BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF018F20

Length=557
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009619960.1|  PREDICTED: eukaryotic translation initiation...    311   2e-105   Nicotiana tomentosiformis
ref|XP_009775987.1|  PREDICTED: eukaryotic translation initiation...    309   1e-104   Nicotiana sylvestris
gb|ACJ85889.1|  unknown                                                 307   1e-103   Medicago truncatula
gb|AIA09928.1|  eukaryotic translation initiation factor 5A             306   2e-103   Quercus suber [cork oak]
ref|XP_007037448.1|  Eukaryotic elongation factor 5A-1 isoform 1        306   2e-103   Theobroma cacao [chocolate]
gb|AIT51844.1|  eukaryotic translation initiation factor 5A             305   4e-103   Lindernia brevidens
gb|AAQ08194.1|  eukaryotic translation initiation factor 5A isofo...    305   6e-103   Hevea brasiliensis [jebe]
gb|AET97661.1|  eukaryotic translation initiation factor 5A4            305   6e-103   Camellia sinensis [black tea]
ref|XP_007045976.1|  Eukaryotic elongation factor 5A-1 isoform 2        305   7e-103   
gb|KHG15047.1|  Eukaryotic translation initiation factor 5A             305   8e-103   Gossypium arboreum [tree cotton]
ref|XP_007045975.1|  Eukaryotic elongation factor 5A-1 isoform 1        305   8e-103   
gb|ACJ85877.1|  unknown                                                 305   9e-103   Medicago truncatula
sp|Q9SC12.1|IF5A_SENVE  RecName: Full=Eukaryotic translation init...    304   1e-102   Senecio vernalis
gb|ABM53472.1|  eIF5A                                                   304   1e-102   Rosa chinensis [China rose]
ref|XP_002308400.1|  eukaryotic translation initiation factor 5A ...    304   2e-102   Populus trichocarpa [western balsam poplar]
gb|AEF15864.1|  eukaryotic translation initiation factor 5A4            304   2e-102   Populus tomentosa [Chinese white poplar]
gb|AIT51845.1|  eukaryotic translation initiation factor 5A             304   2e-102   Lindernia subracemosa
gb|AAQ08191.1|  eukaryotic translation initiation factor 5A isofo...    304   2e-102   Hevea brasiliensis [jebe]
gb|ABS01354.1|  translation initiation factor                           304   2e-102   Carica papaya [mamon]
ref|XP_007045977.1|  Eukaryotic elongation factor 5A-1 isoform 3        305   2e-102   
gb|KHN01998.1|  Eukaryotic translation initiation factor 5A             303   2e-102   Glycine soja [wild soybean]
gb|KJB53260.1|  hypothetical protein B456_008G195800                    303   3e-102   Gossypium raimondii
ref|XP_007202692.1|  hypothetical protein PRUPE_ppa012643mg             303   3e-102   Prunus persica
emb|CDP00389.1|  unnamed protein product                                303   3e-102   Coffea canephora [robusta coffee]
ref|XP_008360103.1|  PREDICTED: eukaryotic translation initiation...    303   3e-102   Malus domestica [apple tree]
gb|KJB17390.1|  hypothetical protein B456_003G098700                    303   3e-102   Gossypium raimondii
ref|XP_007223637.1|  hypothetical protein PRUPE_ppa012654mg             303   3e-102   Prunus persica
ref|XP_004287126.1|  PREDICTED: eukaryotic translation initiation...    303   4e-102   Fragaria vesca subsp. vesca
ref|XP_011070968.1|  PREDICTED: eukaryotic translation initiation...    303   5e-102   Sesamum indicum [beniseed]
ref|XP_009795916.1|  PREDICTED: eukaryotic translation initiation...    303   5e-102   Nicotiana sylvestris
ref|XP_008394324.1|  PREDICTED: eukaryotic translation initiation...    303   5e-102   Malus domestica [apple tree]
ref|XP_004508713.1|  PREDICTED: eukaryotic translation initiation...    303   6e-102   Cicer arietinum [garbanzo]
ref|XP_006344253.1|  PREDICTED: eukaryotic translation initiation...    302   8e-102   Solanum tuberosum [potatoes]
gb|KHG18622.1|  Eukaryotic translation initiation factor 5A-2           302   8e-102   Gossypium arboreum [tree cotton]
gb|ACJ76772.1|  eukaryotic translation initiation factor 5A1            302   8e-102   Glycine max [soybeans]
ref|XP_003634303.1|  PREDICTED: eukaryotic translation initiation...    302   8e-102   Vitis vinifera
ref|XP_010923568.1|  PREDICTED: eukaryotic translation initiation...    302   9e-102   
ref|XP_007011943.1|  Eukaryotic translation initiation factor 5A-1      302   1e-101   Theobroma cacao [chocolate]
gb|ACU13235.1|  unknown                                                 302   1e-101   Glycine max [soybeans]
gb|AEF15863.1|  eukaryotic translation initiation factor 5A3            302   1e-101   Populus tomentosa [Chinese white poplar]
gb|ADG27839.1|  eukaryotic translation initiation factor 5A             301   1e-101   Gossypium hirsutum [American cotton]
gb|AEF15868.1|  eukaryotic translation initiation factor 5A3            301   1e-101   Populus tremula x Populus alba [gray poplar]
ref|XP_002325136.1|  eukaryotic translation initiation factor 5A ...    302   1e-101   Populus trichocarpa [western balsam poplar]
gb|KDP31295.1|  hypothetical protein JCGZ_11671                         301   1e-101   Jatropha curcas
ref|XP_004237050.1|  PREDICTED: eukaryotic translation initiation...    301   1e-101   Solanum lycopersicum
gb|EPS70783.1|  hypothetical protein M569_03977                         301   1e-101   Genlisea aurea
ref|XP_007157699.1|  hypothetical protein PHAVU_002G090900g             301   2e-101   Phaseolus vulgaris [French bean]
ref|NP_001066843.1|  Os12g0507200                                       301   2e-101   
ref|XP_002312268.1|  eukaryotic translation initiation factor 5A ...    301   2e-101   
gb|KJB08360.1|  hypothetical protein B456_001G078800                    301   2e-101   Gossypium raimondii
gb|AAQ08193.1|  eukaryotic translation initiation factor 5A isofo...    301   2e-101   Hevea brasiliensis [jebe]
ref|XP_010047111.1|  PREDICTED: eukaryotic translation initiation...    301   2e-101   Eucalyptus grandis [rose gum]
gb|KHG00291.1|  Eukaryotic translation initiation factor 5A             301   2e-101   Gossypium arboreum [tree cotton]
ref|XP_010101033.1|  Eukaryotic translation initiation factor 5A-4      301   2e-101   Morus notabilis
ref|XP_008443857.1|  PREDICTED: eukaryotic translation initiation...    301   2e-101   Cucumis melo [Oriental melon]
