
 Frame = +1

Query  145  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQ-RSLQNFEIGGDRERMPEPIIRAF  303
            R FS++      FR ERDTFG +QVP+DK WGAQTQ RSLQNF+IGG  ERMPEP+IRAF
Sbjct  21   RLFSSASIALQKFRAERDTFGDLQVPADKYWGAQTQSRSLQNFDIGGQHERMPEPLIRAF  80

Query  304  GILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  483
            G+LKK AA VNM YG++  +G+A+ +AA EV +G L DHFPLV+WQTGSGTQ+NMN NEV
Sbjct  81   GVLKKAAATVNMTYGMDAKVGEAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTNMNVNEV  140

Query  484  IANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            I+NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA +EI
Sbjct  141  ISNRAIELLGGELGSKTPVHPNDHVNMSQSSNDTFPTAMHVAAVVEI  187



>ref|XP_006050829.1| PREDICTED: fumarate hydratase, mitochondrial [Bubalus bubalis]
 ref|XP_010834988.1| PREDICTED: fumarate hydratase, mitochondrial [Bison bison bison]
Length=510

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGMTERMPIPVIKAFGILKRAAAEVNQ  108

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGE  168

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHE  205



>ref|NP_001155363.1| fumarate hydratase, mitochondrial [Ovis aries]
 gb|ACR55776.1| fumarate hydratase [Ovis aries]
Length=510

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGMTERMPIPVIKAFGILKRAAAEVNQ  108

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGE  168

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHE  205



>ref|XP_007820058.1| fumarate hydratase [Metarhizium robertsii ARSEF 23]
 gb|EFZ01273.1| fumarate hydratase [Metarhizium robertsii ARSEF 23]
Length=536

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 144/190 (76%), Gaps = 11/190 (6%)
 Frame = +1

Query  55   QMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            Q+ + + +R  +C S  S +          R  + + R E D FG IQVP+D+ WGAQT+
Sbjct  44   QLQVQLNSRISSCPSIHSTA----------RNMAQATRTESDAFGEIQVPADRYWGAQTE  93

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSL+NF I   ++RMP P+++AFGILK  AA VNM YGL+P IG+A+ QAA+EVA+GKL 
Sbjct  94   RSLENFRINQPQDRMPPPVVKAFGILKGAAATVNMRYGLDPKIGQAIQQAAKEVADGKLM  153

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPT  591
            DHFPLV+WQTGSGTQSNMNANEVI+NRA EILG ++G +K VHPNDHVNRS SSNDTFPT
Sbjct  154  DHFPLVVWQTGSGTQSNMNANEVISNRAIEILGGEKGSKKPVHPNDHVNRSASSNDTFPT  213

Query  592  VMHIAAAMEI  621
            VMHIAA +E+
Sbjct  214  VMHIAAVLEL  223



>ref|XP_007265454.1| fumarate hydratase [Fomitiporia mediterranea MF3/22]
 gb|EJD03853.1| fumarate hydratase [Fomitiporia mediterranea MF3/22]
Length=466

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  157  TSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVN  336
            T +R ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ER+P P+I+AFG+LKK AA VN
Sbjct  2    TQYRTERDTFGELQVPADRYWGAQTQRSLQNFDIGGPTERLPPPLIKAFGVLKKAAAIVN  61

Query  337  MEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGH  516
              YGL+P +G+A+ +AA EV  GKL DHFPLV++QTGSGTQSNMN NEVI+NRA E+LG 
Sbjct  62   TTYGLDPKVGEAIQKAADEVIAGKLIDHFPLVVFQTGSGTQSNMNTNEVISNRAIELLGG  121

Query  517  KRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            + G +K VHPNDHVN SQSSNDTFPT MH+AA MEI+
Sbjct  122  ELGSKKPVHPNDHVNMSQSSNDTFPTAMHVAAVMEIS  158



>gb|KFV66685.1| hypothetical protein N307_11320, partial [Picoides pubescens]
Length=466

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRTEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNK  64

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIADAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  520  RGEK-GVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  125  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  161



>gb|KIE00198.1| fumarate hydratase, partial [Metarhizium majus ARSEF 297]
Length=538

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 144/190 (76%), Gaps = 11/190 (6%)
 Frame = +1

Query  55   QMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  234
            Q+ + + +R  +C S  S +          R  + + R E D FG IQVP+D+ WGAQT+
Sbjct  46   QLQVQLNSRISSCPSIHSTA----------RNMAQATRTESDAFGEIQVPADRYWGAQTE  95

