BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF018G01

Length=565
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010266868.1|  PREDICTED: probable 26S proteasome non-ATPas...    233   2e-70   Nelumbo nucifera [Indian lotus]
sp|P93768.1|PSMD3_TOBAC  RecName: Full=Probable 26S proteasome no...    232   5e-70   Nicotiana tabacum [American tobacco]
ref|XP_009773689.1|  PREDICTED: probable 26S proteasome non-ATPas...    230   2e-69   Nicotiana sylvestris
ref|XP_009628272.1|  PREDICTED: probable 26S proteasome non-ATPas...    229   4e-69   Nicotiana tomentosiformis
emb|CBI37854.3|  unnamed protein product                                221   3e-66   Vitis vinifera
ref|XP_002279715.1|  PREDICTED: probable 26S proteasome non-ATPas...    221   6e-66   Vitis vinifera
ref|XP_010266036.1|  PREDICTED: probable 26S proteasome non-ATPas...    220   2e-65   Nelumbo nucifera [Indian lotus]
ref|XP_002285893.1|  PREDICTED: probable 26S proteasome non-ATPas...    219   2e-65   Vitis vinifera
ref|XP_004231054.1|  PREDICTED: probable 26S proteasome non-ATPas...    219   5e-65   
ref|XP_011088624.1|  PREDICTED: probable 26S proteasome non-ATPas...    219   5e-65   Sesamum indicum [beniseed]
ref|XP_009623855.1|  PREDICTED: probable 26S proteasome non-ATPas...    219   6e-65   Nicotiana tomentosiformis
emb|CDP19574.1|  unnamed protein product                                218   2e-64   Coffea canephora [robusta coffee]
ref|XP_009799469.1|  PREDICTED: probable 26S proteasome non-ATPas...    215   1e-63   Nicotiana sylvestris
sp|Q06364.2|PSMD3_DAUCA  RecName: Full=Probable 26S proteasome no...    215   2e-63   Daucus carota [carrots]
dbj|BAA02696.1|  21D7 antigen                                           214   4e-63   Daucus carota [carrots]
ref|XP_009382042.1|  PREDICTED: probable 26S proteasome non-ATPas...    208   5e-63   
emb|CDO98056.1|  unnamed protein product                                213   1e-62   Coffea canephora [robusta coffee]
ref|XP_010063310.1|  PREDICTED: probable 26S proteasome non-ATPas...    211   3e-62   Eucalyptus grandis [rose gum]
gb|KJB47689.1|  hypothetical protein B456_008G037000                    211   3e-62   Gossypium raimondii
ref|XP_011092961.1|  PREDICTED: probable 26S proteasome non-ATPas...    210   9e-62   Sesamum indicum [beniseed]
gb|EYU37968.1|  hypothetical protein MIMGU_mgv1a005284mg                209   2e-61   Erythranthe guttata [common monkey flower]
gb|KHG11096.1|  putative 26S proteasome non-ATPase regulatory sub...    208   3e-61   Gossypium arboreum [tree cotton]
ref|XP_009382040.1|  PREDICTED: probable 26S proteasome non-ATPas...    208   6e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004290733.1|  PREDICTED: probable 26S proteasome non-ATPas...    206   4e-60   Fragaria vesca subsp. vesca
ref|XP_006855514.1|  hypothetical protein AMTR_s00057p00205760          206   4e-60   Amborella trichopoda
ref|XP_006422568.1|  hypothetical protein CICLE_v10028313mg             205   9e-60   Citrus clementina [clementine]
ref|XP_003527532.1|  PREDICTED: probable 26S proteasome non-ATPas...    204   1e-59   Glycine max [soybeans]
gb|KHN09062.1|  Putative 26S proteasome non-ATPase regulatory sub...    204   2e-59   Glycine soja [wild soybean]
ref|XP_007041788.1|  PAM domain (PCI/PINT associated module) prot...    202   1e-58   
gb|KDP29682.1|  hypothetical protein JCGZ_18844                         202   2e-58   Jatropha curcas
ref|XP_010933362.1|  PREDICTED: probable 26S proteasome non-ATPas...    200   9e-58   Elaeis guineensis
gb|KHN45952.1|  Putative 26S proteasome non-ATPase regulatory sub...    199   2e-57   Glycine soja [wild soybean]
ref|XP_003523322.1|  PREDICTED: probable 26S proteasome non-ATPas...    199   2e-57   Glycine max [soybeans]
gb|KJB15843.1|  hypothetical protein B456_002G199200                    196   2e-56   Gossypium raimondii
gb|KHG18147.1|  putative 26S proteasome non-ATPase regulatory sub...    194   8e-56   Gossypium arboreum [tree cotton]
ref|XP_002306189.1|  26S proteasome regulatory subunit S3 family ...    194   1e-55   Populus trichocarpa [western balsam poplar]
ref|XP_007136115.1|  hypothetical protein PHAVU_009G019100g             194   1e-55   Phaseolus vulgaris [French bean]
ref|XP_010536429.1|  PREDICTED: 26S proteasome non-ATPase regulat...    194   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_009401896.1|  PREDICTED: probable 26S proteasome non-ATPas...    193   3e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009355646.1|  PREDICTED: probable 26S proteasome non-ATPas...    192   6e-55   Pyrus x bretschneideri [bai li]
ref|XP_011045871.1|  PREDICTED: probable 26S proteasome non-ATPas...    192   6e-55   Populus euphratica
ref|XP_007200984.1|  hypothetical protein PRUPE_ppa004807mg             192   7e-55   Prunus persica
ref|XP_008236045.1|  PREDICTED: probable 26S proteasome non-ATPas...    190   4e-54   Prunus mume [ume]
ref|XP_010920092.1|  PREDICTED: probable 26S proteasome non-ATPas...    189   7e-54   Elaeis guineensis
ref|XP_002521275.1|  26S proteasome regulatory subunit S3, putative     189   8e-54   Ricinus communis
ref|XP_003603813.1|  26S proteasome non-ATPase regulatory subunit       189   8e-54   Medicago truncatula
ref|XP_011046661.1|  PREDICTED: probable 26S proteasome non-ATPas...    189   1e-53   Populus euphratica
ref|XP_002312950.2|  26S proteasome regulatory subunit S3 family ...    188   2e-53   
ref|XP_009413027.1|  PREDICTED: probable 26S proteasome non-ATPas...    188   2e-53   
gb|EYU22574.1|  hypothetical protein MIMGU_mgv1a005362mg                187   5e-53   Erythranthe guttata [common monkey flower]
ref|XP_010935159.1|  PREDICTED: probable 26S proteasome non-ATPas...    187   6e-53   Elaeis guineensis
ref|XP_006302193.1|  hypothetical protein CARUB_v10020202mg             185   4e-52   Capsella rubella
ref|XP_008382101.1|  PREDICTED: probable 26S proteasome non-ATPas...    185   4e-52   Malus domestica [apple tree]
ref|XP_008809439.1|  PREDICTED: probable 26S proteasome non-ATPas...    185   4e-52   Phoenix dactylifera
ref|XP_008377724.1|  PREDICTED: LOW QUALITY PROTEIN: probable 26S...    184   7e-52   
ref|XP_008806135.1|  PREDICTED: probable 26S proteasome non-ATPas...    184   7e-52   Phoenix dactylifera
ref|XP_010416506.1|  PREDICTED: 26S proteasome non-ATPase regulat...    184   8e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006390248.1|  hypothetical protein EUTSA_v10018459mg             184   8e-52   Eutrema salsugineum [saltwater cress]
ref|XP_010107643.1|  putative 26S proteasome non-ATPase regulator...    183   1e-51   Morus notabilis
ref|XP_010428646.1|  PREDICTED: 26S proteasome non-ATPase regulat...    183   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_004500920.1|  PREDICTED: probable 26S proteasome non-ATPas...    182   4e-51   Cicer arietinum [garbanzo]
ref|NP_177726.1|  probable 26S proteasome non-ATPase regulatory s...    182   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893093.1|  EMB2719                                            182   5e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_009106250.1|  PREDICTED: 26S proteasome non-ATPase regulat...    182   6e-51   Brassica rapa
ref|XP_002889051.1|  hypothetical protein ARALYDRAFT_476749             181   7e-51   
ref|XP_004162914.1|  PREDICTED: probable 26S proteasome non-ATPas...    173   8e-51   
ref|XP_010471748.1|  PREDICTED: 26S proteasome non-ATPase regulat...    181   9e-51   
gb|KFK42036.1|  hypothetical protein AALP_AA2G203500                    181   1e-50   Arabis alpina [alpine rockcress]
ref|XP_004154161.1|  PREDICTED: probable 26S proteasome non-ATPas...    174   1e-50   
gb|AAL09760.1|  At1g20200/T20H2_4                                       178   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007222347.1|  hypothetical protein PRUPE_ppa004821mg             181   2e-50   Prunus persica
ref|XP_008447941.1|  PREDICTED: probable 26S proteasome non-ATPas...    180   2e-50   Cucumis melo [Oriental melon]
ref|XP_006416422.1|  hypothetical protein EUTSA_v10007479mg             180   2e-50   Eutrema salsugineum [saltwater cress]
ref|XP_002510590.1|  26S proteasome regulatory subunit S3, putative     180   2e-50   Ricinus communis
ref|XP_008811676.1|  PREDICTED: probable 26S proteasome non-ATPas...    179   4e-50   Phoenix dactylifera
ref|XP_008221216.1|  PREDICTED: probable 26S proteasome non-ATPas...    179   8e-50   Prunus mume [ume]
ref|XP_008221217.1|  PREDICTED: probable 26S proteasome non-ATPas...    179   8e-50   Prunus mume [ume]
ref|NP_173447.1|  probable 26S proteasome non-ATPase regulatory s...    179   9e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477252.1|  PREDICTED: 26S proteasome non-ATPase regulat...    179   9e-50   Camelina sativa [gold-of-pleasure]
ref|XP_004499304.1|  PREDICTED: probable 26S proteasome non-ATPas...    178   1e-49   Cicer arietinum [garbanzo]
ref|XP_010459703.1|  PREDICTED: 26S proteasome non-ATPase regulat...    178   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_003550437.1|  PREDICTED: probable 26S proteasome non-ATPas...    177   2e-49   Glycine max [soybeans]
ref|XP_006601362.1|  PREDICTED: probable 26S proteasome non-ATPas...    177   2e-49   
gb|AAM53298.1|  putative proteasome regulatory subunit S3               177   3e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73215.1|  BnaC06g36630D                                          176   7e-49   
ref|XP_010498455.1|  PREDICTED: 26S proteasome non-ATPase regulat...    176   8e-49   Camelina sativa [gold-of-pleasure]
ref|XP_004145004.1|  PREDICTED: probable 26S proteasome non-ATPas...    175   2e-48   Cucumis sativus [cucumbers]
ref|XP_004144854.1|  PREDICTED: probable 26S proteasome non-ATPas...    173   1e-47   Cucumis sativus [cucumbers]
ref|XP_006307354.1|  hypothetical protein CARUB_v10008972mg             172   2e-47   Capsella rubella
ref|XP_007160631.1|  hypothetical protein PHAVU_001G003600g             172   2e-47   Phaseolus vulgaris [French bean]
gb|KDO68111.1|  hypothetical protein CISIN_1g011352mg                   171   4e-47   Citrus sinensis [apfelsine]
ref|XP_008460112.1|  PREDICTED: probable 26S proteasome non-ATPas...    171   6e-47   Cucumis melo [Oriental melon]
ref|XP_007017884.1|  PAM domain protein isoform 3                       166   1e-46   
ref|XP_003589555.1|  26S proteasome non-ATPase regulatory subunit       170   1e-46   Medicago truncatula
gb|AAF26768.2|AC007396_17  T4O12.21                                     170   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017883.1|  PAM domain protein isoform 2                       167   3e-46   
ref|XP_008347374.1|  PREDICTED: probable 26S proteasome non-ATPas...    163   5e-46   
gb|AAF79894.1|AC022472_3  Contains similarity to 26s proteasome r...    168   8e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009773690.1|  PREDICTED: probable 26S proteasome non-ATPas...    168   1e-45   Nicotiana sylvestris
ref|XP_007017885.1|  PAM domain (PCI/PINT associated module) prot...    167   2e-45   
ref|XP_007017882.1|  PAM domain (PCI/PINT associated module) prot...    167   2e-45   
ref|XP_003545019.1|  PREDICTED: probable 26S proteasome non-ATPas...    167   2e-45   Glycine max [soybeans]
emb|CDX87648.1|  BnaA07g32250D                                          167   2e-45   
ref|XP_009773691.1|  PREDICTED: probable 26S proteasome non-ATPas...    164   3e-44   Nicotiana sylvestris
gb|KJB15844.1|  hypothetical protein B456_002G199200                    162   4e-44   Gossypium raimondii
gb|EPS67790.1|  hypothetical protein M569_06981                         163   5e-44   Genlisea aurea
gb|AFW65683.1|  hypothetical protein ZEAMMB73_847170                    157   7e-43   
ref|XP_010666922.1|  PREDICTED: probable 26S proteasome non-ATPas...    159   1e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009628273.1|  PREDICTED: probable 26S proteasome non-ATPas...    159   2e-42   Nicotiana tomentosiformis
emb|CDY31901.1|  BnaC07g15510D                                          153   4e-42   Brassica napus [oilseed rape]
ref|NP_001149170.1|  26S proteasome non-ATPase regulatory subunit 3     157   6e-42   Zea mays [maize]
gb|ACN28097.1|  unknown                                                 157   6e-42   Zea mays [maize]
ref|XP_004231453.1|  PREDICTED: probable 26S proteasome non-ATPas...    156   2e-41   Solanum lycopersicum
ref|XP_009628274.1|  PREDICTED: probable 26S proteasome non-ATPas...    155   6e-41   Nicotiana tomentosiformis
gb|ACA51024.1|  proteasome regulatory subunit S3                        149   8e-41   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09931.1|  hypothetical protein OsI_32229                          151   9e-40   Oryza sativa Indica Group [Indian rice]
ref|NP_001063817.1|  Os09g0541900                                       150   3e-39   
ref|XP_006660365.1|  PREDICTED: probable 26S proteasome non-ATPas...    150   3e-39   Oryza brachyantha
gb|EEE69116.1|  hypothetical protein OsJ_28197                          149   4e-39   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062444.1|  Os08g0550100                                       149   6e-39   
ref|XP_004974153.1|  PREDICTED: probable 26S proteasome non-ATPas...    149   7e-39   Setaria italica
gb|EMT22108.1|  Putative 26S proteasome non-ATPase regulatory sub...    149   1e-38   
ref|XP_010229049.1|  PREDICTED: probable 26S proteasome non-ATPas...    148   1e-38   
gb|ABR16257.1|  unknown                                                 147   3e-38   Picea sitchensis
dbj|BAK01467.1|  predicted protein                                      147   3e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK07086.1|  predicted protein                                      147   5e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90869.1|  predicted protein                                      147   6e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002444618.1|  hypothetical protein SORBIDRAFT_07g024800          146   9e-38   Sorghum bicolor [broomcorn]
gb|ACG34075.1|  26S proteasome non-ATPase regulatory subunit 3          146   9e-38   Zea mays [maize]
ref|XP_004957510.1|  PREDICTED: probable 26S proteasome non-ATPas...    145   1e-37   Setaria italica
gb|ACF84535.1|  unknown                                                 144   4e-37   Zea mays [maize]
ref|NP_001149380.1|  LOC100283005                                       144   5e-37   Zea mays [maize]
ref|XP_010446200.1|  PREDICTED: 26S proteasome non-ATPase regulat...    141   4e-36   Camelina sativa [gold-of-pleasure]
emb|CDY54330.1|  BnaCnng26760D                                          137   3e-35   Brassica napus [oilseed rape]
ref|XP_002300686.1|  26S proteasome regulatory subunit S3 family ...    133   5e-33   Populus trichocarpa [western balsam poplar]
ref|XP_003578544.1|  PREDICTED: probable 26S proteasome non-ATPas...    131   2e-32   Brachypodium distachyon [annual false brome]
ref|XP_011034975.1|  PREDICTED: probable 26S proteasome non-ATPas...    124   4e-30   Populus euphratica
ref|XP_011034972.1|  PREDICTED: probable 26S proteasome non-ATPas...    124   5e-30   Populus euphratica
ref|XP_011034976.1|  PREDICTED: probable 26S proteasome non-ATPas...    124   5e-30   Populus euphratica
dbj|BAB78499.1|  26S proteasome regulatory particle non-ATPase su...    119   2e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CDM82954.1|  unnamed protein product                                112   7e-27   Triticum aestivum [Canadian hard winter wheat]
gb|EMS49644.1|  putative 26S proteasome non-ATPase regulatory sub...    115   9e-27   Triticum urartu
ref|XP_001764054.1|  predicted protein                                  109   1e-24   
gb|EMS46362.1|  putative 26S proteasome non-ATPase regulatory sub...    109   4e-24   Triticum urartu
gb|EMT33081.1|  Putative 26S proteasome non-ATPase regulatory sub...    107   1e-23   
ref|XP_002970446.1|  hypothetical protein SELMODRAFT_231540             105   2e-23   
ref|XP_001757567.1|  predicted protein                                  104   1e-22   
ref|XP_001753136.1|  predicted protein                                  103   2e-22   
gb|KEH36262.1|  26S proteasome non-ATPase regulatory subunit 3        99.8    2e-21   Medicago truncatula
ref|XP_006660915.1|  PREDICTED: probable 26S proteasome non-ATPas...  94.7    1e-19   
dbj|BAG87837.1|  unnamed protein product                              93.6    2e-19   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG94867.1|  unnamed protein product                              92.8    6e-19   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK06811.1|  predicted protein                                    86.7    8e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006386166.1|  hypothetical protein POPTR_0002s01940g           87.0    1e-16   
gb|KEH36263.1|  26S proteasome non-ATPase regulatory subunit 3        85.1    6e-16   Medicago truncatula
ref|XP_010446093.1|  PREDICTED: 26S proteasome non-ATPase regulat...  80.9    1e-14   
ref|XP_003588288.1|  26S proteasome subunit RPN3a                     72.4    3e-13   
gb|AFW65682.1|  hypothetical protein ZEAMMB73_847170                  67.0    4e-11   
ref|XP_002945863.1|  26S proteasome regulatory complex                70.1    9e-11   Volvox carteri f. nagariensis
ref|XP_004354913.1|  26S proteasome regulatory subunit S3             64.7    4e-09   Cavenderia fasciculata
ref|XP_001696175.1|  26S proteasome regulatory subunit                63.9    9e-09   Chlamydomonas reinhardtii
ref|XP_001134521.1|  26S proteasome regulatory subunit S3             62.4    3e-08   Dictyostelium discoideum AX4
ref|XP_011034977.1|  PREDICTED: probable 26S proteasome non-ATPas...  61.6    4e-08   Populus euphratica
ref|XP_005649181.1|  26S proteasome regulatory subunit                61.2    8e-08   Coccomyxa subellipsoidea C-169
ref|XP_003290828.1|  hypothetical protein DICPUDRAFT_98819            59.7    2e-07   Dictyostelium purpureum
gb|EEC83998.1|  hypothetical protein OsI_30168                        58.9    3e-07   Oryza sativa Indica Group [Indian rice]
gb|EIF46605.1|  proteasome regulatory particle subunit                57.4    1e-06   Brettanomyces bruxellensis AWRI1499
ref|XP_006383748.1|  hypothetical protein POPTR_0005s26560g           56.2    2e-06   
gb|KHJ49054.1|  hypothetical protein D918_00172                       56.6    2e-06   Trichuris suis
gb|KFD53466.1|  hypothetical protein M513_05730                       56.6    3e-06   Trichuris suis
ref|XP_007340608.1|  diphenol oxidase-A2                              54.7    1e-05   
ref|XP_003074100.1|  putative nuclear antigen 21D7 (ISS)              53.9    2e-05   
dbj|GAM26028.1|  hypothetical protein SAMD00019534_092030             53.5    2e-05   Acytostelium subglobosum LB1
emb|CEF96488.1|  26S proteasome regulatory subunit, C-terminal        53.1    3e-05   Ostreococcus tauri
ref|XP_008815694.1|  26S proteasome regulatory subunit N3             52.4    5e-05   Plasmodium inui San Antonio 1
ref|XP_007869404.1|  PCI-domain-containing protein                    52.4    6e-05   Gloeophyllum trabeum ATCC 11539
ref|XP_971686.1|  PREDICTED: probable 26S proteasome non-ATPase r...  52.0    7e-05   Tribolium castaneum [rust-red flour beetle]
ref|XP_002259967.1|  proteasome regulatory component                  52.0    7e-05   Plasmodium knowlesi strain H
ref|XP_002967101.1|  hypothetical protein SELMODRAFT_408501           50.4    8e-05   
ref|XP_004223628.1|  26S proteasome non-ATPase regulatory subunit 3   51.6    9e-05   Plasmodium cynomolgi strain B
ref|XP_001614166.1|  26S proteasome non-ATPase regulatory subunit 3   50.8    2e-04   Plasmodium vivax
ref|XP_004340207.1|  proteasome (prosome, macropain) 26S subunit,...  50.8    2e-04   Acanthamoeba castellanii str. Neff
ref|XP_002595252.1|  hypothetical protein BRAFLDRAFT_268075           50.4    3e-04   Branchiostoma floridae
gb|ESA00649.1|  hypothetical protein GLOINDRAFT_338417                50.1    3e-04   
ref|XP_008665628.1|  PREDICTED: probable 26S proteasome non-ATPas...  47.4    3e-04   
gb|EXX77250.1|  proteasome regulatory particle lid subunit RPN3       50.1    3e-04   Rhizophagus irregularis DAOM 197198w
ref|XP_002733522.1|  PREDICTED: 26S proteasome non-ATPase regulat...  50.1    4e-04   Saccoglossus kowalevskii
ref|XP_009062478.1|  hypothetical protein LOTGIDRAFT_207043           50.1    4e-04   Lottia gigantea
ref|XP_006814940.1|  PREDICTED: 26S proteasome non-ATPase regulat...  50.1    4e-04   Saccoglossus kowalevskii
ref|XP_008473192.1|  PREDICTED: probable 26S proteasome non-ATPas...  49.3    6e-04   
gb|KHN76475.1|  26S proteasome non-ATPase regulatory subunit 3        49.3    6e-04   Toxocara canis
ref|XP_005850128.1|  hypothetical protein CHLNCDRAFT_20545            48.9    0.001   Chlorella variabilis



>ref|XP_010266868.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nelumbo nucifera]
 ref|XP_010266869.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nelumbo nucifera]
Length=488

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 138/154 (90%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKE  PA SNSVSST PS  QHLK+IASLIETGAYAREVRRI RAVRLT+ALR+
Sbjct  1    MTQDVEMKEL-PAPSNSVSSTAPSTLQHLKEIASLIETGAYAREVRRIVRAVRLTIALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKA  L+AFLNF L+PGSE H RLSSYLPK DEHDMEVDTATSATQAPVKHS+PE+EIY
Sbjct  60   KLKAPVLSAFLNFALAPGSEAHIRLSSYLPKEDEHDMEVDTATSATQAPVKHSLPEIEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQKRY+EAK CSSASI RLK LNR
Sbjct  120  CYLLVLIFLIDQKRYNEAKICSSASIARLKNLNR  153



>sp|P93768.1|PSMD3_TOBAC RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 
3; Short=26S proteasome subunit S3; AltName: Full=26S 
proteasome regulatory subunit RPN3; AltName: Full=Nuclear antigen 
21D7 [Nicotiana tabacum]
 dbj|BAA19252.1| 21D7 [Nicotiana tabacum]
Length=488