ref|XP_006664051.1|  PREDICTED: eukaryotic translation initiation...    301   2e-101   Oryza brachyantha
ref|XP_009628511.1|  PREDICTED: eukaryotic translation initiation...    301   2e-101   Nicotiana tomentosiformis
ref|NP_001234507.1|  eukaryotic translation initiation factor 5A-3      301   2e-101   Solanum lycopersicum
gb|AEF15861.1|  eukaryotic translation initiation factor 5A1            301   2e-101   Populus tomentosa [Chinese white poplar]
ref|XP_008339846.1|  PREDICTED: eukaryotic translation initiation...    301   2e-101   
gb|AFR23349.1|  eukaryotic translation initiation factor 5A             301   2e-101   Arachis hypogaea [goober]
sp|Q9AXJ4.2|IF5A_MANES  RecName: Full=Eukaryotic translation init...    301   2e-101   Manihot esculenta [manioc]
ref|XP_006650623.1|  PREDICTED: eukaryotic translation initiation...    301   3e-101   Oryza brachyantha
gb|KHG23013.1|  Eukaryotic translation initiation factor 5A             301   3e-101   Gossypium arboreum [tree cotton]
ref|NP_001274959.1|  eukaryotic translation initiation factor 5A-5      301   3e-101   Solanum tuberosum [potatoes]
ref|XP_009421077.1|  PREDICTED: eukaryotic translation initiation...    301   3e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010265598.1|  PREDICTED: eukaryotic translation initiation...    300   4e-101   Nelumbo nucifera [Indian lotus]
ref|XP_010532657.1|  PREDICTED: eukaryotic translation initiation...    300   4e-101   Tarenaya hassleriana [spider flower]
gb|AFC01198.1|  eukaryotic translation initiation factor                300   4e-101   Ammopiptanthus mongolicus
sp|P26564.1|IF5A1_MEDSA  RecName: Full=Eukaryotic translation ini...    300   4e-101   Medicago sativa [alfalfa]
ref|XP_008452854.1|  PREDICTED: eukaryotic translation initiation...    300   5e-101   Cucumis melo [Oriental melon]
ref|XP_009383000.1|  PREDICTED: eukaryotic translation initiation...    300   5e-101   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAQ08198.1|  eukaryotic translation initiation factor 5A isofo...    300   5e-101   Hevea brasiliensis [jebe]
gb|AGU01536.1|  eukaryotic translation initiation factor 5A             300   6e-101   Picrorhiza kurrooa
ref|NP_001234499.1|  eukaryotic translation initiation factor 5A-1      300   6e-101   Solanum lycopersicum
gb|AAQ08196.1|  eukaryotic translation initiation factor 5A isofo...    300   7e-101   Hevea brasiliensis [jebe]
ref|NP_001051336.1|  Os03g0758800                                       300   7e-101   
gb|AEF15866.1|  eukaryotic translation initiation factor 5A1            300   7e-101   Populus tremula x Populus alba [gray poplar]
ref|XP_011079412.1|  PREDICTED: eukaryotic translation initiation...    300   8e-101   Sesamum indicum [beniseed]
gb|ABK93539.1|  unknown                                                 300   8e-101   Populus trichocarpa [western balsam poplar]
gb|ACM79935.1|  eIF5A1                                                  300   8e-101   Populus deltoides
gb|AFK47838.1|  unknown                                                 300   8e-101   Medicago truncatula
ref|NP_001238467.1|  uncharacterized LOC100306157                       300   8e-101   
ref|XP_004146682.1|  PREDICTED: eukaryotic translation initiation...    300   8e-101   Cucumis sativus [cucumbers]
ref|XP_006440666.1|  hypothetical protein CICLE_v10022624mg             299   1e-100   Citrus clementina [clementine]
ref|XP_011463671.1|  PREDICTED: mitotic checkpoint protein BUB3.3...    311   1e-100   Fragaria vesca subsp. vesca
ref|NP_001237458.1|  eukaryotic translation initiation factor 5A3       299   1e-100   Glycine max [soybeans]
gb|ACM79937.1|  eIF5A3                                                  299   2e-100   Populus deltoides
ref|XP_010906864.1|  PREDICTED: eukaryotic translation initiation...    299   2e-100   Elaeis guineensis
gb|EEC82388.1|  hypothetical protein OsI_26733                          299   2e-100   Oryza sativa Indica Group [Indian rice]
sp|P56336.1|IF5A4_SOLTU  RecName: Full=Eukaryotic translation ini...    299   2e-100   Solanum tuberosum [potatoes]
ref|XP_009380102.1|  PREDICTED: eukaryotic translation initiation...    299   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK46389.1|  unknown                                                 299   2e-100   Lotus japonicus
gb|AAK12100.1|AF323604_1  initiation factor eIF5-A                      299   2e-100   Manihot esculenta [manioc]
gb|AFP44116.1|  eukaryotic translation initiation factor                298   2e-100   Lycoris longituba
ref|XP_006453626.1|  hypothetical protein CICLE_v10009759mg             298   2e-100   Citrus clementina [clementine]
ref|XP_004145502.1|  PREDICTED: eukaryotic translation initiation...    298   2e-100   Cucumis sativus [cucumbers]
gb|AGV54677.1|  eukaryotic translation initiation factor 5A             298   2e-100   Phaseolus vulgaris [French bean]
gb|AFD22854.1|  eukaryotic translation initiation factor 5A4            298   3e-100   Tamarix androssowii
gb|AAQ08197.1|  eukaryotic translation initiation factor 5A isofo...    298   3e-100   Hevea brasiliensis [jebe]
ref|XP_003613947.1|  Eukaryotic translation initiation factor 5A        298   3e-100   
ref|XP_007155275.1|  hypothetical protein PHAVU_003G187500g             298   3e-100   Phaseolus vulgaris [French bean]
ref|XP_011083979.1|  PREDICTED: eukaryotic translation initiation...    298   3e-100   Sesamum indicum [beniseed]
ref|XP_008785934.1|  PREDICTED: eukaryotic translation initiation...    298   3e-100   Phoenix dactylifera
ref|XP_007138153.1|  hypothetical protein PHAVU_009G184600g             298   3e-100   Phaseolus vulgaris [French bean]
gb|AAT01416.1|  translation initiation factor 5A                        298   3e-100   Tamarix androssowii
gb|AFD22852.1|  eukaryotic translation initiation factor 5A2            298   4e-100   Tamarix androssowii
ref|NP_001234503.1|  eukaryotic translation initiation factor 5A-2      298   4e-100   Solanum lycopersicum
ref|XP_011101969.1|  PREDICTED: eukaryotic translation initiation...    298   4e-100   Sesamum indicum [beniseed]
ref|NP_001275460.1|  eukaryotic translation initiation factor 5A-4      298   4e-100   Solanum tuberosum [potatoes]