Query  235  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  414
            RSL+NF I   ++RMP P+++AFGILK  AA VNM YGL+P IG+A+ QAA+EVA+GKL 
Sbjct  96   RSLENFRINQPQDRMPPPVVKAFGILKGAAATVNMRYGLDPKIGQAIQQAAKEVADGKLM  155

Query  415  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPT  591
            DHFPLV+WQTGSGTQSNMNANEVI+NRA EILG ++G +K VHPNDHVNRS SSNDTFPT
Sbjct  156  DHFPLVVWQTGSGTQSNMNANEVISNRAIEILGGEKGSKKPVHPNDHVNRSASSNDTFPT  215

Query  592  VMHIAAAMEI  621
            VMHIAA +E+
Sbjct  216  VMHIAAVLEL  225



>gb|KFW71651.1| hypothetical protein AS28_14072, partial [Pygoscelis adeliae]
Length=466

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIIKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  125  LGSKNPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  161



>gb|EGA76536.1| Fum1p [Saccharomyces cerevisiae Vin13]
Length=488

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = +1

Query  130  YTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGI  309
            Y +  R  ++SFR E D FG I VP+DK WGAQTQRS QNF+IGG RERMP P++ AFG+
Sbjct  17   YKLNIRRXNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGV  76

Query  310  LKKCAAKVNMEYG-LEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            LKK AA VN   G L+P I KA+ QAA EVA GKL+DHFPLV++QTGSGTQSNMNANEVI
Sbjct  77   LKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVI  136

Query  487  ANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            +NRA EILG K G K VHPN+H N+SQSSNDTFPTVMHIAA+++I
Sbjct  137  SNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQI  181



>ref|XP_008929917.1| PREDICTED: fumarate hydratase, mitochondrial [Manacus vitellinus]
Length=493

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  32   AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  91

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  92   DYGLDPKIAKAIVQAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  151

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  152  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  188



>ref|XP_007762775.1| fumarate hydratase [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86596.1| fumarate hydratase [Coniophora puteana RWD-64-598 SS2]
Length=493

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 138/174 (79%), Gaps = 6/174 (3%)
 Frame = +1

Query  124  LRYTVCWRYFST-----SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEP  288
            L   V +R FS+     S+R ERDTFG I VPSD+ WGAQTQRSLQNF+IGG  ER+P  
Sbjct  13   LYANVRYRTFSSTPRSMSYRTERDTFGDINVPSDRYWGAQTQRSLQNFDIGGPSERLPPA  72

Query  289  IIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNM  468
            +I+AFG+LKK A+ VN+ YGL+P +G A+ +AA EV  GKL DHFPLV++QTGSGTQSNM
Sbjct  73   LIKAFGVLKKAASVVNVTYGLDPKVGDAIQKAADEVISGKLVDHFPLVVFQTGSGTQSNM  132

Query  469  NANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            NANEVI+NRA E+LG + G +K VHPNDHVN SQSSNDTFPTVMHIAA  EI++
Sbjct  133  NANEVISNRAIELLGGELGSKKPVHPNDHVNMSQSSNDTFPTVMHIAAVTEIHR  186



>ref|XP_010075048.1| PREDICTED: fumarate hydratase, mitochondrial [Pterocles gutturalis]
Length=476

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 135/167 (81%), Gaps = 3/167 (2%)
 Frame = +1

Query  136  VCWRYFST--SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGI  309
            + W   ST  +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGI
Sbjct  5    IQWEVKSTQEAFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGI  64

Query  310  LKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIA  489
            LK+ AA+VN +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+
Sbjct  65   LKRAAAEVNQDYGLDPKISDAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVIS  124

Query  490  NRAAEILGHKRGEK-GVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            NRA EI+G K G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  125  NRAIEIMGGKLGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  171



>ref|XP_003499892.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Cricetulus 
griseus]
 ref|XP_007637780.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Cricetulus 
griseus]
 gb|EGW05762.1| Fumarate hydratase, mitochondrial [Cricetulus griseus]
 gb|ERE73303.1| fumarate hydratase [Cricetulus griseus]
Length=507

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGPTERMPIPVIKAFGILKRAAAEVNQ  105

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHE  202



>ref|XP_010295483.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Phaethon 
lepturus]
 gb|KFQ65379.1| hypothetical protein N335_01053, partial [Phaethon lepturus]
Length=466