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQ    SNS+SST PS+F HLK+IASLIETGAYAREVRRI+RAVRLTMALRK
Sbjct  1    MTQDVEMKEQAAPPSNSLSSTAPSIFHHLKEIASLIETGAYAREVRRISRAVRLTMALRK  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS+L+AFLN++L PGSEVHSRLSS+LPK DE DMEVDTATS  QAP+K+ +PELEIY
Sbjct  61   KLKASSLSAFLNYVLVPGSEVHSRLSSFLPKEDEQDMEVDTATSGAQAPIKNPLPELEIY  120

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK+Y+EAKACSSASI RLKT+NR
Sbjct  121  CYLLVLIFLIDQKKYNEAKACSSASIARLKTVNR  154



>ref|XP_009773689.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Nicotiana sylvestris]
Length=488

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQ    SNS+SST PS+F HLK+IASLIETGAYAREVRRI+RAVRLTMALRK
Sbjct  1    MTQDVEMKEQAAPPSNSLSSTAPSIFHHLKEIASLIETGAYAREVRRISRAVRLTMALRK  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS+L+AFLN++L PGSEVHSRLSS+LPK DE DMEVDTATS  QAP+K+ +PELEIY
Sbjct  61   KLKASSLSAFLNYVLVPGSEVHSRLSSFLPKEDEQDMEVDTATSGAQAPIKNPLPELEIY  120

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK+Y+EAKACSSASI RLK +NR
Sbjct  121  CYLLVLIFLIDQKKYNEAKACSSASIARLKAVNR  154



>ref|XP_009628272.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nicotiana tomentosiformis]
Length=488

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQ    SNS+SST PS+F HLK+IASLIETGAYAREVRRI+RAVRLTMALRK
Sbjct  1    MTQDVEMKEQAAPPSNSLSSTAPSIFHHLKEIASLIETGAYAREVRRISRAVRLTMALRK  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS+L+AFLN++L PGSEV+SRLSS+LPK DE DMEVDTATS  QAP+K+ +PELEIY
Sbjct  61   KLKASSLSAFLNYVLVPGSEVYSRLSSFLPKEDEQDMEVDTATSGAQAPIKNPLPELEIY  120

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK+Y+EAKACSSASI RLKT+NR
Sbjct  121  CYLLVLIFLIDQKKYNEAKACSSASIARLKTVNR  154



>emb|CBI37854.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKE  PA SNSV+ST PS  QHLK+IASLIE+ AYAREVRRI RA+RLTM LR+
Sbjct  1    MTQDVEMKEL-PAPSNSVTSTTPSTLQHLKEIASLIESSAYAREVRRIVRAIRLTMILRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKA+ L+ FLN+ L+PGSEVH+RLSSYLPK DEHDMEVDTATSATQ P KH +PELEIY
Sbjct  60   KLKATVLSGFLNYALNPGSEVHTRLSSYLPKEDEHDMEVDTATSATQTPAKHPLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK+Y EAKACS+ASI RLK LNR
Sbjct  120  CYLLVLIFLIDQKKYKEAKACSAASITRLKNLNR  153



>ref|XP_002279715.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Vitis vinifera]
 ref|XP_010646732.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Vitis vinifera]
Length=487

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKE  PA SNSV+ST PS  QHLK+IASLIE+ AYAREVRRI RA+RLTM LR+
Sbjct  1    MTQDVEMKEL-PAPSNSVTSTTPSTLQHLKEIASLIESSAYAREVRRIVRAIRLTMILRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKA+ L+ FLN+ L+PGSEVH+RLSSYLPK DEHDMEVDTATSATQ P KH +PELEIY
Sbjct  60   KLKATVLSGFLNYALNPGSEVHTRLSSYLPKEDEHDMEVDTATSATQTPAKHPLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK+Y EAKACS+ASI RLK LNR
Sbjct  120  CYLLVLIFLIDQKKYKEAKACSAASITRLKNLNR  153



>ref|XP_010266036.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nelumbo nucifera]
Length=488

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 132/154 (86%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKE  PA SN VSST P   QHLK+I SLIETGAYAREVRRI RAVRLTMALR+
Sbjct  1    MTQDVEMKEL-PAPSNFVSSTVPPTLQHLKEITSLIETGAYAREVRRIVRAVRLTMALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            +LKA  L+AFLNF L PGSE H RLSSYLPKGDEH MEVDTA S TQ PVKHS+PELEIY
Sbjct  60   RLKAPVLSAFLNFALVPGSEAHIRLSSYLPKGDEHAMEVDTAPSTTQTPVKHSLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQKRY+EAK+CSSASI RLK LNR
Sbjct  120  CYLLVLIFLIDQKRYNEAKSCSSASIARLKNLNR  153



>ref|XP_002285893.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Vitis vinifera]
 emb|CBI18933.3| unnamed protein product [Vitis vinifera]
Length=487

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK++  A SNSVSSTGPS    LK+IASLIETG+Y +EVRRI RA+RLTMALR+
Sbjct  1    MTQDVEMKDR-TAPSNSVSSTGPSTLHQLKEIASLIETGSYTKEVRRIVRAIRLTMALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLK   L+AFL+F L P SE HSRLS+YLPK DEHDMEVDTATSA QAPVKH VPELEIY
Sbjct  60   KLKVPVLSAFLDFALVPVSEAHSRLSAYLPKEDEHDMEVDTATSADQAPVKHLVPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVL+FLIDQK+Y+EAKACSSASIVRLK LNR
Sbjct  120  CYLLVLVFLIDQKKYNEAKACSSASIVRLKNLNR  153



>ref|XP_004231054.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Solanum lycopersicum]
Length=487

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEM +Q P  S S+SS  PSV  HLK+IASLIETGAYAREVRRI+RAVRLTM LRK
Sbjct  1    MTQDVEMADQAPP-SKSLSSADPSVLPHLKEIASLIETGAYAREVRRISRAVRLTMVLRK  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS+L AFLNF+L PGS+VHSRLSS+LPK DEHDMEVD+ATS T A VKHS+PELEIY
Sbjct  60   KLKASSLGAFLNFVLVPGSDVHSRLSSFLPKEDEHDMEVDSATSGTLASVKHSLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK+Y EAKACSSASI RLKT+NR
Sbjct  120  CYLLVLIFLIDQKKYDEAKACSSASIARLKTVNR  153



>ref|XP_011088624.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Sesamum indicum]
Length=488

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQ PA SNS+SST PS  QHLKDIA+LIETGAY REVRRI RA+R T+ LRK
Sbjct  1    MTQDVEMKEQHPAPSNSLSSTSPSTLQHLKDIAALIETGAYTREVRRIVRAIRWTIQLRK  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS L AFLNF+L PGS+ HSR+SSY+PK DEHDMEVDTATSA QAP KHS+PELEIY
Sbjct  61   KLKASVLPAFLNFVLVPGSDAHSRMSSYVPKEDEHDMEVDTATSAAQAPAKHSLPELEIY  120

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLL+LIFLIDQKRYSEAKACSSASI RL+ LNR
Sbjct  121  CYLLILIFLIDQKRYSEAKACSSASIARLRNLNR  154



>ref|XP_009623855.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nicotiana tomentosiformis]
Length=491

 Score =   219 bits (557),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 138/155 (89%), Gaps = 2/155 (1%)
 Frame = +3

Query  105  TQDVEMKEQQPAL-SNSVSSTG-PSVFQHLKDIASLIETGayarevrriaravrLTMALR  278
            TQDVEM EQ  A  SNSVSSTG PSV  HLK+IASLIE+GAYAREVRRIARAVRLTMALR
Sbjct  3    TQDVEMIEQGAAAPSNSVSSTGGPSVLHHLKEIASLIESGAYAREVRRIARAVRLTMALR  62

Query  279  KKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEI  458
            KKLKAS L+AFLN+ L P SE+HSRLSSYLP  DEHDMEVDTATSA+QAP KH +PELEI
Sbjct  63   KKLKASVLSAFLNYALVPRSEMHSRLSSYLPTEDEHDMEVDTATSASQAPAKHPLPELEI  122

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCYLLVLIFLIDQK+Y+EAKACSSASI RLKT+NR
Sbjct  123  YCYLLVLIFLIDQKKYNEAKACSSASIARLKTVNR  157



>emb|CDP19574.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQ PA SNSV+ T PS  QHLK+IASLIETGAYAREVRRI RAVRLT+ALRK
Sbjct  1    MTQDVEMKEQ-PATSNSVTLTAPSTLQHLKEIASLIETGAYAREVRRIVRAVRLTIALRK  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS ++AFL   L+PGSEVHSRLSSY+PK DEH+MEVDTATSATQAP KHS+PELEIY
Sbjct  60   KLKASVISAFLTHTLTPGSEVHSRLSSYIPKDDEHEMEVDTATSATQAPTKHSLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
              LLVLIFLIDQKRY+EAKAC+SA I RLK  N+
Sbjct  120  SCLLVLIFLIDQKRYNEAKACASAGIGRLKNFNK  153



>ref|XP_009799469.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nicotiana sylvestris]
Length=491

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 136/155 (88%), Gaps = 2/155 (1%)
 Frame = +3

Query  105  TQDVEMKEQQPAL-SNSVSSTG-PSVFQHLKDIASLIETGayarevrriaravrLTMALR  278
            TQDVEM EQ  A  SNSVSSTG PSV  HLK+IASLIE+GAYAREVRRIARAVRLTMALR
Sbjct  3    TQDVEMIEQAAAAPSNSVSSTGGPSVLHHLKEIASLIESGAYAREVRRIARAVRLTMALR  62

Query  279  KKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEI  458
            KKLK S  +AFLN+ L P SEVHS+LSSYLP  DEHDMEVDTATSA+QAP KH +PELEI
Sbjct  63   KKLKGSVFSAFLNYALVPRSEVHSQLSSYLPTEDEHDMEVDTATSASQAPAKHPLPELEI  122

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCYLLVLIFLIDQK+Y+EAKACSSASI RLKT+NR
Sbjct  123  YCYLLVLIFLIDQKKYNEAKACSSASIARLKTVNR  157



>sp|Q06364.2|PSMD3_DAUCA RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 
3; Short=26S proteasome subunit S3; AltName: Full=26S 
proteasome regulatory subunit RPN3; AltName: Full=Nuclear antigen 
21D7 [Daucus carota]
Length=489

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  MTQDVEMKE-QQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALR  278
            MTQDVEMKE   PA SNSV++  PS  QHLK+IASLIE+GAYAREVRRI RAVRLT+ALR
Sbjct  1    MTQDVEMKEVPAPAPSNSVTAATPSTLQHLKEIASLIESGAYAREVRRILRAVRLTIALR  60

Query  279  KKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEI  458
            KKL AS + AFLNF L PGSEVH+RL+SYLPK DEHDMEVDTA SAT    KHS+PELEI
Sbjct  61   KKLNASVVNAFLNFSLVPGSEVHARLASYLPKEDEHDMEVDTAMSATTTLAKHSLPELEI  120

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCYLLVLIFLIDQK+YSEAKACSSASI R+K LNR
Sbjct  121  YCYLLVLIFLIDQKKYSEAKACSSASIARVKNLNR  155



>dbj|BAA02696.1| 21D7 antigen [Daucus carota]
Length=488

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  MTQDVEMKE-QQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALR  278
            MTQDVEMKE   PA SNSV++  PS  QHLK+IASLIE+GAYAREVRRI RAVRLT+ALR
Sbjct  1    MTQDVEMKEVPAPAPSNSVTAATPSTLQHLKEIASLIESGAYAREVRRILRAVRLTIALR  60

Query  279  KKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEI  458
            KKL AS + AFLNF L PGSEVH+RL+SYLPK DEHDMEVDTA SAT    KHS+PELEI
Sbjct  61   KKLNASVVNAFLNFSLVPGSEVHARLASYLPKEDEHDMEVDTAMSATTTLAKHSLPELEI  120

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCYLLVLIFLIDQK+YSEAKACSSASI R+K LNR
Sbjct  121  YCYLLVLIFLIDQKKYSEAKACSSASIARVKNLNR  155



>ref|XP_009382042.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   208 bits (530),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTG-PSVFQHLKDIASLIETGayarevrriaravrLTMALR  278
            MT DVEMKE Q ALSNSVSS   PS  QHLK+IASLIETGA A+EVRRI RAVRLTM LR
Sbjct  1    MTADVEMKEVQ-ALSNSVSSAAVPSTLQHLKEIASLIETGAQAKEVRRIVRAVRLTMMLR  59

Query  279  KKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEI  458
            +KL+AS ++AFL  +L+PGSEV ++LSSYLPK DEH+M+VDTA SA Q P KHS+PELEI
Sbjct  60   RKLRASVISAFLGHVLTPGSEVLAKLSSYLPKPDEHEMDVDTAASAVQGPAKHSIPELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCYLLVLIFLIDQKRY EAK CSSASI RL+ +NR
Sbjct  120  YCYLLVLIFLIDQKRYDEAKVCSSASIARLRNVNR  154



>emb|CDO98056.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 132/154 (86%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            M  DVEMKEQ PA SNSV+STGPS  QHLK+IASLIETG Y RE+RRI RAVRLT+ALRK
Sbjct  1    MPGDVEMKEQ-PAPSNSVTSTGPSTLQHLKEIASLIETGTYTREIRRIVRAVRLTIALRK  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL AS ++AF+ + L+ GSEVH+RLSSY+PK DEH+MEVDTATSA Q+P KHS+PELEIY
Sbjct  60   KLTASVISAFMTYALTHGSEVHTRLSSYIPKDDEHEMEVDTATSAVQSPSKHSLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
             YLLVLIFLIDQKRY+EAK C+SA I RLK LNR
Sbjct  120  SYLLVLIFLIDQKRYNEAKVCASAGIARLKNLNR  153



>ref|XP_010063310.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Eucalyptus grandis]
 gb|KCW70517.1| hypothetical protein EUGRSUZ_F03722 [Eucalyptus grandis]
Length=487

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 132/154 (86%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+  P  S+SVSS  PS  QHLK+IASLIETG+YA+E RRIARAVRLT+A RK
Sbjct  1    MTQDVEMKDH-PTPSHSVSSAVPSTLQHLKEIASLIETGSYAKEARRIARAVRLTIASRK  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL A  LTAFL++ L PGSE  SRLS+YLPK DEHDMEVDTA+SA QAP KH +PELEIY
Sbjct  60   KLTAPVLTAFLDYALGPGSEARSRLSTYLPKEDEHDMEVDTASSANQAPAKHVLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVL+FL DQKRY+EAKACSSASIVRLKTLNR
Sbjct  120  CYLLVLLFLSDQKRYNEAKACSSASIVRLKTLNR  153



>gb|KJB47689.1| hypothetical protein B456_008G037000 [Gossypium raimondii]
Length=484

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 132/154 (86%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQ  A SNS+ S  PS   HLK+IASLIETGAY REVRRI RA+RLTMALR+
Sbjct  1    MTQDVEMKEQ-AAPSNSLPSFSPSTLHHLKEIASLIETGAYDREVRRILRAIRLTMALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLK+S L+AFLNF L PGSE  +RLSSYLPK DEH MEVDTATSA QAP KHS+PE+EIY
Sbjct  60   KLKSSALSAFLNFTLIPGSEALTRLSSYLPKEDEHAMEVDTATSAPQAPAKHSLPEIEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVL+FLIDQK+Y+EAKACSSASI RLK +NR
Sbjct  120  CYLLVLMFLIDQKKYNEAKACSSASIARLKNINR  153



>ref|XP_011092961.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Sesamum indicum]
 ref|XP_011092962.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Sesamum indicum]
Length=488

 Score =   210 bits (535),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQQ A SNS+SST PS  QHLKDIA+ IETGAY REVRRI RA+R T+ LRK
Sbjct  1    MTQDVEMKEQQAAPSNSLSSTSPSTLQHLKDIAAWIETGAYTREVRRIVRAIRWTIQLRK  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL AS L+AFLNF L PGSEVHSRLSSY+PK DE DMEVDTATS TQAP KHS+PELEIY
Sbjct  61   KLNASVLSAFLNFSLVPGSEVHSRLSSYVPKEDEQDMEVDTATSTTQAPAKHSLPELEIY  120

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
             YLLVLIFLIDQKRY+EAKACSSASI RLK LNR
Sbjct  121  SYLLVLIFLIDQKRYNEAKACSSASIARLKNLNR  154



>gb|EYU37968.1| hypothetical protein MIMGU_mgv1a005284mg [Erythranthe guttata]
 gb|EYU37969.1| hypothetical protein MIMGU_mgv1a005284mg [Erythranthe guttata]
Length=490

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQ--PALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMAL  275
            MTQDVEMKEQQ  P  S+SV+   PS  Q+LKDIA+LIETGAY+REVRRI RA+R T+ L
Sbjct  1    MTQDVEMKEQQQQPTPSDSVAPPSPSTLQYLKDIAALIETGAYSREVRRIVRAIRWTIQL  60

Query  276  RKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELE  455
            RK L AS L+AFL+F L PGSEVHSRLSSY+PK D HDM+VD+ATS T AP KHS+PELE
Sbjct  61   RKNLNASVLSAFLSFALVPGSEVHSRLSSYVPKEDGHDMDVDSATSGTPAPTKHSLPELE  120

Query  456  IYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            I+CYL+VLIFLIDQKRYSEAKACSSASI RL+ LNR
Sbjct  121  IFCYLVVLIFLIDQKRYSEAKACSSASIARLRNLNR  156



>gb|KHG11096.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Gossypium 
arboreum]
Length=447

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQ  A SNS+ S  PS   HLK+IASLIETGAY REVRRI RA+RLTMALR+
Sbjct  1    MTQDVEMKEQ-AAPSNSLPSFSPSTLHHLKEIASLIETGAYDREVRRILRAIRLTMALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS L++FLNF L PGSE  +RLSS+LPK DEH MEVDTA SA QAP KHS+PE+EIY
Sbjct  60   KLKASALSSFLNFTLIPGSEALTRLSSFLPKEDEHAMEVDTAISAPQAPAKHSLPEIEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVL+FLIDQK+Y+EAKACSSASI RLK +NR
Sbjct  120  CYLLVLMFLIDQKKYNEAKACSSASIARLKNINR  153



>ref|XP_009382040.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009382041.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=488

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTG-PSVFQHLKDIASLIETGayarevrriaravrLTMALR  278
            MT DVEMKE Q ALSNSVSS   PS  QHLK+IASLIETGA A+EVRRI RAVRLTM LR
Sbjct  1    MTADVEMKEVQ-ALSNSVSSAAVPSTLQHLKEIASLIETGAQAKEVRRIVRAVRLTMMLR  59

Query  279  KKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEI  458
            +KL+AS ++AFL  +L+PGSEV ++LSSYLPK DEH+M+VDTA SA Q P KHS+PELEI
Sbjct  60   RKLRASVISAFLGHVLTPGSEVLAKLSSYLPKPDEHEMDVDTAASAVQGPAKHSIPELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCYLLVLIFLIDQKRY EAK CSSASI RL+ +NR
Sbjct  120  YCYLLVLIFLIDQKRYDEAKVCSSASIARLRNVNR  154



>ref|XP_004290733.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Fragaria vesca subsp. vesca]
Length=488

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKE   A SNSVSST P+   HLK+IASL+ET AY +EVRR+ RAVRLTMA R+
Sbjct  1    MTQDVEMKEVAAAPSNSVSSTTPTTLHHLKEIASLLETAAYTKEVRRVVRAVRLTMAKRR  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL  S L+AFL+F  SPGSE HSRLSSYLPK  +HDM+VDTATSA Q P KH+ PELEIY
Sbjct  61   KLSVSVLSAFLSFAFSPGSEAHSRLSSYLPKDADHDMDVDTATSAAQVPKKHASPELEIY  120

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK+YSEAKAC++A I RLK +NR
Sbjct  121  CYLLVLIFLIDQKKYSEAKACATAGIARLKNMNR  154



>ref|XP_006855514.1| hypothetical protein AMTR_s00057p00205760 [Amborella trichopoda]
 gb|ERN16981.1| hypothetical protein AMTR_s00057p00205760 [Amborella trichopoda]
Length=484

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKE  PA SNSVSS    V QHLK+IA+LIETGA+ +EVRR+ RAVR T+ALR+
Sbjct  1    MTQDVEMKEP-PAPSNSVSSAASPVLQHLKEIATLIETGAFTKEVRRVLRAVRHTIALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKA  L++FL+ +L+PGSEV  RL+SYLPK DEHDMEVDTA+S TQAP K+S+PELEIY
Sbjct  60   KLKAPVLSSFLHSVLAPGSEVFVRLTSYLPKDDEHDMEVDTASSGTQAPGKYSLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQKRY+EAK+CSSA+I R+K LNR
Sbjct  120  CYLLVLIFLIDQKRYNEAKSCSSAAITRVKQLNR  153



>ref|XP_006422568.1| hypothetical protein CICLE_v10028313mg [Citrus clementina]
 ref|XP_006486715.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Citrus sinensis]
 gb|ESR35808.1| hypothetical protein CICLE_v10028313mg [Citrus clementina]
 gb|KDO68110.1| hypothetical protein CISIN_1g011352mg [Citrus sinensis]
Length=488

 Score =   205 bits (521),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSST-GPSVFQHLKDIASLIETGayarevrriaravrLTMALR  278
            MTQDVEMK+++   SNS+SS   PS   HLK+IASL+ETGA+AREVRRI RAVRLTMALR
Sbjct  1    MTQDVEMKDKENP-SNSLSSPFTPSTLHHLKEIASLMETGAHAREVRRIMRAVRLTMALR  59

Query  279  KKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEI  458
            +KLKA  L+AFLNF L+PGSE HSRL SYLPK DEH+MEVDTA+S   AP KH +PELEI
Sbjct  60   RKLKAPVLSAFLNFALAPGSEAHSRLLSYLPKEDEHEMEVDTASSGAPAPAKHPLPELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCYLLVLIFLID+KRY+EAKACSSASI RLK +NR
Sbjct  120  YCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNR  154



>ref|XP_003527532.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Glycine max]
Length=487

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQD+EMK++    SNSVSS  PS  QHLK+IASLIETG+Y++EVRRIARAVRLT+ALR+
Sbjct  1    MTQDLEMKDRSTP-SNSVSSPAPSTLQHLKEIASLIETGSYSKEVRRIARAVRLTIALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL AS +++FL+ +L+PGSEVH++LS+YLPK D+H+MEVD ATSA Q P KH +PELEIY
Sbjct  60   KLTASAISSFLDHVLTPGSEVHAKLSAYLPKDDDHEMEVDAATSAIQTPAKHLLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVL+FLIDQK+YSEAKACSSASIV LK +NR
Sbjct  120  CYLLVLLFLIDQKKYSEAKACSSASIVWLKNINR  153



>gb|KHN09062.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=487

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQD+EMK++    SNSVSS  PS  QHLK+IASLIETG+Y++EVRRIARAVRLT+ALR+
Sbjct  1    MTQDLEMKDRSTP-SNSVSSPAPSTLQHLKEIASLIETGSYSKEVRRIARAVRLTIALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL AS +++FL+ +L+PGSEVH++LS+YLPK D+H+MEVD ATSA Q P KH +PELEIY
Sbjct  60   KLTASAISSFLDHVLTPGSEVHAKLSAYLPKEDDHEMEVDAATSAIQTPAKHLLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVL+FLIDQK+YSEAKACSSASIV LK +NR
Sbjct  120  CYLLVLLFLIDQKKYSEAKACSSASIVWLKNINR  153



>ref|XP_007041788.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 ref|XP_007041789.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 gb|EOX97619.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 gb|EOX97620.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
Length=484

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQ  A SNS+SS+ PS   HLK+IASLIETGAYAREVRRI RAVRLTMALR+
Sbjct  1    MTQDVEMKEQ-AAPSNSLSSSSPSTLHHLKEIASLIETGAYAREVRRILRAVRLTMALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS L+AFLNF L+PGSE  +RLSSYLP  DEH+MEVDTATSA QAP KHS+PELEIY
Sbjct  60   KLKASVLSAFLNFALTPGSEGLTRLSSYLPMEDEHEMEVDTATSAVQAPAKHSLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK+++EAKACSSASI RLK +NR
Sbjct  120  CYLLVLIFLIDQKKFNEAKACSSASIARLKNMNR  153