ref|XP_006857226.1|  hypothetical protein AMTR_s00065p00207570          298   4e-100   Amborella trichopoda
gb|KHG20338.1|  Eukaryotic translation initiation factor 5A-2           298   4e-100   Gossypium arboreum [tree cotton]
sp|P56335.1|IF5A3_SOLTU  RecName: Full=Eukaryotic translation ini...    298   5e-100   Solanum tuberosum [potatoes]
emb|CAL69910.1|  eIF-5A precursor protein                               298   5e-100   Phalaenopsis hybrid cultivar
ref|XP_010275806.1|  PREDICTED: eukaryotic translation initiation...    298   5e-100   Nelumbo nucifera [Indian lotus]
emb|CAB96075.1|  translation initiation factor, eIF-5A                  298   6e-100   Oryza sativa [red rice]
ref|XP_002315023.1|  hypothetical protein POPTR_0010s17020g             297   6e-100   Populus trichocarpa [western balsam poplar]
ref|XP_010108736.1|  Eukaryotic translation initiation factor 5A-4      299   6e-100   
ref|XP_008776061.1|  PREDICTED: eukaryotic translation initiation...    297   7e-100   Phoenix dactylifera
ref|XP_006657914.1|  PREDICTED: eukaryotic translation initiation...    297   7e-100   Oryza brachyantha
ref|XP_010552563.1|  PREDICTED: eukaryotic translation initiation...    297   7e-100   Tarenaya hassleriana [spider flower]
gb|KJB38697.1|  hypothetical protein B456_006G267400                    297   8e-100   Gossypium raimondii
gb|ABC70326.1|  eukaryotic translation initiation factor eIF5A          297   8e-100   Rosa chinensis [China rose]
ref|XP_008790089.1|  PREDICTED: eukaryotic translation initiation...    297   8e-100   Phoenix dactylifera
ref|XP_009780915.1|  PREDICTED: eukaryotic translation initiation...    297   9e-100   Nicotiana sylvestris
gb|EEE67525.1|  hypothetical protein OsJ_24987                          297   1e-99    Oryza sativa Japonica Group [Japonica rice]
gb|AIC33055.1|  translational initiation factor eIF-5a                  297   1e-99    Panax ginseng [Asiatic ginseng]
gb|AIX10770.1|  eukaryotic translation initiation factor                297   1e-99    Panax notoginseng [san-qi]
ref|XP_010908239.1|  PREDICTED: eukaryotic translation initiation...    297   1e-99    Elaeis guineensis
ref|NP_001060174.1|  Os07g0597000                                       297   1e-99    
gb|KDP41255.1|  hypothetical protein JCGZ_15662                         296   1e-99    Jatropha curcas
ref|XP_010551407.1|  PREDICTED: eukaryotic translation initiation...    296   1e-99    Tarenaya hassleriana [spider flower]
ref|XP_002273265.1|  PREDICTED: eukaryotic translation initiation...    296   2e-99    Vitis vinifera
gb|EYU35322.1|  hypothetical protein MIMGU_mgv1a015345mg                296   2e-99    Erythranthe guttata [common monkey flower]
ref|XP_011033410.1|  PREDICTED: eukaryotic translation initiation...    296   2e-99    Populus euphratica
gb|AFK38403.1|  unknown                                                 296   2e-99    Lotus japonicus
ref|NP_001275165.1|  eukaryotic translation initiation factor 5A-3      296   2e-99    Solanum tuberosum [potatoes]
ref|XP_010527943.1|  PREDICTED: eukaryotic translation initiation...    296   2e-99    Tarenaya hassleriana [spider flower]
ref|XP_011015835.1|  PREDICTED: mitotic checkpoint protein BUB3.3       308   2e-99    Populus euphratica
ref|XP_002529374.1|  initiation factor 5a, putative                     296   3e-99    Ricinus communis
ref|XP_006477598.1|  PREDICTED: eukaryotic translation initiation...    296   3e-99    Citrus sinensis [apfelsine]
gb|KHN42820.1|  Eukaryotic translation initiation factor 5A-2           296   3e-99    Glycine soja [wild soybean]
gb|ACJ84199.1|  unknown                                                 296   3e-99    Medicago truncatula
ref|XP_009617160.1|  PREDICTED: eukaryotic translation initiation...    296   3e-99    Nicotiana tomentosiformis
ref|XP_009617887.1|  PREDICTED: eukaryotic translation initiation...    295   3e-99    Nicotiana tomentosiformis
ref|XP_002514712.1|  initiation factor 5a, putative                     295   4e-99    Ricinus communis
ref|XP_004499516.1|  PREDICTED: eukaryotic translation initiation...    295   4e-99    Cicer arietinum [garbanzo]
ref|XP_010523479.1|  PREDICTED: eukaryotic translation initiation...    295   5e-99    Tarenaya hassleriana [spider flower]
ref|XP_008236039.1|  PREDICTED: eukaryotic translation initiation...    295   5e-99    Prunus mume [ume]
ref|XP_004490179.1|  PREDICTED: mitotic checkpoint protein bub3-like    306   6e-99    
ref|XP_008790673.1|  PREDICTED: eukaryotic translation initiation...    295   6e-99    Phoenix dactylifera
gb|AAR83875.1|  mary storys protein                                     295   6e-99    Capsicum annuum
ref|NP_001235981.1|  uncharacterized protein LOC100305991               295   6e-99    
ref|XP_008446407.1|  PREDICTED: eukaryotic translation initiation...    295   8e-99    Cucumis melo [Oriental melon]
gb|EMS51734.1|  Eukaryotic translation initiation factor 5A-4           297   8e-99    Triticum urartu
ref|XP_010037186.1|  PREDICTED: eukaryotic translation initiation...    295   9e-99    Eucalyptus grandis [rose gum]
ref|XP_002285505.1|  PREDICTED: eukaryotic translation initiation...    294   1e-98    Vitis vinifera
ref|NP_001236395.1|  uncharacterized protein LOC100305510               294   1e-98    Glycine max [soybeans]
ref|XP_006574334.1|  PREDICTED: uncharacterized LOC100306157 isof...    305   2e-98    
ref|XP_009390841.1|  PREDICTED: eukaryotic translation initiation...    294   2e-98    
ref|XP_010936500.1|  PREDICTED: eukaryotic translation initiation...    293   2e-98    Elaeis guineensis
ref|XP_004135157.1|  PREDICTED: eukaryotic translation initiation...    293   2e-98    Cucumis sativus [cucumbers]
ref|XP_010106630.1|  Eukaryotic translation initiation factor 5A-2      293   2e-98    Morus notabilis
sp|Q945F4.1|IF5A2_MEDSA  RecName: Full=Eukaryotic translation ini...    293   3e-98    Medicago sativa [alfalfa]
ref|XP_009795107.1|  PREDICTED: eukaryotic translation initiation...    293   3e-98    Nicotiana sylvestris
gb|EYU28817.1|  hypothetical protein MIMGU_mgv1a015401mg                293   3e-98    Erythranthe guttata [common monkey flower]
ref|XP_004138702.1|  PREDICTED: eukaryotic translation initiation...    293   3e-98    Cucumis sativus [cucumbers]