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIIKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  125  LGSKNPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  161



>ref|XP_005517420.1| PREDICTED: fumarate hydratase, mitochondrial-like [Pseudopodoces 
humilis]
Length=506

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  45   AFRTEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  104

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  105  DYGLDPKIAKAIVQAASEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  164

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  165  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  201



>ref|XP_005078228.1| PREDICTED: fumarate hydratase, mitochondrial [Mesocricetus auratus]
Length=507

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  105

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHE  202



>gb|EHK50052.1| fumarate hydratase [Trichoderma atroviride IMI 206040]
Length=468

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  166  REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEY  345
            R E D FG I+VPSDK WGAQTQRSL NF+I   ++RMP P+I AFGILK  AA VNM+Y
Sbjct  5    RIESDAFGEIEVPSDKYWGAQTQRSLGNFKINQPQDRMPPPVITAFGILKGAAATVNMKY  64

Query  346  GLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG  525
            GL+P IG+A+ QAAQEVA+GKL +HFPLV+WQTGSGTQSNMNANEVI+NRA EILG K G
Sbjct  65   GLDPKIGQAIQQAAQEVADGKLLEHFPLVVWQTGSGTQSNMNANEVISNRAIEILGGKMG  124

Query  526  EKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
             K  VHPNDHVNRS SSNDTFPTVMHIAA +E+
Sbjct  125  SKSPVHPNDHVNRSASSNDTFPTVMHIAAVLEL  157



>gb|ELQ41093.1| fumarate hydratase class II 1 [Magnaporthe oryzae Y34]
 gb|ELQ62694.1| fumarate hydratase class II 1 [Magnaporthe oryzae P131]
Length=471

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 131/158 (83%), Gaps = 1/158 (1%)
 Frame = +1

Query  151  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  330
             S + R E D FG +QVP+DK WGAQTQRSL NF+I   ++RMP PI++A GILK  AA 
Sbjct  1    MSANTRAETDAFGEVQVPADKYWGAQTQRSLGNFDINQPQDRMPPPIVKALGILKGAAAT  60

Query  331  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  510
            VNM YGL+P+IGKA+ QAA+EVA+ KL DHFPLV+WQTGSGTQSNMNANEVI+NRA EIL
Sbjct  61   VNMNYGLDPTIGKAIQQAAKEVADLKLLDHFPLVVWQTGSGTQSNMNANEVISNRAIEIL  120

Query  511  GHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            G ++G +K VHPNDHVNRS SSNDTFPTVMHIAA +EI
Sbjct  121  GGEKGSKKPVHPNDHVNRSASSNDTFPTVMHIAAVLEI  158



>ref|XP_009508750.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Phalacrocorax 
carbo]
 gb|KFW97120.1| hypothetical protein N336_11437, partial [Phalacrocorax carbo]
Length=466

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  125  LGSKNPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  161



>ref|XP_010309788.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Balearica 
regulorum gibbericeps]
 gb|KFO06525.1| hypothetical protein N312_01122, partial [Balearica regulorum 
gibbericeps]
Length=466

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  125  LGSKNPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  161



>ref|XP_005368585.1| PREDICTED: fumarate hydratase, mitochondrial [Microtus ochrogaster]
Length=507

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  105

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHE  202



>ref|XP_011378307.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Pteropus 
vampyrus]
Length=508

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  106

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG +
Sbjct  107  DYGLDPKIANAIMRAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGE  166

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHE  203



>gb|EQK99496.1| fumarate hydratase class II [Ophiocordyceps sinensis CO18]
Length=379

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = +1

Query  151  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  330
             +++ R E D FG IQVP+DK WGAQT+RSL+NF I   ++RMP P+I+AFGILK  AA 
Sbjct  1    MASATRSESDAFGEIQVPADKYWGAQTERSLENFRINQPQDRMPPPVIKAFGILKGAAAT  60

Query  331  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  510
            VNM +GL+ SIG+A+ QAA+EVA+GKL DHFPLV+WQTGSGTQSNMNANEVI+NRA EIL
Sbjct  61   VNMRFGLDASIGQAIQQAAKEVADGKLLDHFPLVVWQTGSGTQSNMNANEVISNRAIEIL  120

Query  511  GHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            G + G +K VHPNDHVNRS SSNDTFPTVMHIAA +E+ +
Sbjct  121  GGQMGSKKPVHPNDHVNRSASSNDTFPTVMHIAAVVELEQ  160