>gb|KDP29682.1| hypothetical protein JCGZ_18844 [Jatropha curcas]
Length=487

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQ PA SNS +S+ PS   HLK+IASLIETGAYAREVRRI RAVRLTMALR+
Sbjct  1    MTQDVEMKEQ-PAPSNSTTSSSPSTLHHLKEIASLIETGAYAREVRRIVRAVRLTMALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKA  L+AFLNF LSPGSE H+RL SYLPK DEH+MEVDTATS T A VKH +PELEIY
Sbjct  60   KLKAQVLSAFLNFALSPGSEPHNRLVSYLPKEDEHEMEVDTATSVTPALVKHPLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLI+LIDQK+Y+EAKACSSASI RLK +NR
Sbjct  120  CYLLVLIYLIDQKKYNEAKACSSASIARLKNVNR  153



>ref|XP_010933362.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Elaeis guineensis]
Length=488

 Score =   200 bits (508),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MT DVEMKE Q   ++  S+T  S  QHLK+I+SLIETGAYA+EVRRI RAVRLTM LR+
Sbjct  1    MTNDVEMKEVQAPSNSLSSATASSTLQHLKEISSLIETGAYAKEVRRIVRAVRLTMMLRR  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL+A+ ++AFL++ L+PGSE HSRLSS+LPK +EHDM+VDTATSA Q P K+S+PELEIY
Sbjct  61   KLRAAVVSAFLSYALAPGSEAHSRLSSFLPKDEEHDMDVDTATSAAQGPAKYSLPELEIY  120

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQKRY+EAKACSSASIVRLK +NR
Sbjct  121  CYLLVLIFLIDQKRYNEAKACSSASIVRLKNMNR  154



>gb|KHN45952.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=487

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQD+EM+++    SNSVS   PS  QHLK+IASLIETG+Y++EVRRIARAVRLT+ALR+
Sbjct  1    MTQDLEMRDRSTP-SNSVSLPAPSTLQHLKEIASLIETGSYSKEVRRIARAVRLTIALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL AS +++FL+ +L+PGSEVH++LS+YLPK D+H+MEVD ATSA Q P KH +PELEIY
Sbjct  60   KLTASAISSFLDLVLTPGSEVHAKLSAYLPKEDDHEMEVDAATSAIQTPAKHLLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVL+FLIDQK+Y+EAKACSSASIV LK  NR
Sbjct  120  CYLLVLLFLIDQKKYNEAKACSSASIVWLKNTNR  153



>ref|XP_003523322.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Glycine max]
Length=487

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQD+EM+++    SNSVS   PS  QHLK+IASLIETG+Y++EVRRIARAVRLT+ALR+
Sbjct  1    MTQDLEMRDRSTP-SNSVSLPAPSTLQHLKEIASLIETGSYSKEVRRIARAVRLTIALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL AS +++FL+ +L+PGSEVH++LS+YLPK D+H+MEVD ATSA Q P KH +PELEIY
Sbjct  60   KLTASAISSFLDLVLTPGSEVHAKLSAYLPKEDDHEMEVDAATSAIQTPAKHLLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVL+FLIDQK+Y+EAKACSSASIV LK  NR
Sbjct  120  CYLLVLLFLIDQKKYNEAKACSSASIVWLKNTNR  153



>gb|KJB15843.1| hypothetical protein B456_002G199200 [Gossypium raimondii]
Length=484

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQ    ++  SS+  ++  HLK+IASLIETGAY RE RRI RA+RLTMALR+
Sbjct  1    MTQDVEMKEQPAPSNSVPSSSPSTL-HHLKEIASLIETGAYDREARRILRAIRLTMALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS L++FL+F L+PGSE  +RLSSYLPK DE++MEVDTATS  Q P KHS+PELEIY
Sbjct  60   KLKASVLSSFLSFALTPGSEAFTRLSSYLPKEDENEMEVDTATSTAQPPAKHSLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK+Y EAKACSSASI RLK LNR
Sbjct  120  CYLLVLIFLIDQKKYDEAKACSSASIARLKNLNR  153



>gb|KHG18147.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Gossypium 
arboreum]
Length=484

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQ    ++  SS+  ++  HLK+IASLIETGAY RE RRI RA+RLTMALR+
Sbjct  1    MTQDVEMKEQPAPSNSVPSSSPSTL-HHLKEIASLIETGAYDREARRILRAIRLTMALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS L+ FL+F L+PGSE  +RLSSYLPK DE++MEVDTATS  Q P KHS+PELEIY
Sbjct  60   KLKASVLSVFLSFALTPGSEAFTRLSSYLPKEDENEMEVDTATSTAQPPAKHSLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK+Y EAKACSSASI RLK LNR
Sbjct  120  CYLLVLIFLIDQKKYDEAKACSSASISRLKNLNR  153



>ref|XP_002306189.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
 gb|EEE86700.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
Length=488

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQQ   SNS +S+ PS   HLK+IASLIETGAYA+E RRI RAVRLTM LR+
Sbjct  1    MTQDVEMKEQQQQPSNSTTSSSPSTLHHLKEIASLIETGAYAKEARRIVRAVRLTMTLRR  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS L+AFLNF LS GSE  +RL SYLPK D H+MEVD+ TS TQAP K+ +PELEIY
Sbjct  61   KLKASVLSAFLNFALSAGSEPFNRLISYLPKEDAHEMEVDSVTSVTQAPAKYPLPELEIY  120

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK+Y+EAK CSSASI RLK LNR
Sbjct  121  CYLLVLIFLIDQKKYNEAKTCSSASIARLKNLNR  154



>ref|XP_007136115.1| hypothetical protein PHAVU_009G019100g [Phaseolus vulgaris]
 gb|ESW08109.1| hypothetical protein PHAVU_009G019100g [Phaseolus vulgaris]
Length=487

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQD+EMK++    SNSVSS  PS  Q+LK+IASLIETG+Y++EVRRIARAVRLT+ALR+
Sbjct  1    MTQDLEMKDRSTP-SNSVSSPAPSTLQNLKEIASLIETGSYSKEVRRIARAVRLTIALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL AS +++FL+ +L+PGSE H +LS+YLPK D+H+MEVD ATS  Q P KH +PELEIY
Sbjct  60   KLTASIISSFLDHVLAPGSEAHVKLSAYLPKEDDHEMEVDAATSTIQTPAKHLLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVL+FLID+KRY+EAKACSSASIV LK  NR
Sbjct  120  CYLLVLLFLIDKKRYNEAKACSSASIVWLKNTNR  153



>ref|XP_010536429.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A [Tarenaya hassleriana]
Length=487

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKE Q   S SV +   S  Q+LK+IASLIETG+Y +EVRRIARAVRLTM LR+
Sbjct  1    MTQDVEMKENQTP-SQSVVTAATSTLQNLKEIASLIETGSYTKEVRRIARAVRLTMGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            K   S L++FL+F L PGSE HSRLSS++PK DEH+MEVDTA+SA QAP KH   ELEIY
Sbjct  60   KFTGSVLSSFLDFALVPGSEAHSRLSSFVPKVDEHEMEVDTASSAAQAPSKHMSAELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYL+VL+FLIDQK+Y+EAKACSSASI RLK++NR
Sbjct  120  CYLIVLLFLIDQKKYNEAKACSSASISRLKSINR  153



>ref|XP_009401896.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
Length=487

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MT DVEM+ Q P+ S+  S+T PS  QHLK+IASLIETGA  +EVRRI RAVRLTM LR+
Sbjct  1    MTADVEMEVQAPS-SSVPSATVPSTLQHLKEIASLIETGAQGKEVRRIVRAVRLTMMLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL+AS L+AFL  +L  GSE  ++LSS+LPK DEHDM+VDTA SA Q P KH +PELEI+
Sbjct  60   KLRASVLSAFLGHVLPSGSEAFAKLSSFLPKDDEHDMDVDTAASAVQGPAKHCIPELEIF  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYL+VLI+LIDQKRY+EAKACSSASI RL+ +NR
Sbjct  120  CYLIVLIYLIDQKRYNEAKACSSASIARLRNINR  153



>ref|XP_009355646.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Pyrus x bretschneideri]
Length=487

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKE  PA SNSVSST PS   +LK+IASL+ET AY REVRRI RAVRLTM LR+
Sbjct  1    MTQDVEMKEV-PAPSNSVSSTSPSTLHNLKEIASLLETAAYTREVRRIVRAVRLTMVLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLK S ++AFLNF L+PGSEVHSRLSS+LPK DE DM+VDTATSATQ P KH++PELE+Y
Sbjct  60   KLKVSVISAFLNFALTPGSEVHSRLSSFLPKDDEQDMDVDTATSATQVPAKHALPELEMY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
             YLLVLIFLIDQK+Y+EAKAC+SASI R+K LNR
Sbjct  120  SYLLVLIFLIDQKKYNEAKACASASIARIKNLNR  153



>ref|XP_011045871.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Populus euphratica]
Length=486

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 126/154 (82%), Gaps = 2/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQ    +++ SS   S   HLK+IASLIETGAYA+E RRI RAVRLT  LR+
Sbjct  1    MTQDVEMKEQHQPSNSTTSSP--STLHHLKEIASLIETGAYAKETRRIQRAVRLTNTLRR  58

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS L AFLNF LS GSE  +RL SYLPK DEH+MEVDTATS TQAP KH +PELEIY
Sbjct  59   KLKASVLYAFLNFALSAGSESFNRLISYLPKEDEHEMEVDTATSVTQAPAKHPLPELEIY  118

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK+++EAKACSSASI RLK LNR
Sbjct  119  CYLLVLIFLIDQKKHNEAKACSSASIARLKNLNR  152



>ref|XP_007200984.1| hypothetical protein PRUPE_ppa004807mg [Prunus persica]
 gb|EMJ02183.1| hypothetical protein PRUPE_ppa004807mg [Prunus persica]
Length=490

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 131/156 (84%), Gaps = 2/156 (1%)
 Frame = +3

Query  102  MTQDVEMKE-QQPALSNSVSSTGPSVFQH-LKDIASLIETGayarevrriaravrLTMAL  275
            MTQDVEMKE   P++ ++ +S+      H LK+IASL+ET AY+REVRRI RAVRLTM L
Sbjct  1    MTQDVEMKEVTAPSIPSNSASSTSPSTLHNLKEIASLLETAAYSREVRRIVRAVRLTMVL  60

Query  276  RKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELE  455
            R+KLK S L+AFLNF LSPGSEVHSRLSSYLPK DEHDM+VDTATSATQ   KH++PELE
Sbjct  61   RRKLKVSVLSAFLNFALSPGSEVHSRLSSYLPKDDEHDMDVDTATSATQVSSKHALPELE  120

Query  456  IYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            IY YLLVLIFLIDQK+Y+EAKAC+SASI R+K LNR
Sbjct  121  IYSYLLVLIFLIDQKKYNEAKACASASIARIKNLNR  156



>ref|XP_008236045.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Prunus mume]
Length=490

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 130/156 (83%), Gaps = 2/156 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQ-PALSNSVSSTGPSVFQH-LKDIASLIETGayarevrriaravrLTMAL  275
            MTQDVEMKE   P++ ++ +S+      H LK+IASL+ET AY REVRRI RAVRLTM L
Sbjct  1    MTQDVEMKEVPVPSIPSNSASSTSPSTLHNLKEIASLLETAAYTREVRRIVRAVRLTMVL  60

Query  276  RKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELE  455
            R+KLK S L+AFLNF LSPGSEVHSRLSSYLP+ DEHDM+VDTATSATQ   KH++PELE
Sbjct  61   RRKLKVSVLSAFLNFALSPGSEVHSRLSSYLPRDDEHDMDVDTATSATQVSSKHALPELE  120

Query  456  IYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            IY YLLVLIFLIDQK+Y+EAKAC+SASI R+K LNR
Sbjct  121  IYSYLLVLIFLIDQKKYNEAKACASASIARIKNLNR  156



>ref|XP_010920092.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Elaeis guineensis]
Length=488

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MT D+EMKE Q   ++  S+T  S  QHLK+IASLIE+GAYA+EVRRI RAVRLTM LR+
Sbjct  1    MTNDLEMKEVQAPSNSVSSATASSTLQHLKEIASLIESGAYAKEVRRIVRAVRLTMMLRR  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL+A  ++AFL + L+PGSE HSRLSSYLPK ++HDM+VDTATSA Q P K+S+ ELEIY
Sbjct  61   KLRAPVVSAFLGYALAPGSEAHSRLSSYLPKDEQHDMDVDTATSAVQGPAKYSLLELEIY  120

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK Y+EAKACSSASI RLK +NR
Sbjct  121  CYLLVLIFLIDQKSYNEAKACSSASIARLKNMNR  154



>ref|XP_002521275.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
 gb|EEF41131.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
Length=491

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 134/157 (85%), Gaps = 3/157 (2%)
 Frame = +3

Query  102  MTQDVEMKE---QQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMA  272
            MTQDVEMKE      A SNS +S+ PS  QHLK+IASLIETGAYAREVRRI RAVRLTMA
Sbjct  1    MTQDVEMKEVPAAAAAPSNSTTSSSPSTLQHLKEIASLIETGAYAREVRRIVRAVRLTMA  60

Query  273  LRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPEL  452
            LR+KLKA  L+AFLN IL+PGS+ ++RLSS+LPK D+H+MEVDTATS TQAP KH +PEL
Sbjct  61   LRRKLKAQLLSAFLNSILTPGSDPYTRLSSFLPKEDDHEMEVDTATSVTQAPAKHPLPEL  120

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            E+YCYLLVLI+LIDQK+Y+EAKACS+A I RLK LNR
Sbjct  121  EMYCYLLVLIYLIDQKKYNEAKACSTACIARLKNLNR  157



>ref|XP_003603813.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula]
 gb|AES74064.1| 26S proteasome non-ATPase regulatory subunit 3 [Medicago truncatula]
Length=490

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 133/157 (85%), Gaps = 4/157 (3%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQD+EMK++    SNSVS   PS  QHLK+IAS+IETG+Y++EVRRIARAVRLT+ALRK
Sbjct  1    MTQDLEMKDRSTP-SNSVSPPVPSTLQHLKEIASVIETGSYSKEVRRIARAVRLTIALRK  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPV---KHSVPEL  452
            KL AS +++FL+ +L+PGSE H++LS+YLPK D+H+MEVD ATSA Q P+   KH +PEL
Sbjct  60   KLTASVISSFLDHVLTPGSEPHAKLSAYLPKEDDHEMEVDAATSAIQTPIPTAKHLLPEL  119

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            EIYCYLLVL+FLIDQK+Y+EAKACSSAS+  LK +NR
Sbjct  120  EIYCYLLVLLFLIDQKKYNEAKACSSASVAWLKNVNR  156



>ref|XP_011046661.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Populus euphratica]
Length=488

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQQ   SNS +S+ PS   HLK+IASLIETGAYA+E RRI RAVRLTM LR+
Sbjct  1    MTQDVEMKEQQQQPSNSSTSSSPSTLHHLKEIASLIETGAYAKEARRIVRAVRLTMTLRR  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS L+AFLNF LS GSE  +RL SYLPK D H+MEVD+ TS TQAP K+ +PELEIY
Sbjct  61   KLKASVLSAFLNFALSAGSEPFNRLISYLPKEDAHEMEVDSVTSVTQAPAKYPLPELEIY  120

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK+Y+EAK CSSASI RLK LNR
Sbjct  121  CYLLVLIFLIDQKKYNEAKTCSSASITRLKNLNR  154



>ref|XP_002312950.2| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
 gb|EEE86905.2| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
Length=485

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 125/154 (81%), Gaps = 2/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKEQ    +++ SS   S   HLK+IASLIETGAYA+E RRI RAVRLT  LR+
Sbjct  1    MTQDVEMKEQHQPSNSTTSSP--STLHHLKEIASLIETGAYAKETRRIQRAVRLTNTLRR  58

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS L AFLNF LS GSE  +RL SYLPK DE++MEVDTATS TQAP KH +PELEIY
Sbjct  59   KLKASVLYAFLNFALSAGSESFNRLISYLPKEDEYEMEVDTATSVTQAPAKHPLPELEIY  118

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK++ EAKACSSASI RLK LNR
Sbjct  119  CYLLVLIFLIDQKKHIEAKACSSASIARLKNLNR  152



>ref|XP_009413027.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
 ref|XP_009413028.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
 ref|XP_009413029.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
Length=487

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTG-PSVFQHLKDIASLIETGayarevrriaravrLTMALR  278
            MT DVEMKE Q A SNSVSS G PS  QH+K+IASLIE+GA A+EVRRI RAVRLTM LR
Sbjct  1    MTADVEMKEVQ-AFSNSVSSAGVPSTLQHMKEIASLIESGAQAKEVRRIVRAVRLTMMLR  59

Query  279  KKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEI  458
            +KL+A  + AFL ++L+P SEV ++LSSYLPK D+HDM+VDTA SA Q P KHS+PELEI
Sbjct  60   RKLRAPLVAAFLGYVLTPASEVFAKLSSYLPKDDDHDMDVDTAASAVQGPAKHSIPELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCYLLVLIFLIDQKRY+EAKACSSASI RL+ +NR
Sbjct  120  YCYLLVLIFLIDQKRYNEAKACSSASIARLRNMNR  154



>gb|EYU22574.1| hypothetical protein MIMGU_mgv1a005362mg [Erythranthe guttata]
Length=487

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 129/156 (83%), Gaps = 5/156 (3%)
 Frame = +3

Query  102  MTQDVEMKEQ--QPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMAL  275
            MTQDVEMKEQ  QP  S+S++S  PS  Q LKDIA+LIETGAY REVRRI RA+R T+ L
Sbjct  1    MTQDVEMKEQPEQPTPSSSLTSPSPSTLQCLKDIAALIETGAYTREVRRIVRAIRWTIQL  60

Query  276  RKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELE  455
            RK LKAS L+AFLNF L PGS+VHSRLSSY+PK D HDMEVD+ATSA   P KHS+PELE
Sbjct  61   RKNLKASVLSAFLNFALVPGSDVHSRLSSYVPKEDGHDMEVDSATSA---PTKHSLPELE  117

Query  456  IYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            I+CYL+VLIFLIDQKRYSEAKACSS  I RL+ LNR
Sbjct  118  IFCYLVVLIFLIDQKRYSEAKACSSGGIARLRNLNR  153



>ref|XP_010935159.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Elaeis guineensis]
Length=493

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 129/159 (81%), Gaps = 5/159 (3%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSV-----FQHLKDIASLIETGayarevrriaravrLT  266
            MTQ+VEM E Q A + + +S+  S       QHLK+IA+LIE+GAYA+EVRRI RAVRLT
Sbjct  1    MTQEVEMVEHQAAAAAAPTSSVSSATASSTLQHLKEIAALIESGAYAKEVRRIVRAVRLT  60

Query  267  MALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVP  446
            M LR+KL+A  + +FLNF+L P SE HSRLSSYLPK DEHDM+VDTA+SA Q P K+S+P
Sbjct  61   MMLRRKLRAPVIASFLNFVLPPVSEAHSRLSSYLPKEDEHDMDVDTASSAGQVPFKYSLP  120

Query  447  ELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            ELEIYCY+LVLIFLIDQKRY EAKACSSASI RLK +NR
Sbjct  121  ELEIYCYVLVLIFLIDQKRYEEAKACSSASIARLKNMNR  159



>ref|XP_006302193.1| hypothetical protein CARUB_v10020202mg [Capsella rubella]
 gb|EOA35091.1| hypothetical protein CARUB_v10020202mg [Capsella rubella]
Length=487

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+      + VS+T  S  QHLK+IA+LI+TG+Y +EVRRIARAVRLT+ LR 
Sbjct  1    MTQDVEMKDNHTPTQSVVSAT-TSTLQHLKEIAALIDTGSYTKEVRRIARAVRLTVGLRL  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL  S +++FL+F L PGSE H+RLS ++PKGDEHDMEVDTA+S +QAP KH   ELEIY
Sbjct  60   KLTGSVISSFLDFALVPGSEAHTRLSCFVPKGDEHDMEVDTASSTSQAPPKHLPAELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CY +VL+FLIDQK+Y+EAK CSSASI RLK+LNR
Sbjct  120  CYFIVLLFLIDQKKYNEAKVCSSASIARLKSLNR  153



>ref|XP_008382101.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Malus domestica]
Length=487

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKE  PA SNSVSS  PS   +LK+IASL+ET AY REVRRI RAVRLTM LR+
Sbjct  1    MTQDVEMKEV-PAPSNSVSSASPSTLHNLKEIASLLETAAYTREVRRIVRAVRLTMVLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLK S ++AFLNF L+PGSEVHSRL S+LPK DE DM+VDTATSAT  P KH++PELE+Y
Sbjct  60   KLKVSVISAFLNFALTPGSEVHSRLLSFLPKDDEQDMDVDTATSATLVPAKHALPELEMY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
             YLLVLIFLIDQK+Y+EAKAC+SASI R+K LNR
Sbjct  120  SYLLVLIFLIDQKKYNEAKACASASIARIKNLNR  153



>ref|XP_008809439.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Phoenix dactylifera]
Length=488

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            M+ DVEMKE Q   ++  S+T  S  QHLK+IASLIETGAYA+EVRRI RAVRLTM LR+
Sbjct  1    MSNDVEMKEVQAPSNSLSSATASSTLQHLKEIASLIETGAYAKEVRRIVRAVRLTMMLRR  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL+A  ++AFL+  L+PGSE H RLSSYLPK +E DM+VDTATSA Q   K+S+PELEIY
Sbjct  61   KLRAPAVSAFLSCALAPGSEAHLRLSSYLPKDEERDMDVDTATSAAQGLAKYSLPELEIY  120

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQKRY+EAKACSS+SI RLK +NR
Sbjct  121  CYLLVLIFLIDQKRYNEAKACSSSSIARLKNINR  154



>ref|XP_008377724.1| PREDICTED: LOW QUALITY PROTEIN: probable 26S proteasome non-ATPase 
regulatory subunit 3 [Malus domestica]
Length=487

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKE   A SNSVSST PS   +LK+IASL+ET AY REVRRI RAVRLTM LR+
Sbjct  1    MTQDVEMKEVL-APSNSVSSTSPSXLHNLKEIASLLETAAYTREVRRIVRAVRLTMVLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLK S ++AFL F L+PGSEVHSRLSS+LPK DE DM+VDTATSATQ P KH++PELE+Y
Sbjct  60   KLKVSVISAFLXFALTPGSEVHSRLSSFLPKDDEQDMDVDTATSATQVPAKHALPELEMY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
             YLLVLIFLIDQK+Y+EAKAC+SASI R+K LNR
Sbjct  120  SYLLVLIFLIDQKKYNEAKACASASIARIKNLNR  153



>ref|XP_008806135.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Phoenix dactylifera]
Length=497

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 127/164 (77%), Gaps = 10/164 (6%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSV----------FQHLKDIASLIETGayarevrriar  251
            MTQDVEM E Q A + + ++  P+            QHLK+IA+LIE+GAYA+EVRRI R
Sbjct  1    MTQDVEMGELQAAAAAAAAAAAPTNSVSSATTSSTLQHLKEIAALIESGAYAKEVRRIVR  60

Query  252  avrLTMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPV  431
            AVRLTM LR+KL+A+ + +FL F L P SE HSRLSSYLPK D+HDM+VDTATSA Q P 
Sbjct  61   AVRLTMTLRRKLRAAVIASFLKFALPPVSEAHSRLSSYLPKEDKHDMDVDTATSAGQVPF  120

Query  432  KHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            K S+PELEIYCYLL++IFLIDQKRY EAKACSSASI RLK LNR
Sbjct  121  KCSLPELEIYCYLLLIIFLIDQKRYEEAKACSSASIARLKNLNR  164