ref|XP_011075552.1|  PREDICTED: mitotic checkpoint protein BUB3.3...    305   3e-98    
ref|XP_008799658.1|  PREDICTED: eukaryotic translation initiation...    293   3e-98    
ref|XP_010938815.1|  PREDICTED: eukaryotic translation initiation...    293   4e-98    Elaeis guineensis
ref|XP_004507734.1|  PREDICTED: eukaryotic translation initiation...    293   5e-98    Cicer arietinum [garbanzo]
ref|XP_010942095.1|  PREDICTED: eukaryotic translation initiation...    293   5e-98    Elaeis guineensis
ref|NP_001234715.1|  eukaryotic translation initiation factor 5A-4      292   6e-98    Solanum lycopersicum
ref|XP_008787088.1|  PREDICTED: eukaryotic translation initiation...    292   6e-98    Phoenix dactylifera
ref|XP_001773059.1|  predicted protein                                  292   6e-98    
ref|XP_010258729.1|  PREDICTED: eukaryotic translation initiation...    292   7e-98    Nelumbo nucifera [Indian lotus]
ref|XP_008780963.1|  PREDICTED: eukaryotic translation initiation...    292   8e-98    
gb|ABF98987.1|  Eukaryotic translation initiation factor 5A-2, pu...    292   9e-98    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001275082.1|  eukaryotic translation initiation factor 5A-1/2    292   1e-97    Solanum tuberosum [potatoes]
gb|AFK42218.1|  unknown                                                 291   1e-97    Lotus japonicus
ref|XP_010086858.1|  Eukaryotic translation initiation factor 5A        295   1e-97    
ref|XP_010683086.1|  PREDICTED: eukaryotic translation initiation...    291   1e-97    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010030379.1|  PREDICTED: eukaryotic translation initiation...    291   2e-97    Eucalyptus grandis [rose gum]
ref|XP_008445267.1|  PREDICTED: eukaryotic translation initiation...    291   2e-97    Cucumis melo [Oriental melon]
ref|XP_010939062.1|  PREDICTED: eukaryotic translation initiation...    291   2e-97    Elaeis guineensis
gb|ABK22126.1|  unknown                                                 291   3e-97    Picea sitchensis
ref|XP_010554300.1|  PREDICTED: eukaryotic translation initiation...    291   3e-97    Tarenaya hassleriana [spider flower]
gb|ABD66513.1|  eukaryotic translation initiation factor 5A             291   3e-97    Gymnadenia conopsea
ref|XP_009393847.1|  PREDICTED: eukaryotic translation initiation...    290   3e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010683083.1|  PREDICTED: eukaryotic translation initiation...    290   5e-97    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002512132.1|  initiation factor 5a, putative                     302   5e-97    
ref|XP_011027917.1|  PREDICTED: mitotic checkpoint protein BUB3.3...    302   5e-97    Populus euphratica
gb|AFK35808.1|  unknown                                                 290   8e-97    Lotus japonicus
emb|CDP10227.1|  unnamed protein product                                289   1e-96    Coffea canephora [robusta coffee]
ref|XP_004981693.1|  PREDICTED: eukaryotic translation initiation...    289   1e-96    Setaria italica
ref|XP_010236032.1|  PREDICTED: eukaryotic translation initiation...    289   1e-96    Brachypodium distachyon [annual false brome]
gb|KCW64912.1|  hypothetical protein EUGRSUZ_G02468                     289   1e-96    Eucalyptus grandis [rose gum]
gb|ABF98986.1|  Eukaryotic translation initiation factor 5A-2, pu...    289   2e-96    Oryza sativa Japonica Group [Japonica rice]
gb|AGZ03629.1|  eukaryotic translation initiation factor 5A             288   2e-96    Pinus contorta
gb|KDO59447.1|  hypothetical protein CISIN_1g030552mg                   289   3e-96    Citrus sinensis [apfelsine]
gb|AAF27938.1|AF225297_1  translation initiation factor 5A              288   3e-96    Euphorbia esula [wolf's milk]
ref|XP_009404766.1|  PREDICTED: eukaryotic translation initiation...    288   3e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006438769.1|  hypothetical protein CICLE_v10032956mg             287   7e-96    
emb|CAH59406.1|  eukaryotic translation initiation factor 5A-1          287   9e-96    Plantago major [cart-track plant]
gb|AAX92692.1|  eukaryotic translation initiation factor 5A             286   1e-95    Picea abies
ref|NP_001058746.1|  Os07g0112800                                       286   2e-95    
ref|NP_001105606.1|  eukaryotic translation initiation factor 5A        285   6e-95    Zea mays [maize]
gb|EMT02502.1|  Eukaryotic translation initiation factor 5A-4           285   7e-95    
ref|NP_001131634.1|  eukaryotic translation initiation factor 5A-1/2    285   8e-95    Zea mays [maize]
ref|XP_010258422.1|  PREDICTED: mitotic checkpoint protein BUB3.3...    298   9e-95    
ref|XP_006844852.1|  hypothetical protein AMTR_s00058p00098620          283   2e-94    Amborella trichopoda
gb|AAX92691.1|  eukaryotic translation initiation factor 5A 2           283   2e-94    Picea abies
ref|XP_010683085.1|  PREDICTED: eukaryotic translation initiation...    283   2e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004958204.1|  PREDICTED: eukaryotic translation initiation...    283   5e-94    Setaria italica
gb|AAS20967.1|  eukaryotic translation initiation factor 5A-4           282   5e-94    Hyacinthus orientalis [common hyacinth]
gb|EEE59965.1|  hypothetical protein OsJ_12660                          293   6e-94    Oryza sativa Japonica Group [Japonica rice]
gb|AHX42566.1|  translation initiation factor5A                         281   2e-93    Saccharum hybrid cultivar ROC22
gb|EEC76213.1|  hypothetical protein OsI_13610                          293   2e-93    Oryza sativa Indica Group [Indian rice]
ref|XP_006391021.1|  hypothetical protein EUTSA_v10019263mg             280   3e-93    Eutrema salsugineum [saltwater cress]
ref|XP_004955320.1|  PREDICTED: eukaryotic translation initiation...    280   5e-93    Setaria italica
ref|XP_002887234.1|  hypothetical protein ARALYDRAFT_894722             279   9e-93    Arabidopsis lyrata subsp. lyrata
ref|XP_003557675.1|  PREDICTED: eukaryotic translation initiation...    279   9e-93    Brachypodium distachyon [annual false brome]
ref|NP_172848.1|  translation initiation factor eIF-5A                  279   9e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003610324.1|  Eukaryotic translation initiation factor 5A-1      296   1e-92    