>gb|EHN00014.1| Fum1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=488

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = +1

Query  130  YTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGI  309
            Y V  R  +++FR E D FG I VP+DK WGAQTQRS QNF+IGG RERMP P++ AFG+
Sbjct  17   YKVNLRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGV  76

Query  310  LKKCAAKVNMEYG-LEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  486
            LKK AA VN   G L+P I KA+ QAA EV  GKL+DHFPLV++QTGSGTQSNMNANEVI
Sbjct  77   LKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVI  136

Query  487  ANRAAEILGHKRGEKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
            +NRA EILG K G K VHPN+H N+SQSSNDTFPTVMHIAA+++I
Sbjct  137  SNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQI  181



>gb|KDQ19923.1| hypothetical protein BOTBODRAFT_51294 [Botryobasidium botryosum 
FD-172 SS1]
Length=490

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 144/188 (77%), Gaps = 8/188 (4%)
 Frame = +1

Query  64   MLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSL  243
            ML AA R     T S++   L  T   R  +  +R ERDTFG ++VPSD+ WGAQTQRSL
Sbjct  2    MLKAAAR-----TNSVAKARLFST--SRLMAQEYRTERDTFGDLKVPSDRYWGAQTQRSL  54

Query  244  QNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHF  423
            QNF+IGG  ER+P P+I+AFG+LKK A++VN+ YG++P +G+A+ +AA EV  GKL DHF
Sbjct  55   QNFDIGGPAERLPPPLIKAFGVLKKAASQVNVTYGMDPKVGEAIGKAADEVISGKLIDHF  114

Query  424  PLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMH  600
            PLV++QTGSGTQSNMN NEVI+NRA E+LG + G +K VHPNDHVN SQSSNDTFPT MH
Sbjct  115  PLVVFQTGSGTQSNMNVNEVISNRAIEMLGGELGSKKPVHPNDHVNMSQSSNDTFPTAMH  174

Query  601  IAAAMEIN  624
            +AA  EIN
Sbjct  175  VAAVTEIN  182



>ref|XP_004895653.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Heterocephalus 
glaber]
 ref|XP_004853524.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Heterocephalus 
glaber]
 gb|EHB09990.1| Fumarate hydratase, mitochondrial [Heterocephalus glaber]
Length=508

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS+ NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRIEYDTFGELKVPNDKYYGAQTVRSMMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  106

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  107  DYGLDPKIATAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGCE  166

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHE  203



>gb|EXV03852.1| fumarase [Metarhizium robertsii]
Length=471

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = +1

Query  166  REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEY  345
            R E D FG IQVP+D+ WGAQT+RSL+NF I   ++RMP P+++AFGILK  AA VNM Y
Sbjct  6    RTESDAFGEIQVPADRYWGAQTERSLENFRINQPQDRMPPPVVKAFGILKGAAATVNMRY  65

Query  346  GLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG  525
            GL+P IG+A+ QAA+EVA+GKL DHFPLV+WQTGSGTQSNMNANEVI+NRA EILG ++G
Sbjct  66   GLDPKIGQAIQQAAKEVADGKLMDHFPLVVWQTGSGTQSNMNANEVISNRAIEILGGEKG  125

Query  526  -EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
             +K VHPNDHVNRS SSNDTFPTVMHIAA +E+
Sbjct  126  SKKPVHPNDHVNRSASSNDTFPTVMHIAAVLEL  158



>gb|KJA29256.1| hypothetical protein HYPSUDRAFT_503715 [Hypholoma sublateritium 
FD-334 SS-4]
Length=467

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  154  STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKV  333
            S S R E+DTFG +QVPSD+ WGAQTQRSLQNF+IGG  ER+P P+I+AFG+LKK A+ V
Sbjct  3    SQSHRVEKDTFGELQVPSDRYWGAQTQRSLQNFDIGGPTERLPLPLIKAFGVLKKAASIV  62

Query  334  NMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  513
            N+EYG++P IG A+ QA+ +V  GKL DHFPLV++QTGSGTQSNMNANEVI+NRA EILG
Sbjct  63   NVEYGMDPRIGDAIQQASDDVISGKLADHFPLVVFQTGSGTQSNMNANEVISNRAIEILG  122