>ref|XP_010416506.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B [Camelina sativa]
Length=487

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+      + VS+T  S  QHLK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNHTPTQSVVSAT-TSTLQHLKEIAALIDTGSYTKEVRRIARAVRLTVGLRQ  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL AS L++FL+F L PGSE H+RLS ++PK DEHDMEVDTA+S +QAP KH   ELEIY
Sbjct  60   KLTASVLSSFLDFALVPGSEAHTRLSPFVPKSDEHDMEVDTASSTSQAPPKHLPAELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CY +VL+FLIDQK+Y+EAK CSSASI RLK +NR
Sbjct  120  CYFIVLLFLIDQKKYNEAKVCSSASIARLKNVNR  153



>ref|XP_006390248.1| hypothetical protein EUTSA_v10018459mg [Eutrema salsugineum]
 dbj|BAJ34390.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27534.1| hypothetical protein EUTSA_v10018459mg [Eutrema salsugineum]
Length=488

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+ Q    + VS+T  S  QHLK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNQTPTQSVVSAT-TSTLQHLKEIAALIDTGSYTKEVRRIARAVRLTVGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAP-VKHSVPELEI  458
            KL +S +++FL+F L PGSE H+RLSS++PK DEHDMEVDTA+S +QAP  KH   ELEI
Sbjct  60   KLTSSVISSFLDFALVPGSEAHTRLSSFVPKSDEHDMEVDTASSNSQAPSSKHLPAELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCY +VL+FLIDQK+Y+EAKACSSASI RLK++NR
Sbjct  120  YCYFIVLLFLIDQKKYNEAKACSSASIARLKSVNR  154



>ref|XP_010107643.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Morus 
notabilis]
 gb|EXC16554.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Morus 
notabilis]
Length=487

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKE Q   ++  S++  ++  HLK+IA+LIETGA+ REVRRI RAVRLTMALR+
Sbjct  1    MTQDVEMKELQDPSNSVSSTSPSTL-HHLKEIAALIETGAFGREVRRILRAVRLTMALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLK+S L+AFLNF L+PGSE+H+RLSSYLPK ++H+M+VDTAT+ TQA VKHS PELEIY
Sbjct  60   KLKSSVLSAFLNFALAPGSELHARLSSYLPKDNDHEMDVDTATATTQATVKHSPPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLIDQK+Y+EAKAC+SASI RLK +NR
Sbjct  120  CYLLVLIFLIDQKKYNEAKACASASIARLKNVNR  153



>ref|XP_010428646.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=487

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 125/154 (81%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+      + VS+T  S  QHLK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNHTPTQSVVSAT-TSTLQHLKEIAALIDTGSYTKEVRRIARAVRLTVGLRQ  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL AS L++FL+F L PGSE H+R+S ++PK DEHDMEVDTA+S +QAP KH   ELEIY
Sbjct  60   KLTASVLSSFLDFALVPGSEAHTRISPFVPKSDEHDMEVDTASSTSQAPPKHLPAELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CY +VL+FLIDQK+Y+EAK CSSASI RLK +NR
Sbjct  120  CYFIVLLFLIDQKKYNEAKVCSSASIARLKNVNR  153



>ref|XP_004500920.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cicer arietinum]
Length=488

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQD+EMK++    SNSVS   PS  QHLK+IASLIETG+Y++EVRRIARAVRLT+ALRK
Sbjct  1    MTQDLEMKDRSTP-SNSVSPPVPSTLQHLKEIASLIETGSYSKEVRRIARAVRLTIALRK  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPV-KHSVPELEI  458
            KL AS +++FL+ +L+PGSE H++LS+YLPK ++H+MEVD ATSA Q PV KH +PELEI
Sbjct  60   KLTASVISSFLDHVLTPGSEPHTKLSAYLPKEEDHEMEVDAATSAIQTPVAKHLLPELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            Y YLLVL+FLIDQK+Y+EAKA SSAS+  LK +NR
Sbjct  120  YSYLLVLLFLIDQKKYNEAKAVSSASVAWLKNINR  154



>ref|NP_177726.1| probable 26S proteasome non-ATPase regulatory subunit 3b [Arabidopsis 
thaliana]
 sp|Q9LQR8.2|PSD3B_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 3 
homolog B; AltName: Full=26S proteasome regulatory subunit RPN3b; 
Short=AtRPN3b; AltName: Full=26S proteasome regulatory 
subunit S3 homolog B [Arabidopsis thaliana]
 gb|AAL09749.1| At1g75990/T4O12_21 [Arabidopsis thaliana]
 gb|AAU90061.1| At1g75990 [Arabidopsis thaliana]
 gb|AEE35783.1| probable 26S proteasome non-ATPase regulatory subunit 3b [Arabidopsis 
thaliana]
Length=487

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+ Q   + SV S   S  Q+LK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNQTP-TQSVVSAPTSTLQNLKEIAALIDTGSYTKEVRRIARAVRLTVGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL  S +++FL+F L PGSE H+RLSS++PK DEHDMEVDTA+S +QAP KH   ELEIY
Sbjct  60   KLTGSVISSFLDFALVPGSEAHTRLSSFVPKSDEHDMEVDTASSNSQAPPKHLPAELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CY +VL+FLIDQK+Y+EAK CS+ASI RLK++NR
Sbjct  120  CYFIVLLFLIDQKKYNEAKVCSTASIARLKSVNR  153



>ref|XP_002893093.1| EMB2719 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69352.1| EMB2719 [Arabidopsis lyrata subsp. lyrata]
Length=488

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+      + +SS+  ++ QHLK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNNTPSQSVISSSTSTM-QHLKEIAALIDTGSYTKEVRRIARAVRLTIGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQ-APVKHSVPELEI  458
            KL  S L++FL+F L PGSE HSRLSS++PKGDEHDMEVDTA+SATQ AP KH   ELEI
Sbjct  60   KLTGSVLSSFLDFALVPGSEAHSRLSSFVPKGDEHDMEVDTASSATQAAPSKHLPAELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCY +VL+FLIDQ++Y+EAKACSSASI RLK +NR
Sbjct  120  YCYFIVLLFLIDQRKYNEAKACSSASIARLKNVNR  154



>ref|XP_009106250.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B [Brassica rapa]
Length=491

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +3

Query  99   TMTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALR  278
            T TQDVEMK+     + S+ S   S  QHLK+IA+LI+TG+Y +EVRR+ARAVRLT+ +R
Sbjct  3    TTTQDVEMKDNNQTPAQSIVSATTSTLQHLKEIAALIDTGSYTKEVRRVARAVRLTVGIR  62

Query  279  KKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEI  458
            +KL AS + +FL+F L PGSE H+RLSS++PK DEHDMEVDTA+S + A  KH   ELEI
Sbjct  63   QKLTASVVASFLDFALGPGSEAHARLSSFVPKSDEHDMEVDTASSTSLAASKHVPVELEI  122

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCY +VL+FLIDQK+Y+EAKACSSASI RLK+LN+
Sbjct  123  YCYFIVLLFLIDQKKYNEAKACSSASIARLKSLNK  157



>ref|XP_002889051.1| hypothetical protein ARALYDRAFT_476749 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65310.1| hypothetical protein ARALYDRAFT_476749 [Arabidopsis lyrata subsp. 
lyrata]
Length=487

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 125/154 (81%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+ Q   + SV S   S  Q+LK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNQTP-TESVVSAPTSTLQNLKEIAALIDTGSYTKEVRRIARAVRLTVGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            +L  S +++FL+F L PGSE H+RLSS++PK DEHDMEVDTA+S +QAP KH   ELEIY
Sbjct  60   QLTGSVISSFLDFALVPGSEAHTRLSSFVPKSDEHDMEVDTASSTSQAPPKHLPAELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CY +VL+ LIDQK+YSEAKACSSASI RLK +NR
Sbjct  120  CYFIVLLLLIDQKKYSEAKACSSASIARLKNVNR  153



>ref|XP_004162914.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cucumis sativus]
Length=176

 Score =   173 bits (438),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 124/153 (81%), Gaps = 8/153 (5%)
 Frame = +3

Query  105  TQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRKK  284
            TQD EMKE    +S+S     PS  Q+LK+I SL+ETGAYAREVRRI RA+RLTMALR+K
Sbjct  3    TQDAEMKELPAPISSS-----PSTLQNLKEIVSLLETGAYAREVRRIVRAIRLTMALRRK  57

Query  285  LKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYC  464
            LKAS L++FLNF L PGS+VH+RLSS++PK ++ +M+VD    ATQ P KH +PE+EI+C
Sbjct  58   LKASVLSSFLNFALPPGSDVHTRLSSFIPKEEDCEMDVDL---ATQTPSKHLLPEIEIFC  114

Query  465  YLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YL++LIFLIDQK+Y EAKAC+SASI RLK LNR
Sbjct  115  YLILLIFLIDQKKYGEAKACASASIARLKNLNR  147



>ref|XP_010471748.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=487

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+      + VS+T  S  QHLK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNHTPTQSVVSAT-TSTLQHLKEIAALIDTGSYTKEVRRIARAVRLTVGLRQ  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL AS L++FL+F L PGSE H+R+S  +PK DEHDMEVDTA+S +QAP KH   ELEIY
Sbjct  60   KLTASVLSSFLDFALVPGSEAHTRISPLVPKSDEHDMEVDTASSTSQAPPKHLPAELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CY +VL+FLIDQK+Y+EAK CSSASI RLK +NR
Sbjct  120  CYFIVLLFLIDQKKYNEAKVCSSASIARLKNVNR  153



>gb|KFK42036.1| hypothetical protein AALP_AA2G203500 [Arabis alpina]
Length=488

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQD+EMK+ Q    + + S   S  QHLK+IA+LI++G+Y +EVRRIARAVRLT+ LRK
Sbjct  1    MTQDIEMKDNQTPTQSIIVSATTSTLQHLKEIAALIDSGSYTKEVRRIARAVRLTVGLRK  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL  S +++FL+F L PGS+ H+RLSS++PK +EHDMEVDTA+S +QA  KH   ELEIY
Sbjct  61   KLTGSVISSFLDFALVPGSDAHTRLSSFVPKSNEHDMEVDTASSNSQATTKHLPAELEIY  120

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CY LVL+FLIDQK+Y+EAK CSSASI RLK++NR
Sbjct  121  CYFLVLLFLIDQKKYNEAKVCSSASIARLKSVNR  154



>ref|XP_004154161.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like, partial [Cucumis sativus]
Length=235

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQD EMKE    LS+S SS  PS  Q+LK+I SLIETGAYAREVRRI RA+RLTMALR+
Sbjct  1    MTQDAEMKELPAPLSSSSSSVSPSTIQNLKEIVSLIETGAYAREVRRIVRAIRLTMALRR  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS L+ FLN +L  GSEVH+RLSS+LPK D+ +M+VDT   ATQAP KH +PE+EI+
Sbjct  61   KLKASVLSQFLNLVLPTGSEVHTRLSSFLPKEDDCEMDVDT---ATQAPAKHHLPEIEIF  117

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYL+VLIFLID K+Y +AKAC+SASI RLK LNR
Sbjct  118  CYLIVLIFLIDHKKYGDAKACASASIARLKNLNR  151



>gb|AAL09760.1| At1g20200/T20H2_4 [Arabidopsis thaliana]
Length=378

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+      + +SS+  ++ Q+LK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNNTPSQSIISSSTSTM-QNLKEIAALIDTGSYTKEVRRIARAVRLTIGLRQ  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQ-APVKHSVPELEI  458
            KL  S L++FL+F L PGSE HSRLSS++PKGDEHDMEVDTA+SATQ AP KH   ELEI
Sbjct  60   KLTGSVLSSFLDFALVPGSEAHSRLSSFVPKGDEHDMEVDTASSATQAAPSKHLPAELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCY +VL+FLIDQK+Y+EAKACSSASI RLK +NR
Sbjct  120  YCYFIVLLFLIDQKKYNEAKACSSASIARLKNVNR  154



>ref|XP_007222347.1| hypothetical protein PRUPE_ppa004821mg [Prunus persica]
 gb|EMJ23546.1| hypothetical protein PRUPE_ppa004821mg [Prunus persica]
Length=490

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 120/157 (76%), Gaps = 3/157 (2%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+++      + S   S+ QHLK+ AS IE  +Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDEEALPQAPLPSDSASILQHLKEGASFIEAASYTKEVRRIARAVRLTIQLRR  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDT---ATSATQAPVKHSVPEL  452
            KL A  L+AFL++ L PGSE H+RLS+YLPK D H MEVD    ATSA QAP KH +PEL
Sbjct  61   KLTAPLLSAFLDYALLPGSEAHARLSAYLPKDDRHGMEVDNDDAATSAVQAPAKHILPEL  120

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            EIYCYLLV++FLIDQKRY EAKACSSASI RLK  NR
Sbjct  121  EIYCYLLVILFLIDQKRYDEAKACSSASIARLKNFNR  157



>ref|XP_008447941.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Cucumis melo]
 ref|XP_008447942.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Cucumis melo]
Length=481

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 126/153 (82%), Gaps = 8/153 (5%)
 Frame = +3

Query  105  TQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRKK  284
            TQD EMKE    +S+S     PS  QHLK+I SL+ETGAYAREVRRI RA+RLTMALR+K
Sbjct  3    TQDAEMKELPAPISSS-----PSTLQHLKEIVSLLETGAYAREVRRIVRAIRLTMALRRK  57

Query  285  LKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYC  464
            LKAS L++FLNF L PGS+VH+RLSS++PK ++++M+VD   SATQ P KH +PE+EI+C
Sbjct  58   LKASDLSSFLNFALPPGSDVHTRLSSFIPKEEDYEMDVD---SATQPPAKHPLPEIEIFC  114

Query  465  YLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YL++LIFLIDQK+Y EAKAC+SASI RLK LNR
Sbjct  115  YLILLIFLIDQKKYGEAKACASASIARLKNLNR  147



>ref|XP_006416422.1| hypothetical protein EUTSA_v10007479mg [Eutrema salsugineum]
 gb|ESQ34775.1| hypothetical protein EUTSA_v10007479mg [Eutrema salsugineum]
Length=488

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMKE Q    + +SST  ++ QHLK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKENQTPSQSIISSTTSTM-QHLKEIAALIDTGSYTKEVRRIARAVRLTIGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQ-APVKHSVPELEI  458
            K+  S L++FL+F L PGSE HSRLSS++PKG+E+DMEVDTA+SATQ AP KH   ELEI
Sbjct  60   KITGSVLSSFLDFALVPGSEAHSRLSSFVPKGEEYDMEVDTASSATQAAPSKHLPAELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCY +VL+FLIDQK+Y+EAKACSSASI RLK +NR
Sbjct  120  YCYFIVLLFLIDQKKYNEAKACSSASIARLKNVNR  154



>ref|XP_002510590.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
 gb|EEF52777.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
Length=491

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 125/156 (80%), Gaps = 1/156 (1%)
 Frame = +3

Query  99   TMTQDVEMKEQQ-PALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMAL  275
            T  +DV MK  Q P+ S SV    PS   HLK+IASLI T +Y++EVR + RAVRLT+ +
Sbjct  2    TTQEDVGMKHNQTPSPSPSVPLALPSTLHHLKEIASLIVTASYSKEVRPMFRAVRLTVGI  61

Query  276  RKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELE  455
            R+KL A  L+AF++F L P S+VH+RLS+YLPK +EHDMEVD+ATSAT+ P KH++PELE
Sbjct  62   RRKLTAPLLSAFIDFALLPASDVHNRLSAYLPKENEHDMEVDSATSATRTPPKHTLPELE  121

Query  456  IYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            IYCYLLVL+FLID+K+Y+EAKACSSASI R+K LNR
Sbjct  122  IYCYLLVLLFLIDRKKYNEAKACSSASIARIKNLNR  157



>ref|XP_008811676.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Phoenix dactylifera]
Length=495

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 124/161 (77%), Gaps = 7/161 (4%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSV-------FQHLKDIASLIETGayarevrriaravr  260
            MTQDVEM E Q A   + +S+  +         QHLK+IA+LI  GAYA+EVRRI RAVR
Sbjct  1    MTQDVEMTEPQAAPLAAAASSNSASSATASSALQHLKEIAALIGNGAYAKEVRRIVRAVR  60

Query  261  LTMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHS  440
            LTM LR+KL+A  + AFL F L PGSE  SRLSSYLPK DEH+M+VD ATSA Q P K+S
Sbjct  61   LTMLLRRKLRAPAVAAFLTFALPPGSEAQSRLSSYLPKEDEHEMDVDMATSAGQVPFKNS  120

Query  441  VPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +PELEIYCYLLV+IFLIDQKRY+EAKACSSASI RLK +NR
Sbjct  121  LPELEIYCYLLVVIFLIDQKRYNEAKACSSASIARLKNMNR  161



>ref|XP_008221216.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Prunus mume]
Length=491

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 120/157 (76%), Gaps = 3/157 (2%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+++      + S   S+ QHLK+ AS IE  +Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDEEALPQAPLPSDSASILQHLKEGASFIEAASYTKEVRRIARAVRLTIQLRR  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDT---ATSATQAPVKHSVPEL  452
            KL A  L+AFL++ L PGSE H+RLS+YLPK + H MEVD    ATSA QAP KH +PEL
Sbjct  61   KLTAPLLSAFLDYALLPGSEAHARLSAYLPKDNRHGMEVDNDDAATSAVQAPAKHILPEL  120

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            EIYCYLLV++FLIDQKRY EAKACSSASI RLK  NR
Sbjct  121  EIYCYLLVILFLIDQKRYDEAKACSSASIARLKNFNR  157



>ref|XP_008221217.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Prunus mume]
Length=490

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 120/157 (76%), Gaps = 3/157 (2%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+++      + S   S+ QHLK+ AS IE  +Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDEEALPQAPLPSDSASILQHLKEGASFIEAASYTKEVRRIARAVRLTIQLRR  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDT---ATSATQAPVKHSVPEL  452
            KL A  L+AFL++ L PGSE H+RLS+YLPK + H MEVD    ATSA QAP KH +PEL
Sbjct  61   KLTAPLLSAFLDYALLPGSEAHARLSAYLPKDNRHGMEVDNDDAATSAVQAPAKHILPEL  120

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            EIYCYLLV++FLIDQKRY EAKACSSASI RLK  NR
Sbjct  121  EIYCYLLVILFLIDQKRYDEAKACSSASIARLKNFNR  157



>ref|NP_173447.1| probable 26S proteasome non-ATPase regulatory subunit 3a [Arabidopsis 
thaliana]
 sp|Q9LNU4.3|PSD3A_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 3 
homolog A; AltName: Full=26S proteasome regulatory subunit RPN3a; 
Short=AtRPN3a; AltName: Full=26S proteasome regulatory 
subunit S3 homolog A; AltName: Full=Protein EMBRYO DEFECTIVE 
2719; AltName: Full=Protein HAPLESS 15 [Arabidopsis thaliana]
 gb|AAP86658.1| 26S proteasome subunit RPN3a [Arabidopsis thaliana]
 gb|AEE29950.1| probable 26S proteasome non-ATPase regulatory subunit 3a [Arabidopsis 
thaliana]
Length=488

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+      + +SS+  ++ Q+LK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNNTPSQSIISSSTSTM-QNLKEIAALIDTGSYTKEVRRIARAVRLTIGLRQ  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQ-APVKHSVPELEI  458
            KL  S L++FL+F L PGSE HSRLSS++PKGDEHDMEVDTA+SATQ AP KH   ELEI
Sbjct  60   KLTGSVLSSFLDFALVPGSEAHSRLSSFVPKGDEHDMEVDTASSATQAAPSKHLPAELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCY +VL+FLIDQK+Y+EAKACSSASI RLK +NR
Sbjct  120  YCYFIVLLFLIDQKKYNEAKACSSASIARLKNVNR  154



>ref|XP_010477252.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A [Camelina sativa]
Length=488

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+      + +SS+  ++ Q+LK+IA+LI+TG+Y +EVRRIAR+VRLT+ LR+
Sbjct  1    MTQDVEMKDNHTPSQSIISSSTSTM-QNLKEIAALIDTGSYTKEVRRIARSVRLTIGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQ-APVKHSVPELEI  458
            KL AS L++FL+F L PGSE HSRLSS++PKGDEHDMEVDTA+SATQ AP KH   ELEI
Sbjct  60   KLTASVLSSFLDFALVPGSEAHSRLSSFVPKGDEHDMEVDTASSATQVAPSKHLPLELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCY +VL+FLIDQK Y+EAKACSSASI RLK +NR
Sbjct  120  YCYFIVLLFLIDQKEYNEAKACSSASIARLKNVNR  154



>ref|XP_004499304.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cicer arietinum]
Length=491

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 127/157 (81%), Gaps = 4/157 (3%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDV+MK+  PA S+S+SS  PS  Q+LK+IAS+IETG+ ++EVRRI+RAVRLTMALR 
Sbjct  1    MTQDVDMKDH-PAPSHSISSAIPSTLQNLKEIASIIETGSNSKEVRRISRAVRLTMALRP  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLP--KGDEHDMEVDTATS-ATQAPVKHSVPEL  452
            KL A  L++F+  +L   SE HSRLSSYLP  K D ++MEVDTATS A Q P KH +PEL
Sbjct  60   KLTAPILSSFITHVLPFASEPHSRLSSYLPNPKDDGNEMEVDTATSVAIQTPPKHLLPEL  119

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            EIYCY LVL+FLIDQKRY+EAKACSSASI RLK LNR
Sbjct  120  EIYCYFLVLLFLIDQKRYNEAKACSSASIDRLKNLNR  156



>ref|XP_010459703.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A [Camelina sativa]
Length=488

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 128/155 (83%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+      + +SS+  ++ Q+LK+IA+LI+TG Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNHTPSQSIISSSTSTM-QNLKEIAALIDTGLYTKEVRRIARAVRLTIGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQ-APVKHSVPELEI  458
            KL  S L++FL+F L PGSE HSRLSS++PKGDEHDMEVDTA+SATQ AP KH   ELEI
Sbjct  60   KLTGSVLSSFLDFALVPGSEAHSRLSSFVPKGDEHDMEVDTASSATQAAPSKHLPLELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCY +VL+FLIDQK+Y+EAKACSSASI RLK +NR
Sbjct  120  YCYFIVLLFLIDQKKYNEAKACSSASIARLKNVNR  154



>ref|XP_003550437.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like isoform X1 [Glycine max]
 gb|KHN12619.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=490

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 128/157 (82%), Gaps = 4/157 (3%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            M++DVEMK+Q    S+S+SS  PS  QHLK+IAS+IETG+Y++EVRRIARA+RLT ALR+
Sbjct  1    MSEDVEMKDQATP-SHSLSSVPPSALQHLKEIASIIETGSYSKEVRRIARALRLTFALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHD--MEVDTATSATQAP-VKHSVPEL  452
            KL A  L++FL+++L P SE H+RLSS+LP   E D  MEVD++TS  Q P  KH +PEL
Sbjct  60   KLTAPVLSSFLDYVLPPASEPHTRLSSFLPNPKEGDREMEVDSSTSTIQTPAAKHLLPEL  119

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            EIYCYLLVL+FLIDQKRY  AKACSSASIVRLK+LNR
Sbjct  120  EIYCYLLVLLFLIDQKRYDTAKACSSASIVRLKSLNR  156



>ref|XP_006601362.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like isoform X2 [Glycine max]
Length=497

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 128/157 (82%), Gaps = 4/157 (3%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            M++DVEMK+Q    S+S+SS  PS  QHLK+IAS+IETG+Y++EVRRIARA+RLT ALR+
Sbjct  8    MSEDVEMKDQATP-SHSLSSVPPSALQHLKEIASIIETGSYSKEVRRIARALRLTFALRR  66