ref|XP_010068784.1|  PREDICTED: mitotic checkpoint protein BUB3.3...    293   1e-92    
ref|NP_177100.1|  eukaryotic translation initiation factor 5A-3         279   1e-92    Arabidopsis thaliana [mouse-ear cress]
emb|CDY71729.1|  BnaCnng74170D                                          279   1e-92    Brassica napus [oilseed rape]
emb|CDY40919.1|  BnaC06g30570D                                          279   1e-92    Brassica napus [oilseed rape]
ref|XP_002890031.1|  eukaryotic translation initiation factor 5A-1      278   2e-92    
ref|XP_009105486.1|  PREDICTED: eukaryotic translation initiation...    278   2e-92    Brassica rapa
ref|XP_006302945.1|  hypothetical protein CARUB_v10021084mg             278   2e-92    Capsella rubella
sp|Q9AXQ7.1|IF5A_DIACA  RecName: Full=Eukaryotic translation init...    278   3e-92    Dianthus caryophyllus [carnation]
ref|XP_006417074.1|  hypothetical protein EUTSA_v10008978mg             278   4e-92    Eutrema salsugineum [saltwater cress]
gb|AAK50073.1|AF372933_1  At1g69410/F10D13.8                            277   6e-92    Arabidopsis thaliana [mouse-ear cress]
emb|CAA45103.1|  eukaryotic initiation factor 5A (1)                    276   6e-92    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAX92694.1|  eukaryotic translation initiation factor 5A 2           277   7e-92    Picea abies
ref|XP_002964180.1|  hypothetical protein SELMODRAFT_142541             276   9e-92    Selaginella moellendorffii
gb|AAX92690.1|  eukaryotic translation initiation factor 5A             276   1e-91    Picea abies
ref|XP_002988883.1|  hypothetical protein SELMODRAFT_184164             276   1e-91    Selaginella moellendorffii
gb|AAZ95171.1|  eukaryotic translation initiation factor 5A1            275   6e-91    Triticum aestivum [Canadian hard winter wheat]
gb|EMT06932.1|  Eukaryotic translation initiation factor 5A             277   8e-91    
ref|XP_006415941.1|  hypothetical protein EUTSA_v10008974mg             274   1e-90    Eutrema salsugineum [saltwater cress]
gb|EMS47402.1|  Eukaryotic translation initiation factor 5A-2           274   1e-90    Triticum urartu
emb|CDY24141.1|  BnaC03g57360D                                          274   1e-90    Brassica napus [oilseed rape]
gb|ABB29987.1|  translation initiation factor 5A                        274   1e-90    Secale sylvestre
ref|XP_009110029.1|  PREDICTED: eukaryotic translation initiation...    273   2e-90    Brassica rapa
ref|XP_002893391.1|  hypothetical protein ARALYDRAFT_472745             272   5e-90    
ref|XP_004962923.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    272   7e-90    
gb|AAZ95173.1|  eukaryotic translation initiation factor 5A3            272   8e-90    Triticum aestivum [Canadian hard winter wheat]
gb|AAZ95172.1|  eukaryotic translation initiation factor 5A2            272   8e-90    Triticum aestivum [Canadian hard winter wheat]
gb|EMT30955.1|  Eukaryotic translation initiation factor 5A-1           274   9e-90    
gb|KFK44576.1|  hypothetical protein AALP_AA1G276400                    271   9e-90    Arabis alpina [alpine rockcress]
gb|AAR91929.1|  eukaryotic translation initiation factor-5A             271   9e-90    Brassica napus [oilseed rape]
emb|CDY16172.1|  BnaA09g29060D                                          271   1e-89    Brassica napus [oilseed rape]
gb|AAX92693.1|  eukaryotic translation initiation factor 5A 4           270   3e-89    Picea abies
ref|XP_009103102.1|  PREDICTED: eukaryotic translation initiation...    269   1e-88    Brassica rapa
gb|ABW78939.1|  translation initiation factor 5A                        269   1e-88    Dendrocalamus sinicus
gb|ABB29985.1|  translation initiation factor 5A                        268   1e-88    Thinopyrum intermedium
ref|XP_008449958.1|  PREDICTED: eukaryotic translation initiation...    268   2e-88    
ref|XP_010499017.1|  PREDICTED: eukaryotic translation initiation...    267   5e-88    Camelina sativa [gold-of-pleasure]
ref|XP_009115386.1|  PREDICTED: eukaryotic translation initiation...    267   6e-88    Brassica rapa
emb|CDY20566.1|  BnaC07g12330D                                          277   8e-88    Brassica napus [oilseed rape]
ref|NP_173985.1|  eukaryotic translation initiation factor 5A-2         266   9e-88    Arabidopsis thaliana [mouse-ear cress]
gb|AAF87023.1|AC006535_1  T24P13.1                                      266   6e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AAQ08195.1|  eukaryotic translation initiation factor 5A isofo...    261   4e-86    Hevea brasiliensis [jebe]
gb|AAF79401.1|AC068197_11  F16A14.17                                    263   9e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304722.1|  hypothetical protein CARUB_v10012030mg             260   2e-85    Capsella rubella
ref|XP_006289980.1|  hypothetical protein CARUB_v10003610mg             259   7e-85    Capsella rubella
emb|CDY40258.1|  BnaA07g09420D                                          269   3e-84    Brassica napus [oilseed rape]
ref|XP_007037449.1|  Eukaryotic translation initiation factor 5A-...    257   1e-83    
pdb|3HKS|A  Chain A, Crystal Structure Of Eukaryotic Translation ...    256   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923569.1|  PREDICTED: eukaryotic translation initiation...    254   6e-83    
ref|XP_003613949.1|  Eukaryotic translation initiation factor 5A        253   1e-82    
ref|XP_003613948.1|  Eukaryotic translation initiation factor 5A        253   2e-82    Medicago truncatula
gb|KJB53264.1|  hypothetical protein B456_008G195800                    251   3e-82    Gossypium raimondii
ref|XP_006440667.1|  hypothetical protein CICLE_v10022624mg             251   4e-82    
gb|KJB29804.1|  hypothetical protein B456_005G143800                    251   6e-82    Gossypium raimondii
ref|XP_011018032.1|  PREDICTED: eukaryotic translation initiation...    251   9e-82    Populus euphratica
ref|XP_010923567.1|  PREDICTED: eukaryotic translation initiation...    251   2e-81    
gb|KJB38699.1|  hypothetical protein B456_006G267400                    248   6e-81    