Query  514  HKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEI  621
             + G K  VHPNDHVNRSQSSND+FPTVMHIA   EI
Sbjct  123  GELGSKTPVHPNDHVNRSQSSNDSFPTVMHIAVVTEI  159



>ref|XP_003974177.1| PREDICTED: fumarate hydratase, mitochondrial-like [Takifugu rubripes]
Length=499

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 143/190 (75%), Gaps = 3/190 (2%)
 Frame = +1

Query  67   LIAARRVTCG--STRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRS  240
            L A R++ C   +   ++  S R     R  S+ +R ERDTFG ++VP+DK +GAQT RS
Sbjct  5    LKAVRQLNCNRLTLEKLAVNSRRLICTSRMASSEYRLERDTFGELKVPADKYYGAQTVRS  64

Query  241  LQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDH  420
              NF+IGG  ERMP  +I+AFGILK+ AA+VN +YGL+P I  A++QAA EV+ GKL+DH
Sbjct  65   TMNFKIGGPSERMPIQVIKAFGILKRAAAEVNKDYGLDPKIAGAIIQAADEVSAGKLDDH  124

Query  421  FPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVM  597
            FPLV+WQTGSGTQSNMN NEVI+NRA EILG   G K  VHPNDHVN+SQSSNDTFPT M
Sbjct  125  FPLVVWQTGSGTQSNMNVNEVISNRAIEILGGTLGSKDPVHPNDHVNKSQSSNDTFPTAM  184

Query  598  HIAAAMEINK  627
            HIAAA E+++
Sbjct  185  HIAAATEVHQ  194



>gb|KIM85397.1| hypothetical protein PILCRDRAFT_817407 [Piloderma croceum F 1598]
Length=496

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 137/170 (81%), Gaps = 2/170 (1%)
 Frame = +1

Query  124  LRYTVCWRYFS-TSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRA  300
            L ++   R+ S  S+R ERDTFG ++VPSD+ WGAQTQRSLQNF+IGG  ER+P P+I+A
Sbjct  20   LNFSSTTRFMSEQSYRTERDTFGELRVPSDRYWGAQTQRSLQNFDIGGPTERLPPPLIKA  79

Query  301  FGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANE  480
            FG+LKK A+ VN EYGL+P I  A+ QAA +V  GKL DHFPLV++QTGSGTQSNMN NE
Sbjct  80   FGVLKKAASIVNAEYGLDPKIAGAIQQAADDVISGKLIDHFPLVVFQTGSGTQSNMNCNE  139

Query  481  VIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            VI+NRA EILG ++G +K VHPNDHVN SQSSNDTFPT MH+AA  EI++
Sbjct  140  VISNRAIEILGGEKGSKKPVHPNDHVNMSQSSNDTFPTAMHVAAVTEISR  189



>ref|XP_004439637.1| PREDICTED: fumarate hydratase, mitochondrial [Ceratotherium simum 
simum]
Length=508

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  106

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG +
Sbjct  107  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGE  166

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+++
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAATEVHE  203



>ref|XP_010581869.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Haliaeetus 
leucocephalus]
Length=467

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  65

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  66   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  125

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  126  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  162



>gb|KFZ60559.1| hypothetical protein N338_09291, partial [Podiceps cristatus]
Length=466

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  125  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  161



>gb|KFQ04696.1| hypothetical protein N329_04765, partial [Haliaeetus albicilla]
 gb|KFQ97614.1| hypothetical protein Y956_03361, partial [Nipponia nippon]
Length=466

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  125  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  161



>gb|KGL93621.1| hypothetical protein N301_03833, partial [Charadrius vociferus]
Length=466

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  125  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  161



>gb|KGL79172.1| hypothetical protein N309_10896, partial [Tinamus guttatus]
Length=466

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    SFRTEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPIQVIRAFGILKRAAAEVNQ  64

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGLEP+I  A+++AA EVA GKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G +
Sbjct  65   DYGLEPNIANAIIKAADEVAAGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGQ  124

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  125  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  161



>ref|XP_009979909.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Tauraco 
erythrolophus]
Length=429

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEG+LNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGQLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  125  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  161



>ref|NP_588397.3| fumarate hydratase (predicted) [Schizosaccharomyces pombe 972h-]
 sp|O94552.3|FUMH_SCHPO RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
Flags: Precursor [Schizosaccharomyces pombe 972h-]
 emb|CAA21432.3| fumarate hydratase (predicted) [Schizosaccharomyces pombe]
Length=520