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHD--MEVDTATSATQAP-VKHSVPEL  452
            KL A  L++FL+++L P SE H+RLSS+LP   E D  MEVD++TS  Q P  KH +PEL
Sbjct  67   KLTAPVLSSFLDYVLPPASEPHTRLSSFLPNPKEGDREMEVDSSTSTIQTPAAKHLLPEL  126

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            EIYCYLLVL+FLIDQKRY  AKACSSASIVRLK+LNR
Sbjct  127  EIYCYLLVLLFLIDQKRYDTAKACSSASIVRLKSLNR  163



>gb|AAM53298.1| putative proteasome regulatory subunit S3 [Arabidopsis thaliana]
Length=488

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+      + +SS+  ++ Q+LK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNNTPSQSIISSSTSTM-QNLKEIAALIDTGSYTKEVRRIARAVRLTIGLRQ  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQ-APVKHSVPELEI  458
            KL  S L++FL+F L PGSE HSRLSS++P+GDEHDMEVDTA+SATQ AP KH   ELEI
Sbjct  60   KLTGSVLSSFLDFALVPGSEAHSRLSSFVPEGDEHDMEVDTASSATQAAPSKHLPAELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCY +VL+FLIDQK+Y+EAKACSSASI RLK +NR
Sbjct  120  YCYFIVLLFLIDQKKYNEAKACSSASIARLKNVNR  154



>emb|CDX73215.1| BnaC06g36630D [Brassica napus]
Length=491

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  99   TMTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALR  278
            T TQDVEMK+       S+ S   S+ QHLK+IA+LI+TG+Y +EVRR+ARAVRLT+ +R
Sbjct  3    TTTQDVEMKDNNQTPPQSIVSATTSILQHLKEIAALIDTGSYTKEVRRVARAVRLTVGIR  62

Query  279  KKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEI  458
            +KL AS +++FL+F L  GSE H+RLSS++PK DEHDMEVDTA+S   A  KH   ELE+
Sbjct  63   QKLTASVVSSFLDFALGHGSEAHARLSSFVPKSDEHDMEVDTASSIPLAASKHVPVELEV  122

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCY +VL+FLIDQK+Y+EAKACSSASI RLK+LN+
Sbjct  123  YCYFIVLLFLIDQKKYNEAKACSSASIARLKSLNK  157



>ref|XP_010498455.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A-like [Camelina sativa]
Length=488

 Score =   176 bits (446),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+      + VSS+  ++ Q+LK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNHTPSQSIVSSSTSTI-QNLKEIAALIDTGSYTKEVRRIARAVRLTIGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQ-APVKHSVPELEI  458
            KL  S L++FL+F L PGSE HSRLSS++PKGDEHDMEVDTA+SATQ +P KH   ELEI
Sbjct  60   KLTGSVLSSFLDFALVPGSEAHSRLSSFVPKGDEHDMEVDTASSATQVSPSKHLPLELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCY +VL+FLIDQK+Y+EAKACSSASI RLK +NR
Sbjct  120  YCYFIVLLFLIDQKKYNEAKACSSASIARLKNVNR  154



>ref|XP_004145004.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cucumis sativus]
 ref|XP_004160668.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cucumis sativus]
 gb|KGN46247.1| hypothetical protein Csa_6G077440 [Cucumis sativus]
Length=485

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQD EMKE    LS+S SS  PS  Q+LK+I SLIETGAYAREVRRI RA+RLTMALR+
Sbjct  1    MTQDAEMKELPAPLSSSSSSVSPSTIQNLKEIVSLIETGAYAREVRRIVRAIRLTMALRR  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS L+ FLN +L  GSEVH+RLSS+LPK D+ +M+VDT   ATQAP KH +PE+EI+
Sbjct  61   KLKASVLSQFLNLVLPTGSEVHTRLSSFLPKEDDCEMDVDT---ATQAPAKHHLPEIEIF  117

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYL+VLIFLID K+Y +AKAC+SASI RLK LNR
Sbjct  118  CYLIVLIFLIDHKKYGDAKACASASIARLKNLNR  151



>ref|XP_004144854.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cucumis sativus]
 gb|KGN43263.1| hypothetical protein Csa_7G014490 [Cucumis sativus]
Length=481

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 124/153 (81%), Gaps = 8/153 (5%)
 Frame = +3

Query  105  TQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRKK  284
            TQD EMKE    +S+S     PS  Q+LK+I SL+ETGAYAREVRRI RA+RLTMALR+K
Sbjct  3    TQDAEMKELPAPISSS-----PSTLQNLKEIVSLLETGAYAREVRRIVRAIRLTMALRRK  57

Query  285  LKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYC  464
            LKAS L++FLNF L PGS+VH+RLSS++PK ++ +M+VD    ATQ P KH +PE+EI+C
Sbjct  58   LKASVLSSFLNFALPPGSDVHTRLSSFIPKEEDCEMDVDL---ATQTPSKHLLPEIEIFC  114

Query  465  YLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YL++LIFLIDQK+Y EAKAC+SASI RLK LNR
Sbjct  115  YLILLIFLIDQKKYGEAKACASASIARLKNLNR  147



>ref|XP_006307354.1| hypothetical protein CARUB_v10008972mg [Capsella rubella]
 gb|EOA40252.1| hypothetical protein CARUB_v10008972mg [Capsella rubella]
Length=488

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 126/155 (81%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+      + +SS+  ++ Q+LK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNHTPSQSIISSSTSTM-QNLKEIAALIDTGSYTKEVRRIARAVRLTIGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQ-APVKHSVPELEI  458
            KL  S L++FL+F L PGSE HSRLSS++PK DEHDMEVDTA+SAT+ AP KH   ELEI
Sbjct  60   KLTGSVLSSFLDFALVPGSEAHSRLSSFVPKNDEHDMEVDTASSATEAAPSKHLPAELEI  119

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCY +VL+FLIDQK Y+EAK CSSASI RLK +NR
Sbjct  120  YCYFIVLLFLIDQKNYNEAKVCSSASIARLKNVNR  154



>ref|XP_007160631.1| hypothetical protein PHAVU_001G003600g [Phaseolus vulgaris]
 gb|ESW32625.1| hypothetical protein PHAVU_001G003600g [Phaseolus vulgaris]
Length=490

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 128/157 (82%), Gaps = 4/157 (3%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            M++DVEMK+Q    S+ +SS  PS  Q LK+I+S+IETG+Y++EVRRIARAVRLT ALR+
Sbjct  1    MSEDVEMKDQATP-SHVISSALPSTLQDLKEISSIIETGSYSKEVRRIARAVRLTFALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLP--KGDEHDMEVDTATSATQAPV-KHSVPEL  452
            KL A  L++FL+++L P SE+H++ SSYLP  K  + +MEVD+ATSA Q PV KH +PEL
Sbjct  60   KLTAPLLSSFLDYVLVPASELHTKFSSYLPSLKEGDREMEVDSATSAIQNPVAKHLLPEL  119

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            EIYCYLLVL+FLIDQKRY  AKACSSA IVRLK+LNR
Sbjct  120  EIYCYLLVLLFLIDQKRYDAAKACSSACIVRLKSLNR  156



>gb|KDO68111.1| hypothetical protein CISIN_1g011352mg [Citrus sinensis]
Length=453

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  207  IETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEH  386
            +ETGA+AREVRRI RAVRLTMALR+KLKA  L+AFLNF L+PGSE HSRL SYLPK DEH
Sbjct  1    METGAHAREVRRIMRAVRLTMALRRKLKAPVLSAFLNFALAPGSEAHSRLLSYLPKEDEH  60

Query  387  DMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +MEVDTA+S   AP KH +PELEIYCYLLVLIFLID+KRY+EAKACSSASI RLK +NR
Sbjct  61   EMEVDTASSGAPAPAKHPLPELEIYCYLLVLIFLIDKKRYNEAKACSSASIARLKNMNR  119



>ref|XP_008460112.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Cucumis melo]
Length=485

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 125/154 (81%), Gaps = 3/154 (2%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQD EMKE    LS+S SS  PS  Q+LK+I SLIETGAYAREVRRI RA+RLTMALR+
Sbjct  1    MTQDAEMKELPAPLSSSSSSASPSALQNLKEIVSLIETGAYAREVRRIVRAIRLTMALRR  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KLKAS L+ FLN +L  GSEVH+RLSS+LPK D+ +M+VDT   ATQAP KH +PE+EIY
Sbjct  61   KLKASVLSQFLNLVLPTGSEVHTRLSSFLPKEDDCEMDVDT---ATQAPAKHPLPEIEIY  117

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
             YL+VLIFLID K+Y +AKAC+SASI RLK LNR
Sbjct  118  SYLIVLIFLIDHKKYDDAKACASASIARLKNLNR  151



>ref|XP_007017884.1| PAM domain protein isoform 3 [Theobroma cacao]
 gb|EOY15109.1| PAM domain protein isoform 3 [Theobroma cacao]
Length=323

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+ Q    +SVSS  PS   HLK+IASLIETG+Y +EVRRI RAVRLT  LR+
Sbjct  1    MTQDVEMKDHQTP-PHSVSSAVPSTLHHLKEIASLIETGSYTKEVRRIVRAVRLTFGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL A  L+AFL+F L PGSE  +RLSS+LPK DEH+MEVDTATSA Q   KH +PELEIY
Sbjct  60   KLTAPVLSAFLDFALQPGSEALARLSSFLPKEDEHEMEVDTATSAVQTSGKHLLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVL++LIDQK+Y+EAKACSSAS+ RLK+LNR
Sbjct  120  CYLLVLLYLIDQKKYNEAKACSSASVNRLKSLNR  153



>ref|XP_003589555.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula]
 gb|AES59806.1| 26S proteasome non-ATPase regulatory subunit 3 [Medicago truncatula]
Length=483

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 122/157 (78%), Gaps = 12/157 (8%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQD EMK+  P  S S+    PS  QHLK+IAS+IETG+  +EVR+I+RAVRLT+ALR 
Sbjct  1    MTQDEEMKDL-PTPSQSI----PSTLQHLKEIASIIETGSNLKEVRKISRAVRLTLALRS  55

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLP--KGDEHDMEVDTATSAT-QAPVKHSVPEL  452
            KL A  L++FL+++L P    HS LSSYLP  KG +H+MEVDTATSA  Q P KH +PEL
Sbjct  56   KLTAPVLSSFLHYVLPP----HSTLSSYLPNSKGGDHEMEVDTATSAAIQTPAKHLLPEL  111

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            EIYCY LVL+FLIDQKRY+EAKACSSASI RLK LNR
Sbjct  112  EIYCYFLVLLFLIDQKRYNEAKACSSASIDRLKNLNR  148



>gb|AAF26768.2|AC007396_17 T4O12.21 [Arabidopsis thaliana]
Length=532

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 126/172 (73%), Gaps = 19/172 (11%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+ Q   + SV S   S  Q+LK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNQTP-TQSVVSAPTSTLQNLKEIAALIDTGSYTKEVRRIARAVRLTVGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPK------------------GDEHDMEVDTA  407
            KL  S +++FL+F L PGSE H+RLSS++PK                   DEHDMEVDTA
Sbjct  60   KLTGSVISSFLDFALVPGSEAHTRLSSFVPKIHVLVFALNLMEFIILVQSDEHDMEVDTA  119

Query  408  TSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +S +QAP KH   ELEIYCY +VL+FLIDQK+Y+EAK CS+ASI RLK++NR
Sbjct  120  SSNSQAPPKHLPAELEIYCYFIVLLFLIDQKKYNEAKVCSTASIARLKSVNR  171



>ref|XP_007017883.1| PAM domain protein isoform 2 [Theobroma cacao]
 gb|EOY15108.1| PAM domain protein isoform 2 [Theobroma cacao]
Length=363

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+ Q    +SVSS  PS   HLK+IASLIETG+Y +EVRRI RAVRLT  LR+
Sbjct  1    MTQDVEMKDHQTP-PHSVSSAVPSTLHHLKEIASLIETGSYTKEVRRIVRAVRLTFGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL A  L+AFL+F L PGSE  +RLSS+LPK DEH+MEVDTATSA Q   KH +PELEIY
Sbjct  60   KLTAPVLSAFLDFALQPGSEALARLSSFLPKEDEHEMEVDTATSAVQTSGKHLLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVL++LIDQK+Y+EAKACSSAS+ RLK+LNR
Sbjct  120  CYLLVLLYLIDQKKYNEAKACSSASVNRLKSLNR  153



>ref|XP_008347374.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Malus domestica]
Length=243

 Score =   163 bits (412),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 114/155 (74%), Gaps = 5/155 (3%)
 Frame = +3

Query  111  DVEMK--EQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRKK  284
            DV+MK  E Q     S  S   S  QHLK+ AS IE  +  +EVRRI+RAVRLT+ALR K
Sbjct  5    DVQMKDDESQSQSKPSFHSDSASTLQHLKEAASFIEAASSTKEVRRISRAVRLTVALRXK  64

Query  285  LKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDT--ATSATQAPVKHSVPELEI  458
            L A+ L+AFL+F L PGSE H+ LS+YL K D+HDMEVD   A S  Q P KH++PEL+I
Sbjct  65   LTAAVLSAFLDFALLPGSEAHAHLSAYL-KNDKHDMEVDNDAAASXVQVPAKHALPELDI  123

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCYLLV++FLIDQKRY EAKACSSASI R+K+ NR
Sbjct  124  YCYLLVILFLIDQKRYDEAKACSSASIARIKSFNR  158



>gb|AAF79894.1|AC022472_3 Contains similarity to 26s proteasome regulatory subunit S3 from 
Nicotiana tabacum gi|3914467 and contains a PCI PF|01399 
domain. ESTs gb|AV527569, gb|T75824, gb|T88578, gb|F15139, 
gb|AV520993, gb|AV440056, gb|AI099602, gb|F15138 come from this 
gene [Arabidopsis thaliana]
Length=519

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = +3

Query  177  FQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHSRL  356
            F  LK+IA+LI+TG+Y +EVRRIARAVRLT+ LR+KL  S L++FL+F L PGSE HSRL
Sbjct  56   FPDLKEIAALIDTGSYTKEVRRIARAVRLTIGLRQKLTGSVLSSFLDFALVPGSEAHSRL  115

Query  357  SSYLPKGDEHDMEVDTATSATQ-APVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSA  533
            SS++PKGDEHDMEVDTA+SATQ AP KH   ELEIYCY +VL+FLIDQK+Y+EAKACSSA
Sbjct  116  SSFVPKGDEHDMEVDTASSATQAAPSKHLPAELEIYCYFIVLLFLIDQKKYNEAKACSSA  175

Query  534  SIVRLKTLNR  563
            SI RLK +NR
Sbjct  176  SIARLKNVNR  185



>ref|XP_009773690.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Nicotiana sylvestris]
Length=488

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  126  EQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLT  305
            E Q A S    S  PSV Q LK+IASLIE+GA   EVR+I +A+RLTM LR+KLK S L+
Sbjct  33   EDQSAPSVYDCSVDPSVLQDLKEIASLIESGANTSEVRKIYKAMRLTMKLRRKLKVSILS  92

Query  306  AFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIF  485
            AFLN+ L P SEVH++LSSYLP+ D++D +VD    AT+A  KH VPELEIYCYLLVLIF
Sbjct  93   AFLNYALGPVSEVHAQLSSYLPQQDKYDTQVDVEMPATEAHSKHLVPELEIYCYLLVLIF  152

Query  486  LIDQKRYSEAKACSSASIVRLKTLN  560
            LIDQK+Y+EAKACSS SIV LK +N
Sbjct  153  LIDQKKYNEAKACSSKSIVSLKNMN  177



>ref|XP_007017885.1| PAM domain (PCI/PINT associated module) protein isoform 4 [Theobroma 
cacao]
 gb|EOY15110.1| PAM domain (PCI/PINT associated module) protein isoform 4 [Theobroma 
cacao]
Length=474

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+ Q    +SVSS  PS   HLK+IASLIETG+Y +EVRRI RAVRLT  LR+
Sbjct  1    MTQDVEMKDHQTP-PHSVSSAVPSTLHHLKEIASLIETGSYTKEVRRIVRAVRLTFGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL A  L+AFL+F L PGSE  +RLSS+LPK DEH+MEVDTATSA Q   KH +PELEIY
Sbjct  60   KLTAPVLSAFLDFALQPGSEALARLSSFLPKEDEHEMEVDTATSAVQTSGKHLLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVL++LIDQK+Y+EAKACSSAS+ RLK+LNR
Sbjct  120  CYLLVLLYLIDQKKYNEAKACSSASVNRLKSLNR  153



>ref|XP_007017882.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 gb|EOY15107.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
Length=487

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+ Q    +SVSS  PS   HLK+IASLIETG+Y +EVRRI RAVRLT  LR+
Sbjct  1    MTQDVEMKDHQTP-PHSVSSAVPSTLHHLKEIASLIETGSYTKEVRRIVRAVRLTFGLRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL A  L+AFL+F L PGSE  +RLSS+LPK DEH+MEVDTATSA Q   KH +PELEIY
Sbjct  60   KLTAPVLSAFLDFALQPGSEALARLSSFLPKEDEHEMEVDTATSAVQTSGKHLLPELEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVL++LIDQK+Y+EAKACSSAS+ RLK+LNR
Sbjct  120  CYLLVLLYLIDQKKYNEAKACSSASVNRLKSLNR  153



>ref|XP_003545019.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Glycine max]
 gb|KHN39404.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=490

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 122/157 (78%), Gaps = 4/157 (3%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            M++D EMK+Q    S+ +SS  PS   HLK IAS+IETG+Y++EVRRIARA+RLT A R+
Sbjct  1    MSEDEEMKDQATP-SHLLSSVPPSTLHHLKGIASIIETGSYSKEVRRIARALRLTFAFRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHD--MEVDTATSATQA-PVKHSVPEL  452
            KL    L++FL+++L+P SE H+RLSSYLP   E D  MEVD+ATS  Q    KH +PEL
Sbjct  60   KLTTPVLSSFLDYVLTPASEPHTRLSSYLPNPKEGDREMEVDSATSTIQTLAAKHLLPEL  119

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            EIYCYLLVL+FLIDQKRY  AKACSSASIVRLK+LNR
Sbjct  120  EIYCYLLVLLFLIDQKRYDAAKACSSASIVRLKSLNR  156



>emb|CDX87648.1| BnaA07g32250D [Brassica napus]
Length=482

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  120  MKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRKKLKAST  299
            MK+     + S+ S   S  QHLK+IA+LI+TG+Y +EVRR+ARAVRLT+ +R+KL AS 
Sbjct  1    MKDNNQTPAQSIVSATTSTLQHLKEIAALIDTGSYTKEVRRVARAVRLTVGIRQKLTASV  60

Query  300  LTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVL  479
            + +FL+F L  GSE H+RLSS++PK DEHDMEVDTA+S + A  KH   ELEIYCY +VL
Sbjct  61   VASFLDFALGSGSEAHARLSSFVPKSDEHDMEVDTASSTSLAASKHVPVELEIYCYFIVL  120

Query  480  IFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +FLIDQK+Y+EAKACSSASI RLK+LN+
Sbjct  121  LFLIDQKKYNEAKACSSASIARLKSLNK  148



>ref|XP_009773691.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X3 [Nicotiana sylvestris]
Length=487

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 112/145 (77%), Gaps = 1/145 (1%)
 Frame = +3

Query  126  EQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLT  305
            E Q A S    S  PSV Q LK+IASLIE+GA   EVR+I +A+RLTM LR+KLK S L+
Sbjct  33   EDQSAPSVYDCSVDPSVLQDLKEIASLIESGANTSEVRKIYKAMRLTMKLRRKLKVSILS  92

Query  306  AFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIF  485
            AFLN+ L P SEVH++LSSYLP+ D++D +VD    AT+A  KH VPELEIYCYLLVLIF
Sbjct  93   AFLNYALGPVSEVHAQLSSYLPQ-DKYDTQVDVEMPATEAHSKHLVPELEIYCYLLVLIF  151

Query  486  LIDQKRYSEAKACSSASIVRLKTLN  560
            LIDQK+Y+EAKACSS SIV LK +N
Sbjct  152  LIDQKKYNEAKACSSKSIVSLKNMN  176



>gb|KJB15844.1| hypothetical protein B456_002G199200 [Gossypium raimondii]
Length=430

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  267  MALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVP  446
            MALR+KLKAS L++FL+F L+PGSE  +RLSSYLPK DE++MEVDTATS  Q P KHS+P
Sbjct  1    MALRRKLKASVLSSFLSFALTPGSEAFTRLSSYLPKEDENEMEVDTATSTAQPPAKHSLP  60

Query  447  ELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            ELEIYCYLLVLIFLIDQK+Y EAKACSSASI RLK LNR
Sbjct  61   ELEIYCYLLVLIFLIDQKKYDEAKACSSASIARLKNLNR  99



>gb|EPS67790.1| hypothetical protein M569_06981, partial [Genlisea aurea]
Length=487

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 126/158 (80%), Gaps = 2/158 (1%)
 Frame = +3

Query  90   IIETMTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTM  269
            I+  MTQDVEMK Q PA S++ S   PS  Q+LK+IA+L+E GAY REVRRI RA+R T+
Sbjct  1    ILSKMTQDVEMKMQLPASSDTSSPPSPSTLQNLKEIAALVEMGAYGREVRRIVRAIRCTI  60

Query  270  ALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPE  449
             LRKKL AS +++FLNF L PGSE+ SRLSSY+PK  +H MEVDTA++  QA  KH++PE
Sbjct  61   QLRKKLNASVISSFLNFTLVPGSEILSRLSSYIPKDGDHHMEVDTASA--QAHGKHTLPE  118

Query  450  LEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +EI+ YLLV+IFLIDQK+YSEAKACS++ I RL+ LNR
Sbjct  119  IEIFSYLLVIIFLIDQKKYSEAKACSTSGIARLRNLNR  156



>gb|AFW65683.1| hypothetical protein ZEAMMB73_847170 [Zea mays]
Length=337

 Score =   157 bits (397),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 115/157 (73%), Gaps = 3/157 (2%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGP---SVFQHLKDIASLIETGayarevrriaravrLTMA  272
            MT+DV+M + +P  + S  + G    S   HLK+IAS+IE G+ ++EVRRI+RA RLT+A
Sbjct  1    MTEDVQMNDSEPQPAASAPAVGAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTVA  60

Query  273  LRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPEL  452
            LR++L A  ++AFL F L   SE + RL++ +PK D+ +M+VD A  ATQ  +KH +PE+
Sbjct  61   LRRRLAARDVSAFLAFALPASSEAYGRLTALVPKEDDTEMDVDAAAPATQISIKHGLPEI  120

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            EIYCYLLVLIFLID K+Y EAKAC+S SI RLK LNR
Sbjct  121  EIYCYLLVLIFLIDHKKYDEAKACASVSIARLKNLNR  157



>ref|XP_010666922.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+ Q A SNS+SS  P   +HLK+IASL+ETG+Y +E RRI+RA+RLT  +R 
Sbjct  1    MTQDVEMKDTQ-AHSNSLSSADPPTLKHLKEIASLLETGSYTKETRRISRAIRLTFVIRH  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL +  L  FL++ L PGSE H ++S++LPKG EH+MEVDTATSA Q   K ++PELEI+
Sbjct  60   KLTSRVLHLFLDYALVPGSEAHGKISAFLPKGGEHEMEVDTATSAVQTSGKSTLPELEIF  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYL+VL+FLIDQK Y+EAKAC++ASI RLK+L R
Sbjct  120  CYLIVLLFLIDQKLYNEAKACAAASIARLKSLKR  153



>ref|XP_009628273.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Nicotiana tomentosiformis]
Length=486

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +3

Query  159  STGPSVFQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGS  338
            S  PSV Q LK+IAS+IE+GA   EVR+I +A+RLTM LR+KLK S L+AFLN+ L   S
Sbjct  42   SVDPSVLQDLKEIASMIESGANTSEVRKIYKAMRLTMKLRRKLKVSMLSAFLNYALGHVS  101