gb|KJB38698.1|  hypothetical protein B456_006G267400                    248   7e-81    
gb|KJB08363.1|  hypothetical protein B456_001G078800                    247   2e-80    
gb|KDO83051.1|  hypothetical protein CISIN_1g031432mg                   247   2e-80    
gb|EYU22389.1|  hypothetical protein MIMGU_mgv1a0153782mg               247   2e-80    
ref|XP_007155276.1|  hypothetical protein PHAVU_003G187500g             246   5e-80    
ref|XP_008785935.1|  PREDICTED: eukaryotic translation initiation...    246   7e-80    
gb|KCW64913.1|  hypothetical protein EUGRSUZ_G02468                     245   9e-80    
ref|XP_008790091.1|  PREDICTED: eukaryotic translation initiation...    244   2e-79    
gb|KCW64914.1|  hypothetical protein EUGRSUZ_G02468                     243   6e-79    
gb|KEH32625.1|  eukaryotic translation initiation factor 5A             243   1e-78    
ref|XP_008651866.1|  PREDICTED: eukaryotic translation initiation...    234   2e-75    
gb|ACF23039.1|  ST6-32                                                  234   3e-75    
ref|XP_011395973.1|  Eukaryotic translation initiation factor 5A-1/2    227   5e-72    
ref|XP_005849925.1|  hypothetical protein CHLNCDRAFT_56087              225   2e-71    
ref|NP_001077597.1|  eukaryotic translation initiation factor 5A-2      223   4e-71    
ref|XP_008384370.1|  PREDICTED: eukaryotic translation initiation...    221   3e-70    
ref|XP_008780964.1|  PREDICTED: eukaryotic translation initiation...    219   3e-69    
gb|KEH31975.1|  eukaryotic translation initiation factor 5A4            216   2e-68    
gb|KCW83674.1|  hypothetical protein EUGRSUZ_B00553                     215   4e-68    
ref|XP_006601417.1|  PREDICTED: eukaryotic translation initiation...    214   2e-66    
gb|KJB53262.1|  hypothetical protein B456_008G195800                    210   2e-66    
gb|KDD73936.1|  hypothetical protein H632_c1715p0                       214   4e-66    
gb|ABB90163.1|  translation initiation factor                           210   4e-66    
gb|KJB17391.1|  hypothetical protein B456_003G098700                    209   1e-65    
gb|KJB17392.1|  hypothetical protein B456_003G098700                    208   1e-65    
gb|ABB90158.1|  translation initiation factor                           207   3e-65    
gb|ABB90159.1|  translation initiation factor                           207   3e-65    
gb|ABF98988.1|  Eukaryotic translation initiation factor 5A-2, pu...    207   4e-65    
gb|ACN27100.1|  unknown                                                 207   4e-65    
gb|KJB08361.1|  hypothetical protein B456_001G078800                    206   7e-65    
gb|ABB90162.1|  translation initiation factor                           206   1e-64    
gb|ABB90161.1|  translation initiation factor                           206   2e-64    
gb|ABB90157.1|  translation initiation factor                           206   2e-64    
gb|KHN17487.1|  Putative LRR receptor-like serine/threonine-prote...    223   2e-64    
gb|KCW78909.1|  hypothetical protein EUGRSUZ_C00350                     205   3e-64    
gb|KCW83675.1|  hypothetical protein EUGRSUZ_B00553                     204   8e-64    
ref|XP_002374390.1|  Eukaryotic translation initiation factor eIF-5A    204   2e-63    
ref|XP_005645371.1|  eukaryotic initiation factor                       204   3e-63    
dbj|GAN04309.1|  eukaryotic translation initiation factor 5A            203   6e-63    
ref|XP_002420941.1|  eukaryotic translation initiation factor 5a ...    202   1e-62    
gb|KDO83053.1|  hypothetical protein CISIN_1g031432mg                   201   1e-62    
ref|XP_004199064.1|  Piso0_002469                                       202   1e-62    
ref|XP_004199916.1|  Piso0_002469                                       201   3e-62    
ref|XP_011271556.1|  Eukaryotic translation initiation factor 5A        201   6e-62    
gb|KDO83052.1|  hypothetical protein CISIN_1g031432mg                   198   1e-61    
gb|KIM26567.1|  hypothetical protein M408DRAFT_181590                   200   1e-61    
gb|EIE88376.1|  eukaryotic translation initiation factor 5A             199   2e-61    
gb|EPB89363.1|  eukaryotic translation initiation factor 5A             199   2e-61    
gb|EMG50343.1|  Eukaryotic translation initiation factor 5A             199   3e-61    
ref|XP_002552376.1|  KLTH0C03476p                                       198   4e-61    
emb|CEI88663.1|  Putative Eukaryotic translation initiation facto...    198   5e-61    
ref|XP_007377354.1|  eukaryotic translation initiation factor 5A        198   6e-61    
emb|CEP63105.1|  LALA0S07e02498g1_1                                     198   6e-61    
ref|XP_001384727.1|  Eukaryotic translation initiation factor 5A ...    198   6e-61    
gb|KIY47655.1|  eukaryotic translation initiation factor 5A-2           197   1e-60    
ref|XP_001834214.1|  eukaryotic translation initiation factor 5A-2      197   1e-60    
ref|XP_007398936.1|  hypothetical protein PHACADRAFT_261118             197   1e-60    
emb|CCM03225.1|  predicted protein                                      198   1e-60    
emb|CEG68709.1|  Putative Eukaryotic translation initiation facto...    197   2e-60    
emb|CEI99977.1|  Putative Eukaryotic translation initiation facto...    197   2e-60    
gb|KIJ60453.1|  hypothetical protein HYDPIDRAFT_160876                  197   2e-60    
emb|CCE39834.1|  hypothetical protein CPAR2_602530                      197   2e-60    
ref|XP_007387090.1|  eukaryotic translation initiation factor 5A-2      196   2e-60    
ref|XP_002950537.1|  eukaryotic translation initiation factor 5A        197   3e-60    
ref|XP_007337625.1|  eukaryotic translation initiation factor 5A-2      196   3e-60    
ref|XP_460907.2|  DEHA2F12540p                                          196   4e-60    
ref|XP_007005561.1|  hypothetical protein TREMEDRAFT_71870              196   4e-60    
ref|XP_003870703.1|  Anb1 translation initiation factor eIF-5A          196   5e-60    
ref|XP_008710970.1|  eukaryotic translation initiation factor 5A        196   6e-60    
ref|XP_006693435.1|  eukaryotic translation initiation factor 5A-...    196   6e-60    
ref|XP_004365882.1|  translation initiation factor eIF-5A               195   8e-60    