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = +1

Query  163  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  342
            FR+E DTFGPIQVP++K WGAQTQRSLQNF IGG++ER+P P++RAFG+LK+ AA VN E
Sbjct  58   FRQESDTFGPIQVPAEKYWGAQTQRSLQNFRIGGEKERLPLPLVRAFGVLKRAAASVNRE  117

Query  343  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  522
            +GL+P +  A+ QAAQEV +G+L+D+FPLV++QTGSGTQSNMN+NEVIANRA EILG   
Sbjct  118  FGLDPKLADAIEQAAQEVIDGRLDDNFPLVVFQTGSGTQSNMNSNEVIANRAIEILGGTL  177

Query  523  G-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            G +K VHPNDHVN SQSSNDTFPTVMHIA+ ++I+
Sbjct  178  GSKKPVHPNDHVNMSQSSNDTFPTVMHIASVLQIH  212



>dbj|GAA87674.1| fumarate hydratase class II [Aspergillus kawachii IFO 4308]
Length=533

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 146/195 (75%), Gaps = 11/195 (6%)
 Frame = +1

Query  70   IAARRVTCGSTRSISS----ESLRYTVCWRYFSTSF------REERDTFGPIQVPSDKLW  219
             + RR+   ++R +      +SL  T   R F T+       R E D FG IQVP+DK W
Sbjct  29   FSCRRLLSSNSRPVQQFPRLQSLTSTSSKRAFGTTVKMSSATRTETDAFGEIQVPADKYW  88

Query  220  GAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVA  399
            GAQTQRSL NF+I   ++RMPEP+++AFGILK  AA+VNM++GL+P IG+A+ QAA EVA
Sbjct  89   GAQTQRSLGNFDINQPQDRMPEPVVKAFGILKGAAAEVNMKFGLDPKIGEAIKQAAAEVA  148

Query  400  EGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSN  576
            EGKL DHFPLV+WQTGSGTQSNMN+NEVI+NRA EILG ++G +K VHPNDHVN S SSN
Sbjct  149  EGKLMDHFPLVVWQTGSGTQSNMNSNEVISNRAIEILGGEKGSKKPVHPNDHVNMSASSN  208

Query  577  DTFPTVMHIAAAMEI  621
            D+FPT MHIAA +E+
Sbjct  209  DSFPTAMHIAAVLEL  223



>gb|KIW47448.1| fumarate hydratase, class II [Exophiala oligosperma]
Length=540

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 149/208 (72%), Gaps = 13/208 (6%)
 Frame = +1

Query  40   SIRETQMAMLIAARRVTCG-----------STRSISSESLRYTVCWRYFSTSFREERDTF  186
            ++R +Q ++ I A+R++C            +T S S  S R     R  + S R E D F
Sbjct  26   AVRSSQ-SLRIPAQRLSCSYPSQASRRPSPATFSTSPSSYRTFSTTRNMAASTRTETDAF  84

Query  187  GPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIG  366
            GPI+VPSDK WGAQTQRSL NF+I   ++RMPE ++RAFGILK  AA VNM YGL+P +G
Sbjct  85   GPIEVPSDKYWGAQTQRSLGNFKINQPQDRMPEGVVRAFGILKGAAATVNMRYGLDPKVG  144

Query  367  KAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKGVHP  543
            +A+ QAA EVA  KL DHFPLV+WQTGSGTQSNMNANEVI+NRA EILG + G +K VHP
Sbjct  145  EAIQQAAAEVAALKLIDHFPLVVWQTGSGTQSNMNANEVISNRAIEILGGQMGSKKPVHP  204

Query  544  NDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            NDHVN S SSND+FPTVMHIAA ++  +
Sbjct  205  NDHVNMSASSNDSFPTVMHIAAVLDFEQ  232



>gb|KFO98944.1| hypothetical protein N300_02760, partial [Calypte anna]
Length=468

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  7    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  66

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  67   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  126

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  127  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  163



>ref|XP_006924183.1| PREDICTED: fumarate hydratase, mitochondrial [Pteropus alecto]
 gb|ELK02298.1| Fumarate hydratase, mitochondrial [Pteropus alecto]
Length=508

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  106

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG +
Sbjct  107  DYGLDPKIANAIMRAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGE  166

Query  520  RG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHE  203



>gb|KFP18053.1| hypothetical protein Z169_14841, partial [Egretta garzetta]
Length=466