Query  339  EVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAK  518
            EVH++LSSY+P+ D++D +VD   S T+A   H VPELE YCYLLVLIFLIDQK+Y EAK
Sbjct  102  EVHAQLSSYVPQQDKYDTQVDVEMSETEAHSTHLVPELETYCYLLVLIFLIDQKKYKEAK  161

Query  519  ACSSASIVRLKTLN  560
            ACSS SIVRLK +N
Sbjct  162  ACSSESIVRLKNMN  175



>emb|CDY31901.1| BnaC07g15510D [Brassica napus]
Length=251

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 111/152 (73%), Gaps = 8/152 (5%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            M QDVEMK+          +   S  QHLK+IA LI+TG+Y +EVRRIARAVRLT+ LR+
Sbjct  1    MAQDVEMKDNH--------TPSQSTMQHLKEIADLIDTGSYTKEVRRIARAVRLTIGLRR  52

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL +S LT+FL+F L PGSE HSRLSS+ PKGDEHDMEVDTATSATQ P K+   ELEIY
Sbjct  53   KLTSSVLTSFLDFALVPGSEPHSRLSSFTPKGDEHDMEVDTATSATQPPSKNLPSELEIY  112

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTL  557
            CY +VL+FLIDQK+Y E       +++  +TL
Sbjct  113  CYFIVLLFLIDQKKYPELNLVLQQALLVSRTL  144



>ref|NP_001149170.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
 gb|ACG34451.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=491

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 115/157 (73%), Gaps = 3/157 (2%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGP---SVFQHLKDIASLIETGayarevrriaravrLTMA  272
            MT+DV+M + +P  + S  + G    S   HLK+IAS+IE G+ ++EVRRI+RA RLT+A
Sbjct  1    MTEDVQMNDSEPQPAASAPAVGAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTVA  60

Query  273  LRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPEL  452
            LR++L A  ++AFL F L   SE + RL++ +PK D+ +M+VD A  ATQ  +KH +PE+
Sbjct  61   LRRRLAARDVSAFLAFALPASSEAYGRLTALVPKEDDTEMDVDAAAPATQISIKHGLPEI  120

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            EIYCYLLVLIFLID K+Y EAKAC+S SI RLK LNR
Sbjct  121  EIYCYLLVLIFLIDHKKYDEAKACASVSIARLKNLNR  157



>gb|ACN28097.1| unknown [Zea mays]
 gb|AFW65684.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=491

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 115/157 (73%), Gaps = 3/157 (2%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGP---SVFQHLKDIASLIETGayarevrriaravrLTMA  272
            MT+DV+M + +P  + S  + G    S   HLK+IAS+IE G+ ++EVRRI+RA RLT+A
Sbjct  1    MTEDVQMNDSEPQPAASAPAVGAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTVA  60

Query  273  LRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPEL  452
            LR++L A  ++AFL F L   SE + RL++ +PK D+ +M+VD A  ATQ  +KH +PE+
Sbjct  61   LRRRLAARDVSAFLAFALPASSEAYGRLTALVPKEDDTEMDVDAAAPATQISIKHGLPEI  120

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            EIYCYLLVLIFLID K+Y EAKAC+S SI RLK LNR
Sbjct  121  EIYCYLLVLIFLIDHKKYDEAKACASVSIARLKNLNR  157



>ref|XP_004231453.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Solanum lycopersicum]
Length=484

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 115/151 (76%), Gaps = 4/151 (3%)
 Frame = +3

Query  108  QDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRKKL  287
            Q+V+++ Q P  S    S  PSV Q LK++ASLIE GAY  EV++I RA+RLTM LR KL
Sbjct  30   QEVKVQHQSPP-SVYDCSVDPSVLQDLKEVASLIEGGAYTSEVQKIYRAMRLTMKLRSKL  88

Query  288  KASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCY  467
            KAS L+AFLN++L  GSE H RLSSYLP+ D HD + D  T AT++  KH +PELE++CY
Sbjct  89   KASVLSAFLNYVLISGSEFHKRLSSYLPR-DRHDSQCDVGTPATES--KHLLPELEMFCY  145

Query  468  LLVLIFLIDQKRYSEAKACSSASIVRLKTLN  560
            LLVLIFLIDQK+Y+EAKACSS SIV LK+ N
Sbjct  146  LLVLIFLIDQKKYNEAKACSSESIVLLKSKN  176



>ref|XP_009628274.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Nicotiana tomentosiformis]
Length=485

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  159  STGPSVFQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGS  338
            S  PSV Q LK+IAS+IE+GA   EVR+I +A+RLTM LR+KLK S L+AFLN+ L   S
Sbjct  42   SVDPSVLQDLKEIASMIESGANTSEVRKIYKAMRLTMKLRRKLKVSMLSAFLNYALGHVS  101

Query  339  EVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAK  518
            EVH++LSSY+P+ D++D +VD   S T+A   H VPELE YCYLLVLIFLIDQK+Y EAK
Sbjct  102  EVHAQLSSYVPQ-DKYDTQVDVEMSETEAHSTHLVPELETYCYLLVLIFLIDQKKYKEAK  160

Query  519  ACSSASIVRLKTLN  560
            ACSS SIVRLK +N
Sbjct  161  ACSSESIVRLKNMN  174



>gb|ACA51024.1| proteasome regulatory subunit S3 [Oryza sativa Japonica Group]
Length=222

 Score =   149 bits (375),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  177  FQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHSRL  356
              HLK+IAS+IE G+ ++EVRRI+RAVRLT+ALR++L A  ++AFL F L P SE ++RL
Sbjct  24   LHHLKEIASVIEAGSLSKEVRRISRAVRLTVALRRRLAARDVSAFLAFALPPSSEAYTRL  83

Query  357  SSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSAS  536
            +S +PK D+ +M++D A  ATQ  +KH +PE+EIYCYLLVLIFLIDQK+Y +AKAC++AS
Sbjct  84   TSLVPKEDDTEMDIDMAAPATQISIKHGLPEIEIYCYLLVLIFLIDQKKYDDAKACANAS  143

Query  537  IVRLKTLNR  563
            I RLK LNR
Sbjct  144  IARLKNLNR  152



>gb|EAZ09931.1| hypothetical protein OsI_32229 [Oryza sativa Indica Group]
Length=487

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 112/154 (73%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            M +DVEM + QP  + +      S  QHLK+IAS+IE G+  +EVRRI+RAVRLT+ALR+
Sbjct  1    MPEDVEMNDSQPQPAAAPPPAA-STLQHLKEIASVIEAGSLTKEVRRISRAVRLTVALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            +L A  + AFL F L   SE  +RLSS LPK D  +M+VD+A  A Q  +KH +PE+EIY
Sbjct  60   RLAARDVAAFLAFALPHSSEAFARLSSLLPKEDGSEMDVDSAAPAAQVSIKHGLPEIEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLID K+Y EAKAC+SASI RLK LNR
Sbjct  120  CYLLVLIFLIDNKKYDEAKACASASITRLKNLNR  153



>ref|NP_001063817.1| Os09g0541900 [Oryza sativa Japonica Group]
 dbj|BAB82474.1| 21D7 [Oryza sativa Japonica Group]
 dbj|BAC79193.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Oryza 
sativa Japonica Group]
 dbj|BAD46593.1| putative nuclear antigen 21D7 [Oryza sativa Japonica Group]
 dbj|BAF25731.1| Os09g0541900 [Oryza sativa Japonica Group]
 gb|EAZ45527.1| hypothetical protein OsJ_30188 [Oryza sativa Japonica Group]
Length=487

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 111/154 (72%), Gaps = 1/154 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            M +DVEM + QP  + +      S  QHLK+IAS+IE G+  +EVRRI+RAVRLT+ALR+
Sbjct  1    MPEDVEMNDSQPQPAAAPPPAA-STLQHLKEIASVIEAGSLTKEVRRISRAVRLTVALRR  59

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            +L A  + AFL F L   SE  +RLSS LPK D  +M+VD A  A Q  +KH +PE+EIY
Sbjct  60   RLAARDVAAFLAFALPHSSEAFARLSSLLPKEDGSEMDVDLAAPAAQVSIKHGLPEIEIY  119

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CYLLVLIFLID K+Y EAKAC+SASI RLK LNR
Sbjct  120  CYLLVLIFLIDNKKYDEAKACASASITRLKNLNR  153



>ref|XP_006660365.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Oryza brachyantha]
Length=486

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  171  SVFQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHS  350
            S   HLK+IAS+IE G+ ++EVRRI+RAVRLT+ALR++L A  ++AFL F L P SE +S
Sbjct  22   SALHHLKEIASVIEAGSLSKEVRRISRAVRLTVALRRRLAARDVSAFLAFALPPSSEAYS  81

Query  351  RLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSS  530
            RL+S +PK DE +M+VD A  ATQ  +KH +PE+EIYC LLVLIFLIDQK+Y +AKAC++
Sbjct  82   RLTSLVPKEDETEMDVDAAAPATQISIKHGLPEIEIYCSLLVLIFLIDQKKYDDAKACAN  141

Query  531  ASIVRLKTLNR  563
            ASI RLK LNR
Sbjct  142  ASIARLKNLNR  152



>gb|EEE69116.1| hypothetical protein OsJ_28197 [Oryza sativa Japonica Group]
Length=467

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  177  FQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHSRL  356
              HLK+IAS+IE G+ ++EVRRI+RAVRLT+ALR++L A  ++AFL F L P SE ++RL
Sbjct  24   LHHLKEIASVIEAGSLSKEVRRISRAVRLTVALRRRLAARDVSAFLAFALPPSSEAYTRL  83

Query  357  SSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSAS  536
            +S +PK D+ +M++D A  ATQ  +KH +PE+EIYCYLLVLIFLIDQK+Y +AKAC++AS
Sbjct  84   TSLVPKEDDTEMDIDMAAPATQISIKHGLPEIEIYCYLLVLIFLIDQKKYDDAKACANAS  143

Query  537  IVRLKTLNR  563
            I RLK LNR
Sbjct  144  IARLKNLNR  152



>ref|NP_001062444.1| Os08g0550100 [Oryza sativa Japonica Group]
 dbj|BAD08959.1| putative 21D7 [Oryza sativa Japonica Group]
 dbj|BAF24358.1| Os08g0550100 [Oryza sativa Japonica Group]
Length=486

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  177  FQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHSRL  356
              HLK+IAS+IE G+ ++EVRRI+RAVRLT+ALR++L A  ++AFL F L P SE ++RL
Sbjct  24   LHHLKEIASVIEAGSLSKEVRRISRAVRLTVALRRRLAARDVSAFLAFALPPSSEAYTRL  83

Query  357  SSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSAS  536
            +S +PK D+ +M++D A  ATQ  +KH +PE+EIYCYLLVLIFLIDQK+Y +AKAC++AS
Sbjct  84   TSLVPKEDDTEMDIDMAAPATQISIKHGLPEIEIYCYLLVLIFLIDQKKYDDAKACANAS  143

Query  537  IVRLKTLNR  563
            I RLK LNR
Sbjct  144  IARLKNLNR  152



>ref|XP_004974153.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Setaria italica]
Length=491

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 116/157 (74%), Gaps = 3/157 (2%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGP---SVFQHLKDIASLIETGayarevrriaravrLTMA  272
            M +DV+M + +P  +    +      S   HLK+IAS+IE G+ ++EVRRI+RAVRLT+A
Sbjct  1    MPEDVQMNDSEPQPAAPTPAAAAPALSTLHHLKEIASVIEAGSLSKEVRRISRAVRLTVA  60

Query  273  LRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPEL  452
            LR++L A  ++AFL F L   SE ++RL++ +PK D+ +M+VD A  ATQ  +KH +PE+
Sbjct  61   LRRRLAARDVSAFLGFALPASSEAYARLTALVPKEDDTEMDVDAAAPATQISIKHGLPEI  120

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            EIYCYLLVLIFLIDQK+Y EAKAC+++SI RLK LNR
Sbjct  121  EIYCYLLVLIFLIDQKKYDEAKACATSSIARLKNLNR  157



>gb|EMT22108.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Aegilops 
tauschii]
Length=496

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +3

Query  171  SVFQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHS  350
            S  QHLK+IAS++E G+  +EVRRI+RAVRLT+ALR++L A  + AFL F L P SE  +
Sbjct  32   STLQHLKEIASVVEAGSLTKEVRRISRAVRLTVALRRRLAAPDVAAFLAFALPPSSEAFT  91

Query  351  RLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSS  530
            RLS  LPK D  +M+VDTA  A Q  +KH +PE+EIYCYLLVLIFLID K+Y EAKAC++
Sbjct  92   RLSPLLPKEDGSEMDVDTAAPAAQVSIKHGLPEIEIYCYLLVLIFLIDHKKYDEAKACAN  151

Query  531  ASIVRLKTLNR  563
            +SI RLK LNR
Sbjct  152  SSIARLKNLNR  162



>ref|XP_010229049.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Brachypodium distachyon]
Length=490

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGP--SVFQHLKDIASLIETGayarevrriaravrLTMAL  275
            M +DV+M EQQ A   + ++  P  S   HLK+IAS+IE G+  +EVRRI+RAVRLT+AL
Sbjct  1    MPEDVQMSEQQAAPPAAATAAAPAPSTLHHLKEIASVIEAGSLTKEVRRISRAVRLTVAL  60

Query  276  RKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELE  455
            R++L    ++AFL F L   +E ++RL+S LPK D+ +M++D    ATQ  +KH +PE+E
Sbjct  61   RRRLGHRDVSAFLAFALPASTEAYARLTSLLPKEDDTEMDLDATAQATQISIKHGLPEIE  120

Query  456  IYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            IYCYLLVLIFLIDQK+Y EAKAC++ SI RLK +NR
Sbjct  121  IYCYLLVLIFLIDQKKYDEAKACATTSIARLKNMNR  156



>gb|ABR16257.1| unknown [Picea sitchensis]
Length=492

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = +3

Query  105  TQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRKK  284
            TQDVEMK+   A SNS + + P V  HLK++++LIE G   +EVR + RA+R  M LR+K
Sbjct  3    TQDVEMKDSAAAPSNSSAPSPPPVLTHLKNVSALIEKGVVTKEVRLMIRAIRHIMTLRRK  62

Query  285  LKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQ-APVKHSV-PELEI  458
            +KAS + AFL  +L PGSEV SRL  Y PK DE DMEVD+ +S +Q  P KH++ PELEI
Sbjct  63   IKASHVLAFLKQLLPPGSEVASRLLLYFPKEDEKDMEVDSPSSTSQTVPSKHTILPELEI  122

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            + YLLVLIFLIDQK+Y+EAK CSSA+I RLK  NR
Sbjct  123  FAYLLVLIFLIDQKQYNEAKNCSSAAISRLKQFNR  157



>dbj|BAK01467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  MTQDVEMKE-QQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALR  278
            MT+DV+M E Q      + ++  PS  QHLK+IA++IE G+ ++EVRRI+RAVRLT+ALR
Sbjct  1    MTEDVQMGEPQAAPPPAAAAAPAPSTLQHLKEIAAVIEAGSLSKEVRRISRAVRLTVALR  60

Query  279  KKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEI  458
            ++L A  ++AFL F L   S+ ++RL+  LPK DE +M+VD A   TQ  +KH +PE+EI
Sbjct  61   RRLAARDVSAFLAFALPASSDAYARLTPLLPKEDEAEMDVDAAAPPTQISIKHGLPEIEI  120

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YC LLVLIFLIDQK+Y EAK+C++ SI RLK LNR
Sbjct  121  YCSLLVLIFLIDQKKYDEAKSCATGSIARLKNLNR  155



>dbj|BAK07086.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +3

Query  171  SVFQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHS  350
            S  QHLK+IAS++E G+  +EVRRI+RA+RLT+ALR++L A  + AFL F L P SE  +
Sbjct  32   STLQHLKEIASVVEAGSLTKEVRRISRAIRLTVALRRRLAAPDVAAFLAFALPPSSEAFT  91

Query  351  RLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSS  530
            RLS  LPK D  +M+VD A  A Q  +KH +PE+EIYCYLLVLIFLID K+Y EAKAC++
Sbjct  92   RLSPLLPKEDGSEMDVDAAAPAAQVSIKHGLPEIEIYCYLLVLIFLIDHKKYDEAKACAN  151

Query  531  ASIVRLKTLNR  563
            +SI RLK LNR
Sbjct  152  SSIARLKNLNR  162



>dbj|BAJ90869.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +3

Query  171  SVFQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHS  350
            S  QHLK+IAS++E G+  +EVRRI+RA+RLT+ALR++L A  + AFL F L P SE  +
Sbjct  32   STLQHLKEIASVVEAGSLTKEVRRISRAIRLTVALRRRLAAPDVAAFLAFALPPSSEAFT  91

Query  351  RLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSS  530
            RLS  LPK D  +M+VD A  A Q  +KH +PE+EIYCYLLVLIFLID K+Y EAKAC++
Sbjct  92   RLSPLLPKEDGSEMDVDAAAPAAQVSIKHGLPEIEIYCYLLVLIFLIDHKKYDEAKACAN  151

Query  531  ASIVRLKTLNR  563
            +SI RLK LNR
Sbjct  152  SSIARLKNLNR  162



>ref|XP_002444618.1| hypothetical protein SORBIDRAFT_07g024800 [Sorghum bicolor]
 gb|EES14113.1| hypothetical protein SORBIDRAFT_07g024800 [Sorghum bicolor]
Length=496

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 113/162 (70%), Gaps = 8/162 (5%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGP--------SVFQHLKDIASLIETGayarevrriarav  257
            M +DV+M + +P  +  V             S   HLK+IA++IE G+ ++EVRRI+RA 
Sbjct  1    MPEDVQMNDSEPQPAAPVPVAAAAAAAAPALSTLHHLKEIATVIEAGSLSKEVRRISRAF  60

Query  258  rLTMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKH  437
            RLT+ALR++L A  ++AFL F L   SE + RL++ +PK D+ +M+VD A  ATQ  +KH
Sbjct  61   RLTVALRRRLAARDVSAFLAFALPASSEAYGRLTALVPKEDDTEMDVDAAAPATQISIKH  120

Query  438  SVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
             +PE+EI+CYLLVLIFLIDQK+Y EAKAC++ SI RLK LNR
Sbjct  121  GLPEIEIFCYLLVLIFLIDQKKYDEAKACANVSIARLKNLNR  162



>gb|ACG34075.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=492

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 111/158 (70%), Gaps = 4/158 (3%)
 Frame = +3

Query  102  MTQDVEMKEQQP----ALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTM  269
            M +DV+M + +P        + ++   S   HLK+IAS+IE G+ ++EVRRI+RA RLT+
Sbjct  1    MPEDVQMNDSEPQSAAPAPAAAAAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTV  60

Query  270  ALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPE  449
            ALR++L A  ++AFL F L   SE + RL + +PK D+ +M+VD A  ATQ  +KH +PE
Sbjct  61   ALRRRLAARDVSAFLAFALPASSEAYGRLIALVPKEDDTEMDVDAAAPATQISIKHGLPE  120

Query  450  LEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +EIYCYLL LIFLIDQK+Y EAK C+S SI RLK LNR
Sbjct  121  IEIYCYLLALIFLIDQKKYDEAKVCASVSIARLKNLNR  158



>ref|XP_004957510.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Setaria italica]
Length=489

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 109/155 (70%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  MTQDVEMKE-QQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALR  278
            M +DVEM +    A +    +   S   HLK+IAS+IE G+ ++EVRRI+RA RLT+ALR
Sbjct  1    MPEDVEMNDSAATAAAADAPAPAQSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTIALR  60

Query  279  KKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEI  458
            ++L A  + AFL F L P SE  +RL++ +PK D  +M+VD A    Q  +KH +PE+EI
Sbjct  61   RRLAARDVAAFLAFALPPSSEAFARLAALVPKEDGSEMDVDAAAPTAQVSIKHGLPEIEI  120

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YCYLLVLIFLID K+Y EAK C+SASI RLK+LNR
Sbjct  121  YCYLLVLIFLIDNKKYDEAKTCASASIARLKSLNR  155



>gb|ACF84535.1| unknown [Zea mays]
 gb|ACN28040.1| unknown [Zea mays]
 tpg|DAA48733.1| TPA: 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=492

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 110/158 (70%), Gaps = 4/158 (3%)
 Frame = +3

Query  102  MTQDVEMKEQQP----ALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTM  269
            M +DV+M + +P        + ++   S   HLK+IAS+IE G+ ++EVRRI+RA RLT+
Sbjct  1    MPEDVQMNDSEPQSAAPAPAAAAAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTV  60

Query  270  ALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPE  449
            ALR++L A  ++AFL F L   SE + RL + +PK D+ +M+VD    ATQ  +KH +PE
Sbjct  61   ALRRRLAARDVSAFLAFALPASSEAYGRLIALVPKEDDTEMDVDAVAPATQISIKHGLPE  120

Query  450  LEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +EIYCYLL LIFLIDQK+Y EAK C+S SI RLK LNR
Sbjct  121  IEIYCYLLALIFLIDQKKYDEAKVCASVSIARLKNLNR  158



>ref|NP_001149380.1| LOC100283005 [Zea mays]
 gb|ACG35233.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=492

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 110/158 (70%), Gaps = 4/158 (3%)
 Frame = +3

Query  102  MTQDVEMKEQQP----ALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTM  269
            M +DV+M + +P        + ++   S   HLK+IAS+IE G+ ++EVRRI+RA RLT+
Sbjct  1    MPEDVQMNDSEPQSAAPAPAAAAAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTV  60

Query  270  ALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPE  449
            ALR++L A  ++AFL F L   SE + RL + +PK D+ +M+VD    ATQ  +KH +PE
Sbjct  61   ALRRRLAARDVSAFLAFALPASSEAYRRLIALVPKEDDTEMDVDAVAPATQISIKHGLPE  120

Query  450  LEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +EIYCYLL LIFLIDQK+Y EAK C+S SI RLK LNR
Sbjct  121  IEIYCYLLALIFLIDQKKYDEAKVCASVSIARLKNLNR  158



>ref|XP_010446200.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=475

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 114/151 (75%), Gaps = 9/151 (6%)
 Frame = +3

Query  120  MKEQQPALSNSVS-STGPSVFQHLKDIASLIETGayarevrriaravrLTMALRKKLKAS  296
            MK+ Q    + VS +T  S  QHLK+IA+LI+T    +EVRRIARAVRLT+ LR+KL  S
Sbjct  1    MKDNQTQTQSLVSATTTTSTLQHLKEIAALIDT----KEVRRIARAVRLTVGLRRKLSGS  56

Query  297  TLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSAT-QAPVKHSV-PELEIYCYL  470
             +++FL+F L PGSE H+RLS ++PKGD  DMEVDTA+S+T QAP       ELEIYCY 
Sbjct  57   VISSFLDFALVPGSEAHTRLSCFVPKGD--DMEVDTASSSTSQAPPPPPPPTELEIYCYF  114

Query  471  LVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            ++L+FLIDQK+Y+EAK CSSASI RLK +NR
Sbjct  115  ILLLFLIDQKKYNEAKVCSSASIARLKNVNR  145



>emb|CDY54330.1| BnaCnng26760D [Brassica napus]
Length=353

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 108/154 (70%), Gaps = 19/154 (12%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQDVEMK+      + +SST  S  QHLK+IA+LI+TG+Y +EVRR+ARAVRLT+ LR+
Sbjct  1    MTQDVEMKDNHTPSQSIISSTTTSTIQHLKEIAALIDTGSYTKEVRRVARAVRLTVGLRR  60

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIY  461
            KL AS L++FL                    GDEHDMEVDTA+S  QA  KH   ELEIY
Sbjct  61   KLTASVLSSFL-------------------LGDEHDMEVDTASSVAQASSKHLSAELEIY  101