gb|KDQ54476.1|  hypothetical protein JAAARDRAFT_38147                   195   8e-60    
gb|EIE85318.1|  eukaryotic translation initiation factor 5A             195   8e-60    
gb|EPX71022.1|  translation elongation factor eIF5A                     195   9e-60    
gb|EHN01650.1|  Anb1p                                                   195   1e-59    
gb|KGQ84148.1|  eukaryotic translation initiation factor 5A             195   1e-59    
ref|XP_007772864.1|  initiation factor 5a                               195   1e-59    
ref|NP_010880.3|  translation elongation factor eIF-5A                  195   1e-59    
dbj|GAA22792.1|  K7_Hyp2p                                               194   1e-59    
pdb|3ER0|A  Chain A, Crystal Structure Of The Full Length Eif5a F...    195   1e-59    
ref|XP_003056444.1|  eukaryotic translation initiation factor 5A        195   2e-59    
gb|KIY96709.1|  Eukaryotic translation initiation factor 5A-1           194   2e-59    
ref|XP_001245555.1|  eukaryotic translation initiation factor 5A-2      194   2e-59    
gb|KIP09440.1|  hypothetical protein PHLGIDRAFT_18633                   194   2e-59    
ref|XP_007865544.1|  translation initiation factor eIF-5A               194   2e-59    
ref|XP_007853008.1|  eukaryotic translation initiation factor 5a        194   2e-59    
ref|XP_001699840.1|  eukaryotic initiation factor                       194   3e-59    
gb|EUD71171.1|  eukaryotic translation initiation factor 5A-2           194   4e-59    
ref|NP_012581.3|  translation elongation factor eIF-5A                  193   4e-59    
ref|XP_001265255.1|  Eukaryotic translation initiation factor eIF-5A    193   5e-59    
emb|CDS03499.1|  Putative Eukaryotic translation initiationFT fac...    193   5e-59    
gb|ACZ06791.1|  eukaryotic translation initiation factor 5A             193   5e-59    
ref|XP_002260547.1|  eukaryotictranslation initiation factor 5a         193   5e-59    
ref|XP_001350451.1|  eukaryotic initiation factor 5a, putative          193   6e-59    
emb|CDO65325.1|  eukaryotic translation initiation factor 5A            193   6e-59    
ref|XP_676806.1|  eukaryotic initiation factor 5a                       193   7e-59    
ref|XP_003028068.1|  hypothetical protein SCHCODRAFT_78975              193   7e-59    
ref|XP_008625401.1|  eukaryotic translation initiation factor 5A-2      193   7e-59    
ref|XP_011127112.1|  hypothetical protein AOL_s00210g8                  193   8e-59    
gb|KIM58189.1|  hypothetical protein SCLCIDRAFT_1218825                 192   9e-59    
ref|XP_009548413.1|  hypothetical protein HETIRDRAFT_445562             192   1e-58    
ref|XP_004224203.1|  eukaryotic translation initiation factor 5A        192   1e-58    
ref|XP_447317.1|  hypothetical protein                                  192   1e-58    
ref|XP_011104130.1|  anb1p                                              192   1e-58    
ref|XP_003645861.1|  hypothetical protein Ecym_3574                     192   1e-58    
emb|CDF90960.1|  ZYBA0S09-01662g1_1                                     192   1e-58    
gb|EHN02851.1|  Hyp2p                                                   192   1e-58    
gb|EYE94434.1|  eukaryotic translation initiation factor eIF-5A         192   1e-58    
emb|CCK71822.1|  hypothetical protein KNAG_0I00310                      192   1e-58    
ref|XP_002473322.1|  eukaryotic translation initiation factor 5A        192   1e-58    
gb|EJT43422.1|  HYP2-like protein                                       192   2e-58    
gb|AGO11122.1|  AaceriAFR356Cp                                          192   2e-58    
ref|XP_001616518.1|  eukaryotic translation initiation factor 5A        192   2e-58    
ref|XP_002173401.1|  translation elongation factor eIF5A                191   2e-58    
ref|XP_002497420.1|  ZYRO0F05148p                                       191   3e-58    
ref|NP_985903.1|  AFR356Cp                                              191   3e-58    
gb|EPX73779.1|  translation elongation factor eIF5A                     191   4e-58    
emb|CDH48576.1|  eukaryotic translation initiation factor 5a            191   5e-58    
ref|XP_002561164.1|  Pc16g08430                                         191   5e-58    
emb|CDI55414.1|  probable HYP2-translation initiation factor eIF5A.1    192   6e-58    
emb|CDI80615.1|  translation initiation factor eIF-5A, putative         191   7e-58    
sp|O94083.1|IF5A_CANAL  RecName: Full=Eukaryotic translation init...    190   7e-58    
ref|XP_501535.2|  YALI0C06886p                                          190   7e-58    
gb|ACZ59462.1|  initiation factor 5a                                    190   8e-58    
gb|EPY51429.1|  translation elongation factor eIF5A                     190   1e-57    
ref|XP_007367042.1|  eukaryotic translation initiation factor 5A        190   1e-57    
emb|CCJ30298.1|  unnamed protein product                                190   1e-57    
ref|XP_002507472.1|  eukaryotic translation initiation factor 5A        190   1e-57    
ref|XP_007310721.1|  eukaryotic translation initiation factor 5A-2      189   1e-57    
emb|CCK71109.1|  hypothetical protein KNAG_0G00520                      189   1e-57    
gb|KGO74823.1|  Nucleic acid-binding, OB-fold                           189   1e-57    
ref|XP_008040087.1|  eukaryotic translation initiation factor 5A        189   1e-57    
gb|EPY53783.1|  translation elongation factor eIF5A                     189   2e-57    
gb|EMD35100.1|  hypothetical protein CERSUDRAFT_116588                  189   2e-57    
ref|XP_001269749.1|  Eukaryotic translation initiation factor eIF-5A    189   2e-57    
gb|KDQ24106.1|  hypothetical protein PLEOSDRAFT_1072569                 189   2e-57    
emb|CDJ47139.1|  translation initiation factor eIF-5A, putative         189   2e-57    
ref|XP_002493289.1|  Translation initiation factor eIF-5A, promot...    189   3e-57    
ref|XP_011103128.1|  hyp2p                                              188   4e-57    
gb|KIY69258.1|  initiation factor 5a                                    189   4e-57    
gb|ESX00195.1|  Eukaryotic translation initiation factor 5A-2           188   4e-57    
emb|CDR38433.1|  CYFA0S02e01640g1_1                                     188   4e-57    