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  125  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  161



>gb|KIK96362.1| hypothetical protein PAXRUDRAFT_826028 [Paxillus rubicundulus 
Ve08.2h10]
Length=492

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 141/178 (79%), Gaps = 6/178 (3%)
 Frame = +1

Query  109  ISSESLRYTVCWRYFSTS-----FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRE  273
            +S+  L      + FSTS     FR+ERDTFG +QVP+D+ WGAQTQRS+QNF+IGG  E
Sbjct  7    VSARVLHVKPQHKLFSTSTRVMSFRQERDTFGDLQVPADRYWGAQTQRSMQNFDIGGPTE  66

Query  274  RMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSG  453
            R+P P+I+AFG+LKK A+ VN+ YG++P+IG+A+ +AA EV  GKL DHFPLV++QTGSG
Sbjct  67   RLPPPLIKAFGVLKKAASVVNVGYGMDPTIGEAIQKAADEVISGKLIDHFPLVVFQTGSG  126

Query  454  TQSNMNANEVIANRAAEILGHKRG-EKGVHPNDHVNRSQSSNDTFPTVMHIAAAMEIN  624
            TQSNMN NEVI+NRA E+LG + G +K VHPNDHVN SQSSNDTFPT MH+AA  EI+
Sbjct  127  TQSNMNVNEVISNRAIELLGGELGSKKPVHPNDHVNMSQSSNDTFPTAMHVAAVTEIH  184



>gb|KFV39301.1| hypothetical protein N341_12919, partial [Tyto alba]
Length=467

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  65

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  66   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  125

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  126  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  162



>ref|XP_003439886.2| PREDICTED: fumarate hydratase, mitochondrial-like [Oreochromis 
niloticus]
Length=499

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 139/173 (80%), Gaps = 2/173 (1%)
 Frame = +1

Query  115  SESLRYTVCW-RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPI  291
            S + ++ +C  R  S+ +R ERDTFG ++VP+DK +GAQT RS  NF+IGG  ERMP  +
Sbjct  22   SATSKFHICTSRMASSDYRIERDTFGELKVPADKYYGAQTVRSTMNFKIGGPSERMPIQV  81

Query  292  IRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMN  471
            I+AFG+LKK AA+VN EYGL+P I +A++QAA EV+ GKL+DHFPLV+WQTGSGTQ+NMN
Sbjct  82   IKAFGVLKKAAAQVNKEYGLDPKIAEAIVQAADEVSAGKLDDHFPLVVWQTGSGTQTNMN  141

Query  472  ANEVIANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             NEVI+NRA EILG K G K  VHPNDHVN+SQSSNDTFPT MHIA A E+++
Sbjct  142  VNEVISNRAIEILGGKLGSKDPVHPNDHVNKSQSSNDTFPTAMHIAVATEVHQ  194



>ref|XP_008489569.1| PREDICTED: fumarate hydratase, mitochondrial [Calypte anna]
Length=474

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  13   AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  72

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  73   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  132

Query  520  RGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  133  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  169



>ref|XP_008295685.1| PREDICTED: fumarate hydratase, mitochondrial [Stegastes partitus]
Length=499

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 135/169 (80%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  RYTVCWRYFSTS-FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  303
            +  +C    + S FR ERDTFG ++VP+D+ +GAQT RS  NF+IGG  ERMP P+I+AF
Sbjct  26   KLLICTSAMAASEFRIERDTFGELKVPADRYYGAQTVRSTMNFKIGGPTERMPLPVIKAF  85

Query  304  GILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  483
            GILK+ AA+VN +YGL P I  A++QAA EVA GKL+DHFPLV+WQTGSGTQ+NMN NEV
Sbjct  86   GILKRAAAEVNKDYGLNPKIADAIVQAADEVAAGKLDDHFPLVVWQTGSGTQTNMNVNEV  145

Query  484  IANRAAEILGHKRGEKG-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
            I+NRA EILG K G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+++
Sbjct  146  ISNRAIEILGGKLGSKDPVHPNDHVNKSQSSNDTFPTAMHIAAATEVHQ  194



>gb|KFW11876.1| hypothetical protein N326_13222, partial [Eurypyga helias]
Length=466

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +1

Query  160  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  339
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  340  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  519
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  520  RGEK-GVHPNDHVNRSQSSNDTFPTVMHIAAAMEINK  627
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+
Sbjct  125  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNE  161



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250