Query  462  CYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            CY +VL+FL+DQ +Y+EAKACSSASI RLK LNR
Sbjct  102  CYFIVLLFLVDQNKYNEAKACSSASIARLKNLNR  135



>ref|XP_002300686.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
 gb|EEE79959.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
Length=492

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 107/145 (74%), Gaps = 5/145 (3%)
 Frame = +3

Query  135  PALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRKKL-KASTLTAF  311
            PA SNS++S      + L DIASLIETG+   EV  IARAVRLT +L+KKL + + L AF
Sbjct  14   PAPSNSITSPMEGSLKSLMDIASLIETGSCKEEVFHIARAVRLTNSLKKKLAEPNLLQAF  73

Query  312  LNFILSPGSEVHSRLSSYLP-KGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFL  488
            L+F LSP SE+H+RLS +L  +G E  ME D+ATSA   P K   PELEIYCYLL+L+FL
Sbjct  74   LDFALSPRSELHNRLSGFLDHQGGELGMEADSATSA---PAKRVSPELEIYCYLLMLLFL  130

Query  489  IDQKRYSEAKACSSASIVRLKTLNR  563
            IDQ RY+EAKA SSA++VR++ L+R
Sbjct  131  IDQNRYNEAKAFSSAAVVRVENLSR  155



>ref|XP_003578544.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Brachypodium distachyon]
Length=497

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = +3

Query  177  FQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHSRL  356
             QHLK+IA ++E G+  +EVRRI+RAVRLT+ALR++L A  + AFL F L+P SE  +RL
Sbjct  35   LQHLKEIALVVEAGSLTKEVRRISRAVRLTVALRRRLAARDVAAFLAFALAPSSEAFTRL  94

Query  357  SSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSAS  536
            S  LPK D  +M+VD A  A Q  +KH +PE+EIYCYLLVLIFLID K+Y EAKAC++AS
Sbjct  95   SPLLPKEDGSEMDVDAAALAAQVSIKHGLPEIEIYCYLLVLIFLIDHKKYDEAKACANAS  154

Query  537  IVRLKTLNR  563
            I RLK +NR
Sbjct  155  IARLKNINR  163



>ref|XP_011034975.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Populus euphratica]
Length=492

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = +3

Query  186  LKDIASLIETGayarevrriaravrLTMALRKKL-KASTLTAFLNFILSPGSEVHSRLSS  362
            L DIASLIETG+  +EV  IARAVRLT +L+KKL + + L AFL+F LSPGSE+H+RLS 
Sbjct  30   LMDIASLIETGSCKKEVFHIARAVRLTNSLKKKLAEPNLLQAFLDFALSPGSELHNRLSG  89

Query  363  YLP-KGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASI  539
            +L  +  E  ME D+ATSA   P K   PELEIYCYLL+L+FLIDQ RY+EAKA SSA++
Sbjct  90   FLHHQRGELGMEADSATSA---PAKRVSPELEIYCYLLMLLFLIDQNRYNEAKAFSSAAV  146

Query  540  VRLKTLNR  563
            VR++ L+R
Sbjct  147  VRVENLSR  154



>ref|XP_011034972.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Populus euphratica]
 ref|XP_011034973.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Populus euphratica]
Length=517

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = +3

Query  186  LKDIASLIETGayarevrriaravrLTMALRKKL-KASTLTAFLNFILSPGSEVHSRLSS  362
            L DIASLIETG+  +EV  IARAVRLT +L+KKL + + L AFL+F LSPGSE+H+RLS 
Sbjct  30   LMDIASLIETGSCKKEVFHIARAVRLTNSLKKKLAEPNLLQAFLDFALSPGSELHNRLSG  89

Query  363  YLP-KGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASI  539
            +L  +  E  ME D+ATSA   P K   PELEIYCYLL+L+FLIDQ RY+EAKA SSA++
Sbjct  90   FLHHQRGELGMEADSATSA---PAKRVSPELEIYCYLLMLLFLIDQNRYNEAKAFSSAAV  146

Query  540  VRLKTLNR  563
            VR++ L+R
Sbjct  147  VRVENLSR  154



>ref|XP_011034976.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X3 [Populus euphratica]
Length=491

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = +3

Query  186  LKDIASLIETGayarevrriaravrLTMALRKKL-KASTLTAFLNFILSPGSEVHSRLSS  362
            L DIASLIETG+  +EV  IARAVRLT +L+KKL + + L AFL+F LSPGSE+H+RLS 
Sbjct  30   LMDIASLIETGSCKKEVFHIARAVRLTNSLKKKLAEPNLLQAFLDFALSPGSELHNRLSG  89

Query  363  YLP-KGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASI  539
            +L  +  E  ME D+ATSA   P K   PELEIYCYLL+L+FLIDQ RY+EAKA SSA++
Sbjct  90   FLHHQRGELGMEADSATSA---PAKRVSPELEIYCYLLMLLFLIDQNRYNEAKAFSSAAV  146

Query  540  VRLKTLNR  563
            VR++ L+R
Sbjct  147  VRVENLSR  154



>dbj|BAB78499.1| 26S proteasome regulatory particle non-ATPase subunit3 [Oryza 
sativa Japonica Group]
Length=419

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +3

Query  309  FLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFL  488
            FL F L P SE ++RL+S +PK D+ +M++D A  ATQ  +KH +PE+EIYCYLLVLIFL
Sbjct  1    FLAFALPPSSEAYTRLTSLVPKEDDTEMDIDMAAPATQISIKHGLPEIEIYCYLLVLIFL  60

Query  489  IDQKRYSEAKACSSASIVRLKTLNR  563
            IDQK+Y +AKAC++ASI RLK LNR
Sbjct  61   IDQKKYDDAKACANASIARLKNLNR  85



>emb|CDM82954.1| unnamed protein product [Triticum aestivum]
Length=244

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = +3

Query  279  KKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEI  458
            ++L A  + AFL F L P SE  +R S  LPK D  +M+VD A  A Q  +KH +PE++I
Sbjct  69   RRLVAPDIAAFLAFALPPSSEAFTRFSPLLPKEDSSEMDVDVAALAAQVSIKHGLPEIKI  128

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            YC LLVLIFLID K+Y E KAC+SASI RLK LNR
Sbjct  129  YCDLLVLIFLIDHKKYDEVKACASASIARLKNLNR  163



>gb|EMS49644.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Triticum 
urartu]
Length=517

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = +3

Query  186  LKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHSRLSSY  365
            ++  AS +E G+  +EVRRI+RAVRLT+ALR++L A  + AFL F L   SE   RLS  
Sbjct  58   VRSTASGVEAGSPTKEVRRISRAVRLTVALRRRLAAPDVAAFLAFALPASSEAFPRLSPL  117

Query  366  LPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVR  545
            LPK D  +M+VD A  A Q  +KH +PE+EIYCYLLVLIFLID K+Y EAKAC+++SI R
Sbjct  118  LPKEDGSEMDVDAAAPAAQVSIKHGLPEIEIYCYLLVLIFLIDHKKYDEAKACANSSIAR  177

Query  546  LKTLNR  563
            LK LNR
Sbjct  178  LKNLNR  183



>ref|XP_001764054.1| predicted protein [Physcomitrella patens]
 gb|EDQ71193.1| predicted protein [Physcomitrella patens]
Length=486

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 102/159 (64%), Gaps = 13/159 (8%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            M  DVEM        +S+ S  PS+   L+ + S IE G  ++E+R +ARA R  +A+R+
Sbjct  1    MGLDVEM--------SSLDSAPPSLLSQLRGVISSIEKGVASKEMRLMARANRQMLAVRR  52

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLP--KGDEHDMEVDTATSATQAPV--KHSV-P  446
            +LK ST+ AFL   L  GS+  +RL  +L   +  E DM+VDT  +  Q+PV  K SV P
Sbjct  53   QLKPSTVNAFLKNTLPAGSDALARLLPFLAAVEKSEKDMDVDTPPATGQSPVSQKQSVLP  112

Query  447  ELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            E+E++CYLLV IFLIDQK+   AKACSSA++ RL+ LNR
Sbjct  113  EVEVFCYLLVTIFLIDQKQLEVAKACSSAAVKRLQQLNR  151



>gb|EMS46362.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Triticum 
urartu]
Length=651

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 96/172 (56%), Gaps = 46/172 (27%)
 Frame = +3

Query  186  LKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHSRLSSY  365
            ++  AS +E G+  +EVRRI+RAVRLT+ALR++L A  ++AFL F L   S+ ++RL+  
Sbjct  146  VRSTASGVEAGSPTKEVRRISRAVRLTVALRRRLAARDVSAFLAFALPANSDAYARLTPL  205

Query  366  LPKG----------------------------------------------DEHDMEVDTA  407
            LPK                                               DE +M++D A
Sbjct  206  LPKSILEVSSSATSSSRNGVASLARARQDLAGVIHLQLYFFSFCMWELAEDEAEMDIDAA  265

Query  408  TSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
              ATQ  +KH +PE+EIYC LLVLIFLIDQK+Y EAKAC++ SI RLK LNR
Sbjct  266  APATQISIKHGLPEIEIYCSLLVLIFLIDQKKYDEAKACATGSIARLKNLNR  317



>gb|EMT33081.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Aegilops 
tauschii]
Length=496

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 77/144 (53%), Gaps = 43/144 (30%)
 Frame = +3

Query  261  LTMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPK----------------------  374
            LT+ALR++L A  ++AFL F L   S+ ++RL+  LPK                      
Sbjct  19   LTVALRRRLAARDVSAFLAFALPANSDAYARLTPLLPKLLVIRQLKIFFGSVDFGSEQFS  78

Query  375  ---------------------GDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLI  491
                                  DE +M++D A  ATQ  +KH +PE+EIYC LLVLIFLI
Sbjct  79   NKLEPGTAWRHWRGLARTSPEEDEAEMDIDAAAPATQISIKHGLPEIEIYCSLLVLIFLI  138

Query  492  DQKRYSEAKACSSASIVRLKTLNR  563
            DQK+Y EAKAC++ SI RLK LNR
Sbjct  139  DQKKYDEAKACATGSIARLKNLNR  162



>ref|XP_002970446.1| hypothetical protein SELMODRAFT_231540 [Selaginella moellendorffii]
 ref|XP_002978519.1| hypothetical protein SELMODRAFT_233136 [Selaginella moellendorffii]
 gb|EFJ20505.1| hypothetical protein SELMODRAFT_233136 [Selaginella moellendorffii]
 gb|EFJ28576.1| hypothetical protein SELMODRAFT_231540 [Selaginella moellendorffii]
Length=482

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +3

Query  120  MKEQQPALS--NSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRKKLKA  293
            MKE  PA+S  +     GPS+  HLK IA+L+E G   +E+R + RAVR  M +++KLK 
Sbjct  1    MKEAAPAVSSPDRKDQAGPSLLSHLKSIAALVEKGVSTKEMRLMVRAVRNVMVIKRKLKP  60

Query  294  STLTAFLNFILSPGSEVHSRLSSYLPKGDEHD--MEVDTATSATQAPVKHSVPELEIYCY  467
             +L AF+ +++S  ++    +  ++ K +E    MEVD  +  +  P  + +PELEI CY
Sbjct  61   GSLAAFVKYVMSTDAD---SVLQFVKKQEEDKVSMEVDMPSQVSNKP--NVLPELEILCY  115

Query  468  LLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            LLVLI+L DQK+Y +AKAC+ A I RL+ LNR
Sbjct  116  LLVLIYLHDQKQYKQAKACADAGIKRLQQLNR  147



>ref|XP_001757567.1| predicted protein [Physcomitrella patens]
 gb|EDQ77624.1| predicted protein [Physcomitrella patens]
Length=486

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 13/159 (8%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            M Q+V+MK   PA         PSV   +K + + IE G   +E+R +ARA R  + +R+
Sbjct  1    MGQEVDMKPADPA--------PPSVLSQMKVVITSIEKGVSNKEMRLMARANRQMLVVRR  52

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLP--KGDEHDMEVDTATSATQAPV---KHSVP  446
            +L AS + AFL   L  GS+  +RLS ++     +E DM+VDT   + Q+ V   +  +P
Sbjct  53   QLNASVVNAFLKHALPAGSDALARLSPFVAGIAKNEKDMDVDTPPISGQSHVSQKQSGLP  112

Query  447  ELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            E+EI+CYLLV IFLIDQK+  E+K CSSA++ RL+ LNR
Sbjct  113  EVEIFCYLLVTIFLIDQKQLEESKTCSSAAVKRLQQLNR  151



>ref|XP_001753136.1| predicted protein [Physcomitrella patens]
 gb|EDQ82177.1| predicted protein [Physcomitrella patens]
Length=486

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 97/159 (61%), Gaps = 13/159 (8%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            M QDVE +         V    PSV   LK + + IE G   +E+R +ARA R   A+R+
Sbjct  1    MGQDVEKR--------PVEVVPPSVLSQLKGVIASIEKGVLNKEMRLMARANRQMFAVRR  52

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLP--KGDEHDMEVDTA--TSATQAPVKHSV-P  446
            +LK ST++A +   L  GS+  +RLS ++   +  E DM+VD+   T  +    K SV P
Sbjct  53   QLKTSTVSAIMKHALPAGSDALARLSPFVAALEKSEKDMDVDSPAITGQSHGSQKQSVLP  112

Query  447  ELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            E+EI+CYLLV IFLIDQK+  EAKACS+A++ RL+ LNR
Sbjct  113  EVEIFCYLLVTIFLIDQKKLKEAKACSTAAVKRLQQLNR  151



>gb|KEH36262.1| 26S proteasome non-ATPase regulatory subunit 3 [Medicago truncatula]
Length=423

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 3/65 (5%)
 Frame = +3

Query  378  DEHDMEVDTATSATQAPV---KHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRL  548
            D+H+MEVD ATSA Q P+   KH +PELEIYCYLLVL+FLIDQK+Y+EAKACSSAS+  L
Sbjct  25   DDHEMEVDAATSAIQTPIPTAKHLLPELEIYCYLLVLLFLIDQKKYNEAKACSSASVAWL  84

Query  549  KTLNR  563
            K +NR
Sbjct  85   KNVNR  89



>ref|XP_006660915.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Oryza brachyantha]
Length=392

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +3

Query  390  MEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            M+VD+ATS  Q  +KH +PE+EIYCY LVLIFLID KRY EAK C+SASI RLK LNR
Sbjct  1    MDVDSATSVAQVSIKHGLPEIEIYCYFLVLIFLIDNKRYDEAKTCASASIARLKNLNR  58



>dbj|BAG87837.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +3

Query  390  MEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            M++D A  ATQ  +KH +PE+EIYCYLLVLIFLIDQK+Y +AKAC++ASI RLK LNR
Sbjct  1    MDIDMAAPATQISIKHGLPEIEIYCYLLVLIFLIDQKKYDDAKACANASIARLKNLNR  58



>dbj|BAG94867.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95111.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +3

Query  390  MEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            M+VD A  A Q  +KH +PE+EIYCYLLVLIFLID K+Y EAKAC+SASI RLK LNR
Sbjct  1    MDVDLAAPAAQVSIKHGLPEIEIYCYLLVLIFLIDNKKYDEAKACASASITRLKNLNR  58



>dbj|BAK06811.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  390  MEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            M+VD A   TQ  +KH +PE+EIYC LLVLIFLIDQK+Y EAK+C++ SI RLK LNR
Sbjct  1    MDVDAAAPPTQISIKHGLPEIEIYCSLLVLIFLIDQKKYDEAKSCATGSIARLKNLNR  58



>ref|XP_006386166.1| hypothetical protein POPTR_0002s01940g [Populus trichocarpa]
 gb|ERP63963.1| hypothetical protein POPTR_0002s01940g [Populus trichocarpa]
Length=481

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 93/154 (60%), Gaps = 11/154 (7%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            M+QD E+     A  +S +S   S ++ L  I S IE    + +V R ARAVRLT  LRK
Sbjct  1    MSQDSEINSNSTA--SSYTSAFISTYESLMKIVSHIE---LSSDVLRTARAVRLTNCLRK  55

Query  282  KLKASTLTAFL-NFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEI  458
             L   TL  +L +F L   SE+++RLSS+L    E D E D+A S     ++ S+ ELE 
Sbjct  56   NLTEDTLIQYLLHFGLLKNSELNARLSSFLII--EEDEEADSAMSV--CAIEFSL-ELEF  110

Query  459  YCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLN  560
            YCY LVLIFLIDQKRY++AK CS   I R+ +LN
Sbjct  111  YCYFLVLIFLIDQKRYNKAKVCSLDGITRVMSLN  144



>gb|KEH36263.1| 26S proteasome non-ATPase regulatory subunit 3 [Medicago truncatula]
Length=453

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 47/56 (84%), Gaps = 3/56 (5%)
 Frame = +3

Query  405  ATSATQAPV---KHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            ATSA Q P+   KH +PELEIYCYLLVL+FLIDQK+Y+EAKACSSAS+  LK +NR
Sbjct  64   ATSAIQTPIPTAKHLLPELEIYCYLLVLLFLIDQKKYNEAKACSSASVAWLKNVNR  119



>ref|XP_010446093.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=392

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 6/65 (9%)
 Frame = +3

Query  372  KGDEHDMEVDTATSAT-QAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRL  548
            KGD  DMEVDTA+S+T QAP      ELEIYCY ++L+FLIDQK+Y+EA  CSSASI RL
Sbjct  3    KGD--DMEVDTASSSTSQAP---PPTELEIYCYFILLLFLIDQKKYNEAIVCSSASIARL  57

Query  549  KTLNR  563
            K +NR
Sbjct  58   KNVNR  62



>ref|XP_003588288.1| 26S proteasome subunit RPN3a, partial [Medicago truncatula]
 ref|XP_003604950.1| 26S proteasome subunit RPN3a, partial [Medicago truncatula]
 ref|XP_003607062.1| 26S proteasome subunit RPN3a, partial [Medicago truncatula]
 ref|XP_003630780.1| 26S proteasome subunit RPN3a, partial [Medicago truncatula]
Length=85

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 66/92 (72%), Gaps = 9/92 (10%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGPSVFQHLKDIASLIETGayarevrriaravrLTMALRK  281
            MTQD EMK+  P  S S+    PS  QHLK+IAS+IETG+  +EVR+I+RAVRLT+ALR 
Sbjct  1    MTQDEEMKDL-PTPSQSI----PSTLQHLKEIASIIETGSNLKEVRKISRAVRLTLALRS  55

Query  282  KLKASTLTAFLNFILSPGSEVHSRLSSYLPKG  377
            KL A  L++FL+++L P    HS LSSYLP  
Sbjct  56   KLTAPVLSSFLHYVLPP----HSTLSSYLPNS  83



>gb|AFW65682.1| hypothetical protein ZEAMMB73_847170 [Zea mays]
Length=112

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTGP---SVFQHLKDIASLIETGayarevrriaravrLTMA  272
            MT+DV+M + +P  + S  + G    S   HLK+IAS+IE G+ ++EVRRI+RA RLT+A
Sbjct  1    MTEDVQMNDSEPQPAASAPAVGAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTVA  60

Query  273  LRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPK  374
            LR++L A  ++AFL F L   SE + RL++ +PK
Sbjct  61   LRRRLAARDVSAFLAFALPASSEAYGRLTALVPK  94



>ref|XP_002945863.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
 gb|EFJ52858.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
Length=490

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = +3

Query  264  TMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSV  443
            T ++RK+L AS +  FL  +L    E  + L S++ +     M+ D AT++ Q  V   +
Sbjct  58   TASVRKQLTASNVKCFLQQMLPAELESRTFLCSHVEQAAASGMDADEATTSAQCEVSAVI  117

Query  444  PELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            PE+E Y YL+VLIFL D  +Y  A++ +  ++ RL   NR
Sbjct  118  PEVEFYAYLIVLIFLCDTNQYQLARSVADHAVTRLAQFNR  157



>ref|XP_004354913.1| 26S proteasome regulatory subunit S3 [Dictyostelium fasciculatum]
 gb|EGG16513.1| 26S proteasome regulatory subunit S3 [Dictyostelium fasciculatum]
Length=494

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 70/126 (56%), Gaps = 5/126 (4%)
 Frame = +3

Query  186  LKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHSRLSSY  365
            LK    LIE G   +E R I R +R T A+RKKL A  L   +     P S   + L SY
Sbjct  37   LKKNVQLIEKGVDTKESRFITRVLRQTTAIRKKLNAKILYQIIATTF-PESSRKASLLSY  95

Query  366  LPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVR  545
            +   D   M++D++  A+     H +PE+E Y  LLV+IFLIDQK+Y EA  CS++ +  
Sbjct  96   VKGND--GMDIDSSAGASSKD--HILPEVEAYLQLLVVIFLIDQKKYVEATQCSTSLVEL  151

Query  546  LKTLNR  563
            ++  NR
Sbjct  152  IQPNNR  157



>ref|XP_001696175.1| 26S proteasome regulatory subunit [Chlamydomonas reinhardtii]
 gb|EDP08152.1| 26S proteasome regulatory subunit [Chlamydomonas reinhardtii]
Length=488

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 55/100 (55%), Gaps = 0/100 (0%)
 Frame = +3

Query  264  TMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSV  443
            T  +RK+L A+ + AFL   L    E  + L+  + +     ME D AT+A        +
Sbjct  57   TATVRKQLTAANVKAFLRQTLPADLESRTFLTGQVEQAASSSMESDEATTAASCESTSVL  116

Query  444  PELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            PE+E+Y YL+VL+FL D++ Y  A+  + A++ R+   NR
Sbjct  117  PEVELYAYLIVLLFLSDRQEYKLARTVADAAVARVGQFNR  156



>ref|XP_001134521.1| 26S proteasome regulatory subunit S3 [Dictyostelium discoideum 
AX4]
 sp|Q1ZXD3.1|PSMD3_DICDI RecName: Full=26S proteasome non-ATPase regulatory subunit 3; 
AltName: Full=26S proteasome regulatory subunit RPN3 [Dictyostelium 
discoideum]
 gb|EAS66838.1| 26S proteasome regulatory subunit S3 [Dictyostelium discoideum 
AX4]
Length=504

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 67/126 (53%), Gaps = 8/126 (6%)
 Frame = +3

Query  177  FQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHSR-  353
            F  LK    LI+ G   +E+R I   +R T ++RKKL    L   +NF  S  +    + 
Sbjct  34   FADLKKNIGLIDKGVDTKEMRFIISVLRQTQSIRKKLNYKVLNQIVNFAFSHQNHATKKN  93

Query  354  -LSSYLPKGDEHDMEVDTATSATQAPV-----KHSVPELEIYCYLLVLIFLIDQKRYSEA  515
             L S+L K D   M++D+ T A +         H   E+E Y +LLVLI+LIDQK+Y +A
Sbjct  94   FLLSFL-KSDGSSMDIDSTTQAEKETTPSSSSSHLNIEVESYIHLLVLIYLIDQKKYEDA  152

Query  516  KACSSA  533
              CSSA
Sbjct  153  TKCSSA  158



>ref|XP_011034977.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Populus euphratica]
Length=385

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  447  ELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLN  560
            ELE YCY LVLIFLIDQKRY+EAK CS   I R+ +LN
Sbjct  11   ELEFYCYFLVLIFLIDQKRYNEAKVCSLDGITRVMSLN  48



>ref|XP_005649181.1| 26S proteasome regulatory subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE24637.1| 26S proteasome regulatory subunit [Coccomyxa subellipsoidea C-169]
Length=498

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 84/168 (50%), Gaps = 15/168 (9%)
 Frame = +3

Query  102  MTQDVEMKEQQPALSNSVSSTG---------PSVFQHLKDIASLIETGayarevrriara  254
            M + +EMK+   A S+S ++           PSV   L    SL+E+   A+E R +   
Sbjct  1    MGKAIEMKDADAAPSDSTAARTEKKETAEQPPSVSAQLATNVSLLESAVRAKETRLLVGR  60

Query  255  v-rLTMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPV  431
            + R T A+RK+L A  L  F+  +L  G    S L ++L K     ME D   +  ++  
Sbjct  61   LLRQTTAVRKQLTAENLADFVKNVLPRGYPGTSLLLTHLNKASSA-METDGTDAPAESAA  119

Query  432  KHS----VPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
              S    +PELE Y YLLV+ FL+D+K Y EAK   +A I R+   NR
Sbjct  120  ASSAVGLLPELETYAYLLVVTFLVDKKLYPEAKEVVTAGISRVADFNR  167



>ref|XP_003290828.1| hypothetical protein DICPUDRAFT_98819 [Dictyostelium purpureum]
 gb|EGC32659.1| hypothetical protein DICPUDRAFT_98819 [Dictyostelium purpureum]
Length=446

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (56%), Gaps = 4/102 (4%)
 Frame = +3

Query  264  TMALRKKLKASTLTAFLNFILSPGSEVHSR--LSSYLPKGDEHDMEVDTATSATQAPVKH  437
            T ++RKKL    LT  +N + S  +    +  L S+L   +   M+VD++   T  P  H
Sbjct  11   TSSIRKKLTQKVLTQIINQVFSHANYTTKKNFLLSFLKSNES--MDVDSSKETTVTPQSH  68

Query  438  SVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
               E+E Y YLLVLI LIDQ++Y ++   SSA I  +++ NR
Sbjct  69   LNVEVEGYVYLLVLIHLIDQEKYEDSTKVSSALIETIQSNNR  110



>gb|EEC83998.1| hypothetical protein OsI_30168 [Oryza sativa Indica Group]
Length=339

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +3

Query  177  FQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSPGSEVHSRL  356
              HLK+IAS+IE G+ ++EVRRI+RAVRLT+ALR++L A  ++AFL F L P SE ++RL
Sbjct  24   LHHLKEIASVIEAGSLSKEVRRISRAVRLTVALRRRLAARDVSAFLAFALPPSSEAYTRL  83

Query  357  SSYLPK  374
            +S +PK
Sbjct  84   TSLVPK  89



>gb|EIF46605.1| proteasome regulatory particle subunit [Brettanomyces bruxellensis 
AWRI1499]
Length=483

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 76/157 (48%), Gaps = 12/157 (8%)
 Frame = +3

Query  120  MKEQQPALS--------NSVSSTGP-SVFQHLKDIASLIETGayarevrriaravrLTMA  272
            M +++PA S         +V  T P +  ++LK+  SLIE  A   + R + +  R    
Sbjct  1    MTQEKPAQSATTKTVKGKTVDVTPPVNALENLKEFYSLIEXSAETFDPRYVLKVFRELTP  60

Query  273  LRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPEL  452
            +RK++   TL +F+NF     SE    L   L      DME D   S    P    + E+
Sbjct  61   IRKQIDLETLVSFINFTYPYTSEHRKYLLETLSYDSSADMETDGDDSQ---PKSAPIAEI  117

Query  453  EIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +++C+LLV IFL+D K+Y +  +  +  I  +K  +R
Sbjct  118  DVFCHLLVQIFLLDGKKYDQLYSFGNICIKLMKLYDR  154



>ref|XP_006383748.1| hypothetical protein POPTR_0005s26560g, partial [Populus trichocarpa]
 gb|ERP61545.1| hypothetical protein POPTR_0005s26560g, partial [Populus trichocarpa]
Length=292

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  387  DMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLN  560
            D E D+ATS+        +PE+ ++CY LVLIFL++Q+RY EAK CS   + +L  +N
Sbjct  2    DEEDDSATSSHPICGGGFLPEILLFCYFLVLIFLVEQRRYEEAKTCSMDGLNQLMDIN  59



>gb|KHJ49054.1| hypothetical protein D918_00172 [Trichuris suis]
Length=502

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 69/138 (50%), Gaps = 13/138 (9%)
 Frame = +3

Query  174  VFQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSP--GSEVH  347
            +F+ LK+    +E    A   R   R VR   ALRK+L +  L   +NF +S    + + 
Sbjct  35   IFEILKENVRYLERAEEANVPRFANRTVRGLTALRKELSSRILVRIINFAMSDPSAANLK  94

Query  348  SRLSSYLPKGDEHDMEVDTATSATQAPV------KHSVPELEIYCYLLVLIFLIDQKRYS  509
            + L +YL    E     D  +   + P+        ++PE+E Y  LLV++FL+D+KR+ 
Sbjct  95   ADLLNYLKSAPE-----DGKSLPEKKPIPAGGHDHEAIPEVEAYLRLLVILFLVDEKRFE  149

Query  510  EAKACSSASIVRLKTLNR  563
            EA+ C+   I R +  NR
Sbjct  150  EAQTCAQEMIYRCEKHNR  167



>gb|KFD53466.1| hypothetical protein M513_05730 [Trichuris suis]
 gb|KFD66498.1| hypothetical protein M514_05730 [Trichuris suis]
Length=500

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 69/138 (50%), Gaps = 13/138 (9%)
 Frame = +3

Query  174  VFQHLKDIASLIETGayarevrriaravrLTMALRKKLKASTLTAFLNFILSP--GSEVH  347
            +F+ LK+    +E    A   R   R VR   ALRK+L +  L   +NF +S    + + 
Sbjct  35   IFEILKENVRYLERAEEANVPRFANRTVRGLTALRKELSSRILVRIINFAMSDPSAANLK  94

Query  348  SRLSSYLPKGDEHDMEVDTATSATQAPV------KHSVPELEIYCYLLVLIFLIDQKRYS  509
            + L +YL    E     D  +   + P+        ++PE+E Y  LLV++FL+D+KR+ 
Sbjct  95   ADLLNYLKSAPE-----DGKSLPEKKPIPAGGHDHEAIPEVEAYLRLLVILFLVDEKRFE  149

Query  510  EAKACSSASIVRLKTLNR  563
            EA+ C+   I R +  NR
Sbjct  150  EAQTCAQEMIYRCEKHNR  167



>ref|XP_007340608.1| diphenol oxidase-A2 [Auricularia delicata TFB-10046 SS5]
 gb|EJD51211.1| diphenol oxidase-A2 [Auricularia delicata TFB-10046 SS5]
Length=492

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 50/98 (51%), Gaps = 5/98 (5%)
 Frame = +3

Query  270  ALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPE  449
            +LRKKL A+ L   +  + S        + +YLP G    M+VDT    T    K  +PE
Sbjct  64   SLRKKLDATVLADAVRTVWSKDGATRGHILAYLP-GASTGMDVDT----TSGKDKDVLPE  118

Query  450  LEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
             E Y  LLVL FLID K Y+ A   ++ ++  +  LNR
Sbjct  119  TEAYVRLLVLDFLIDNKNYARAIELANETVDVVHRLNR  156



>ref|XP_003074100.1| putative nuclear antigen 21D7 (ISS), partial [Ostreococcus tauri]
Length=456

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 5/106 (5%)
 Frame = +3

Query  261  LTMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHS  440
             T  +R++     + AF+  +L   S     LS+             T TS   A     
Sbjct  68   FTATVRREFTGENVRAFVRAVLPEESAAREALSARCGATGAKTTSKGTDTSDGDAIDASE  127

Query  441  V-----PELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +     PE+E+Y YL+VL++LIDQKR ++A  C+  ++ R++  NR
Sbjct  128  IAPCAFPEMEVYAYLVVLMYLIDQKRGTDALECAREAVDRIRQFNR  173



>dbj|GAM26028.1| hypothetical protein SAMD00019534_092030 [Acytostelium subglobosum 
LB1]
Length=478

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 21/100 (21%)
 Frame = +3

Query  264  TMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSV  443
            T  +RKKL    LT  +  + +                  ++ME+D+  +     +   +
Sbjct  64   TTTIRKKLNQKALTQIVAHVFT------------------NNMEIDSVPNTAPTSI---I  102

Query  444  PELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            PE+E Y +LLV+IFLID KRY +A  CS+A +  ++  NR
Sbjct  103  PEVEAYIHLLVVIFLIDSKRYDDAIKCSTALVENIQQNNR  142



>emb|CEF96488.1| 26S proteasome regulatory subunit, C-terminal [Ostreococcus tauri]
Length=490

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 51/105 (49%), Gaps = 5/105 (5%)
 Frame = +3

Query  264  TMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSV  443
            T  +R++     + AF+  +L   S     LS+             T TS   A     +
Sbjct  54   TATVRREFTGENVRAFVRAVLPEESAAREALSARCGATGAKTTSKGTDTSDGDAIDASEI  113

Query  444  -----PELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
                 PE+E+Y YL+VL++LIDQKR ++A  C+  ++ R++  NR
Sbjct  114  APCAFPEMEVYAYLVVLMYLIDQKRGTDALECAREAVDRIRQFNR  158



>ref|XP_008815694.1| 26S proteasome regulatory subunit N3 [Plasmodium inui San Antonio 
1]
 gb|EUD67684.1| 26S proteasome regulatory subunit N3 [Plasmodium inui San Antonio 
1]
Length=507

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 55/103 (53%), Gaps = 4/103 (4%)
 Frame = +3

Query  267  MALRKKLKASTLT----AFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVK  434
            M L  K ++STL     + +N     G  ++  L+ YL +  E   EV   ++       
Sbjct  68   MRLSIKNESSTLMPIMISLINKTFKEGYPIYEILAKYLEEFRELPKEVPEFSNINDKTYA  127

Query  435  HSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            H+ PE+E+  Y+++L++L+D+K Y+EA   S+  + R+  LNR
Sbjct  128  HAAPEIEVLFYIMILLYLLDKKCYNEAMDLSTVIVNRITKLNR  170



>ref|XP_007869404.1| PCI-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ52226.1| PCI-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
Length=502

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 76/161 (47%), Gaps = 11/161 (7%)
 Frame = +3

Query  111  DVEMKEQQPALSNSVSSTGP-------SVFQHLKDIASLIETGayarevrriaravrLTM  269
            DVEMK +  A   +   T         S    +K   +LIE      E R   R +R   
Sbjct  3    DVEMKTEDKAQDKAQDKTKEEPKPVPVSPAAEIKSNVALIERAVATLEPRFTMRVLRTLT  62

Query  270  ALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGD--EHDMEVDTATSATQAPVKHSV  443
            +LRK+L  + L   +  +    S +   L S+LP     +H M++D A ++++ P    V
Sbjct  63   SLRKRLNDAVLREAVEEVYPKDSSIKKSLLSWLPAATSADHSMDIDGAPASSK-PTSDPV  121

Query  444  PELEIYCYLLVL-IFLIDQKRYSEAKACSSASIVRLKTLNR  563
            PE+EIY  LL+L  FL  Q  Y +A   +  ++ +++ LNR
Sbjct  122  PEVEIYLRLLILHHFLSSQSTYGKAMELAQDTVAKMQALNR  162



>ref|XP_971686.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Tribolium castaneum]
 gb|EFA04054.1| hypothetical protein TcasGA2_TC014286 [Tribolium castaneum]
Length=495

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 81/159 (51%), Gaps = 17/159 (11%)
 Frame = +3

Query  111  DVEMK--EQQPALSNSVSSTGPSVFQHLKDI---ASLIETGayarevrriaravrLTMAL  275
            DVEMK  +  P L    S      FQ+L +I   A  IE     +E R I R +R     
Sbjct  12   DVEMKNADSPPGLEAGDSKRTID-FQNLVEIREQARQIEKAVTNKENRFILRVLRCLPNT  70

Query  276  RKKLKASTLTAFLNFILSPGSEVHSRLSSYL---PKGDEHDMEVDTATSATQAPVKHSVP  446
            R+KL  + L   +N I  P SE  + L+ YL   P G E  +E   A SAT++PV    P
Sbjct  71   RRKLNGAVLKGLVNQIY-PVSERDA-LTEYLEDVPAGLE--LETGRARSATKSPV----P  122

Query  447  ELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            E++ Y +LL+L++LID  + ++   CS A + ++   NR
Sbjct  123  EVDAYIHLLILVYLIDTSKLTDGVRCSQALMNKITVQNR  161



>ref|XP_002259967.1| proteasome regulatory component [Plasmodium knowlesi strain H]
 emb|CAQ41234.1| proteasome regulatory component, putative [Plasmodium knowlesi 
strain H]
Length=506

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = +3

Query  267  MALRKKLKASTLTAFLNFILSP----GSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVK  434
            M L  K ++STL   +  ++S     G  ++  L  Y+ +  E   EV   ++       
Sbjct  67   MRLSIKNESSTLMPIMTNLISKTFKEGYPIYEILFKYINEFKELPKEVPEFSNINDKTYT  126

Query  435  HSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            H+ PE+E++ Y+++L++L+D+K Y+EA   S+  + R+  LNR
Sbjct  127  HAAPEIEVFFYIMILLYLLDKKCYNEAMDLSTVIVNRITKLNR  169



>ref|XP_002967101.1| hypothetical protein SELMODRAFT_408501 [Selaginella moellendorffii]
 gb|EFJ31700.1| hypothetical protein SELMODRAFT_408501 [Selaginella moellendorffii]
Length=173

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 52/100 (52%), Gaps = 15/100 (15%)
 Frame = +3

Query  264  TMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSV  443
             MA R KLK  +L       L     V     S L   D+  MEVD ++   Q+P K +V
Sbjct  11   VMAARHKLKPGSLGCIYQVHLLYMIPV-----SNLKPEDDKTMEVDMSS---QSPSKQNV  62

Query  444  -PELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLN  560
             PELEI CYL+VLI+LIDQK+      C    + +++T+ 
Sbjct  63   LPELEILCYLIVLIYLIDQKQ------CKQLYLGKIRTIQ  96



>ref|XP_004223628.1| 26S proteasome non-ATPase regulatory subunit 3 [Plasmodium cynomolgi 
strain B]
 dbj|GAB67681.1| 26S proteasome non-ATPase regulatory subunit 3 [Plasmodium cynomolgi 
strain B]
Length=509

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 55/103 (53%), Gaps = 4/103 (4%)
 Frame = +3

Query  267  MALRKKLKASTLT-AFLNFI---LSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVK  434
            M L  K +++TL    +N I      G  ++  LS Y+ +  E   EV    +       
Sbjct  70   MRLSIKNESTTLMPIMINLISKTFKEGYPIYDILSKYIGEFKELPKEVPDFLNINDKTYT  129

Query  435  HSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            H+ PE+E++ Y+++L++L+D+K Y+EA   S+  + R+  LNR
Sbjct  130  HAAPEIEVFFYIMILLYLLDKKCYNEAMDLSTVIVNRITKLNR  172



>ref|XP_001614166.1| 26S proteasome non-ATPase regulatory subunit 3 [Plasmodium vivax 
Sal-1]
 gb|EDL44439.1| 26S proteasome non-ATPase regulatory subunit 3, putative [Plasmodium 
vivax]
Length=519

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +3

Query  324  LSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLIDQKR  503
               G  ++  L+ Y+ +  E   EV    +  +    H+ PE+E++ Y++VL++L+D K 
Sbjct  97   FKEGYPIYEILAKYIDEFRELPKEVPDFLNINEKTYTHAAPEIEVFFYIMVLLYLLDNKC  156

Query  504  YSEAKACSSASIVRLKTLNR  563
            Y+EA   S+  + R+  LNR
Sbjct  157  YNEAMDLSTVIVNRITKLNR  176



>ref|XP_004340207.1| proteasome (prosome, macropain) 26S subunit, non ATPase, 32, 
putative [Acanthamoeba castellanii str. Neff]
 gb|ELR18187.1| proteasome (prosome, macropain) 26S subunit, non ATPase, 32, 
putative [Acanthamoeba castellanii str. Neff]
Length=511

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 57/106 (54%), Gaps = 11/106 (10%)
 Frame = +3

Query  276  RKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEV------DTATSATQAPVKH  437
            R+ +  + LTA ++ +L+  +E+ ++L SY+ K  E  ME         A + T+ P   
Sbjct  59   RRHINRNVLTATVDEVLANENELKAKLHSYVSKLPE-PMETVSEETKPAAAAKTEEPAAA  117

Query  438  S----VPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +     PE+EIY  L+  I L+D K + EA ACS+  I  L+T NR
Sbjct  118  APLPLQPEVEIYLRLVTTIALVDNKLFDEAAACSTDMIKSLQTYNR  163



>ref|XP_002595252.1| hypothetical protein BRAFLDRAFT_268075 [Branchiostoma floridae]
 gb|EEN51264.1| hypothetical protein BRAFLDRAFT_268075 [Branchiostoma floridae]
Length=512

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 75/173 (43%), Gaps = 27/173 (16%)
 Frame = +3

Query  108  QDVEMKEQQPALSNSVSSTGPS-----VFQHLKDIASLIETGayarevrriaravrLTMA  272
            QDVEMK+     +  V   G         + +++   LIE G   +E R ++R +    A
Sbjct  14   QDVEMKDADSVPNGDVPEKGKKETDQLTLEDIREQVKLIEKGVNGKEPRFVSRVLWSFSA  73

Query  273  LRKKLKASTLTAFLN-FILSPGSEVHSRLSSYLPKGDEHDMEVDTATSA-----------  416
             R++L  S L   +N +  S        L  YL      D  +DT + A           
Sbjct  74   TRRRLNHSVLRRLINAYFPSTNMAAKEALQQYL------DEPMDTESHASTPSSSVSTPS  127

Query  417  ----TQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
                +  P    VPE+E+Y  LLV++ LID KR  +A  CS + + ++  LNR
Sbjct  128  TRPRSSRPPPTYVPEVEVYIQLLVVVHLIDTKRLDDALQCSESLVQKIIGLNR  180



>gb|ESA00649.1| hypothetical protein GLOINDRAFT_338417, partial [Rhizophagus 
irregularis DAOM 181602]
Length=395

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 56/98 (57%), Gaps = 3/98 (3%)
 Frame = +3

Query  270  ALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPE  449
            ++RK+L A  L+  +  +    +    RL  +L K D   M+VD+  +    P    +PE
Sbjct  60   SIRKRLNAEILSQAIRDVYPRDAVDKRRLLKFLGK-DSGVMDVDSDDTTKDNP--QVLPE  116

Query  450  LEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +++Y +LLV+I+L+D++ Y +    S+ +I +++ LNR
Sbjct  117  IDLYLHLLVMIYLLDKQDYYQGILLSNETIHKIQNLNR  154



>ref|XP_008665628.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Zea mays]
Length=92

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = +3

Query  354  LSSYLPKGDEHDMEVDTATSATQAPVKHSVPELEIYCYLLVLIFLID  494
            ++ Y+   D+ +M+VD     +   +KH + E+EIYCYLLVLIFLID
Sbjct  49   VAKYIASEDDTNMDVDVVAPIS---IKHGLLEIEIYCYLLVLIFLID  92



>gb|EXX77250.1| proteasome regulatory particle lid subunit RPN3 [Rhizophagus 
irregularis DAOM 197198w]
Length=491

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 56/98 (57%), Gaps = 3/98 (3%)
 Frame = +3

Query  270  ALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSVPE  449
            ++RK+L A  L+  +  +    +    RL  +L K D   M+VD+  +    P    +PE
Sbjct  60   SIRKRLNAEILSQAIRDVYPRDAVDKRRLLKFLGK-DSGVMDVDSDDTTKDNP--QVLPE  116

Query  450  LEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +++Y +LLV+I+L+D++ Y +    S+ +I +++ LNR
Sbjct  117  IDLYLHLLVMIYLLDKQDYYQGILLSNETIHKIQNLNR  154



>ref|XP_002733522.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3-like 
isoform X1 [Saccoglossus kowalevskii]
Length=500

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  441  VPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +PEL++Y +LLV+++LID KRY EA  CS   + +L T NR
Sbjct  127  LPELDVYIHLLVVLYLIDNKRYDEAVKCSDLLMEKLTTYNR  167



>ref|XP_009062478.1| hypothetical protein LOTGIDRAFT_207043 [Lottia gigantea]
 gb|ESO86782.1| hypothetical protein LOTGIDRAFT_207043 [Lottia gigantea]
Length=502

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 56/100 (56%), Gaps = 1/100 (1%)
 Frame = +3

Query  267  MALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPK-GDEHDMEVDTATSATQAPVKHSV  443
            +++R+KL ++ L   ++   +  S+    L+ +L +    + + V     + +A     V
Sbjct  69   VSIRRKLSSNILRKLIHGYYTASSQQKEDLTPFLIEPATVNGIGVPFRPRSGKAATLPLV  128

Query  444  PELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            PEL+IY  LLV+I+LIDQK+Y EA  CS   + ++  +NR
Sbjct  129  PELDIYFNLLVVIYLIDQKKYKEALKCSEQLVNKIGLINR  168



>ref|XP_006814940.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3-like 
isoform X2 [Saccoglossus kowalevskii]
Length=499

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  441  VPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            +PEL++Y +LLV+++LID KRY EA  CS   + +L T NR
Sbjct  127  LPELDVYIHLLVVLYLIDNKRYDEAVKCSDLLMEKLTTYNR  167



>ref|XP_008473192.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Diaphorina citri]
Length=380

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 79/162 (49%), Gaps = 12/162 (7%)
 Frame = +3

Query  99   TMTQDVEMKE-QQPALSNSVSSTGPSV----FQHLKDIASLIETGayarevrriaravrL  263
            T++ DVEMK    PA       T   V     Q +KD    IE     +E R + R +R 
Sbjct  2    TVSTDVEMKNASSPAAEKDKEKTKVDVDAQSIQEIKDQIKQIEKAVQTKEQRFVLRVLRA  61

Query  264  TMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHS-  440
                R+KL    L + ++      S ++S L   +   D ++ME D  + ++Q   K   
Sbjct  62   LPNTRRKLTVPVLKSLIS-----DSSLNSFLEDEMETDDPNEMETDDPSGSSQPSSKSGK  116

Query  441  -VPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
             +PE++ Y +LLVL+ LID KRY +A  CS+  + ++ + NR
Sbjct  117  VLPEVDAYIHLLVLVRLIDNKRYEDAVICSNKLMSKITSENR  158



>gb|KHN76475.1| 26S proteasome non-ATPase regulatory subunit 3 [Toxocara canis]
Length=520

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 52/105 (50%), Gaps = 14/105 (13%)
 Frame = +3

Query  276  RKKLKASTLTAFLNFILSPGSEVHSRLSSYLP----KGDEHDMEVDTATSA---------  416
            RK++ A  L   ++  L+    +  +L ++LP          ME+D              
Sbjct  73   RKQINADVLHKLISTQLAAVPLIREQLLAWLPALPPSSTAVPMEIDVGGRGGGRSPRPLR  132

Query  417  -TQAPVKHSVPELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRL  548
             T   V   VPE+E+Y +LLVL++L+DQKR++ A+ C+   I RL
Sbjct  133  RTGVSVSTPVPEVELYIHLLVLVYLVDQKRWNCAEKCAELLIARL  177



>ref|XP_005850128.1| hypothetical protein CHLNCDRAFT_20545 [Chlorella variabilis]
 gb|EFN58026.1| hypothetical protein CHLNCDRAFT_20545 [Chlorella variabilis]
Length=480

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = +3

Query  264  TMALRKKLKASTLTAFLNFILSPGSEVHSRLSSYLPKGDEHDMEVDTATSATQAPVKHSV  443
            T A+R++L A  L AFL   L P S    +L   + +      ++D   +    P  +++
Sbjct  51   TAAVRRQLTAQELQAFLASALPPASAAAQQLQEAVKQVGHGAADLDMCPARAAPPPANAL  110

Query  444  PELEIYCYLLVLIFLIDQKRYSEAKACSSASIVRLKTLNR  563
            PE+E+Y +LL L+FL+D K+Y  A+  + A++ RL T NR
Sbjct  111  PEVEMYAHLLTLMFLLDHKQYELAQQVAGAAVDRLSTFNR  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920