gb|KDN36394.1|  initiation factor 5a                                    188   5e-57    
ref|XP_001879756.1|  predicted protein                                  188   5e-57    
ref|XP_002614266.1|  eukaryotic translation initiation factor 5A        189   5e-57    
ref|XP_454956.1|  hypothetical protein                                  188   5e-57    
gb|KII90278.1|  hypothetical protein PLICRDRAFT_175041                  188   6e-57    
gb|EST05957.1|  eukaryotic translation initiation factor                188   6e-57    
ref|XP_003660671.1|  hypothetical protein MYCTH_59591                   188   6e-57    
emb|CCA66447.1|  probable HYP2-translation initiation factor eIF5A.1    188   6e-57    
ref|XP_002150293.1|  Eukaryotic translation initiation factor eIF-5A    188   6e-57    
ref|XP_002483966.1|  Eukaryotic translation initiation factor eIF-5A    188   7e-57    
dbj|BAO38330.1|  eukaryotic translation initiation factor 5A-2          188   7e-57    
dbj|GAM38182.1|  eukaryotic translation initiation factor               188   7e-57    
emb|CCF48032.1|  probable HYP2-translation initiation factor eIF5A.1    188   7e-57    
ref|XP_001820054.1|  eukaryotic translation initiation factor 5A        188   7e-57    
gb|KIW08756.1|  eukaryotic translation initiation factor 5A             187   8e-57    
ref|XP_003680361.1|  hypothetical protein TDEL_0C02610                  187   8e-57    
ref|XP_008893022.1|  translation elongation factor IF5A                 187   8e-57    
emb|CDJ38681.1|  translation initiation factor eIF-5A, putative         187   8e-57    
ref|XP_003674237.1|  hypothetical protein NCAS_0A12990                  187   9e-57    
gb|EJT48840.1|  initiation factor 5a                                    187   9e-57    
ref|XP_011388734.1|  putative translation elongation factor eIF-5A      187   1e-56    
ref|XP_003957343.1|  hypothetical protein KAFR_0E00540                  187   1e-56    
ref|XP_003677647.1|  hypothetical protein NCAS_0G04090                  187   1e-56    
gb|KIM77397.1|  hypothetical protein PILCRDRAFT_825360                  187   1e-56    
gb|EKG14107.1|  Translation elongation factor IF5A                      187   1e-56    
ref|NP_998350.1|  eukaryotic translation initiation factor 5A-1         187   2e-56    
ref|XP_750156.1|  Eukaryotic translation initiation factor eIF-5A       188   2e-56    
ref|XP_002367420.1|  translation initiation factor eIF-5A, putative     187   2e-56    
ref|XP_003671054.2|  hypothetical protein NDAI_0G00350                  186   2e-56    
ref|XP_001983653.1|  GH15450                                            187   2e-56    
emb|CEF96685.1|  Translation elongation factor, IF5A C-terminal         187   2e-56    
dbj|GAC98575.1|  eukaryotic translation initiation factor               187   2e-56    
dbj|GAM18292.1|  hypothetical protein SAMD00019534_014670               186   3e-56    
emb|CBN76779.1|  conserved unknown protein                              187   3e-56    
gb|EKV11187.1|  Eukaryotic translation initiation factor eIF-5A         186   3e-56    
gb|KIK09535.1|  hypothetical protein K443DRAFT_671436                   186   3e-56    
ref|XP_001388724.1|  eukaryotic translation initiation factor 5A        186   3e-56    
ref|XP_001212985.1|  eukaryotic translation initiation factor 5A        186   3e-56    
gb|KIL60699.1|  hypothetical protein M378DRAFT_187727                   186   3e-56    
ref|XP_003686245.1|  hypothetical protein TPHA_0F03300                  186   4e-56    
gb|KIN96254.1|  hypothetical protein M404DRAFT_248776                   186   4e-56    
gb|KIJ47369.1|  hypothetical protein M422DRAFT_28977                    186   4e-56    
gb|KIK90583.1|  hypothetical protein PAXRUDRAFT_35259                   186   4e-56    
emb|CDJ64534.1|  translation initiation factor eIF-5A, putative         186   4e-56    
gb|KEQ70596.1|  eukaryotic translation initiation factor 5A-2           186   4e-56    
ref|NP_594457.1|  translation elongation factor eIF5A (predicted)       186   5e-56    
ref|XP_003737205.1|  PREDICTED: eukaryotic translation initiation...    186   5e-56    
ref|XP_003959190.1|  hypothetical protein KAFR_0I02760                  186   5e-56    
ref|XP_001644190.1|  hypothetical protein Kpol_1059p22                  186   5e-56    
gb|KGO44740.1|  Nucleic acid-binding, OB-fold                           186   5e-56    
gb|KDR74197.1|  hypothetical protein GALMADRAFT_212325                  186   5e-56    
ref|XP_006680276.1|  hypothetical protein BATDEDRAFT_17234              185   6e-56    
emb|CBQ71195.1|  probable HYP2-translation initiation factor eIF5A.1    186   6e-56    
ref|XP_008865153.1|  translation elongation factor IF5A                 186   6e-56    
dbj|GAD92748.1|  eukaryotic translation initiation factor 5A-2          186   6e-56    
dbj|GAA88755.1|  eukaryotic translation initiation factor eIF-5A        185   6e-56    
emb|CCQ18657.1|  Translation initiation factor 5A                       187   7e-56    
gb|KGK36776.1|  hypothetical protein JL09_g4096                         185   7e-56    
gb|KEQ83442.1|  eukaryotic translation initiation factor 5A-2           185   7e-56    
ref|XP_002847962.1|  eukaryotic translation initiation factor 5A-1      185   7e-56    
ref|XP_002174004.1|  translation elongation factor eIF5A                185   8e-56    
ref|XP_003886287.1|  hypothetical protein NCLIV_066870                  185   8e-56    
ref|XP_007582050.1|  putative eukaryotic translation initiation f...    185   8e-56    
ref|XP_006956218.1|  translation initiation factor eIF-5A               185   8e-56    
ref|XP_006455784.1|  hypothetical protein AGABI2DRAFT_195151            185   9e-56    
gb|KEQ97928.1|  hypothetical protein AUEXF2481DRAFT_37493               185   1e-55    
gb|KIR86103.1|  eukaryotic translation initiation factor 5A             185   1e-55    
ref|NP_596130.2|  translation elongation factor eIF5A (predicted)       185   1e-55    
emb|CDJ58986.1|  translation initiation factor eIF-5A, putative         185   1e-55    
gb|KEQ63268.1|  translation initiation factor eIF-5A                    185   1e-55    
ref|XP_003384319.1|  PREDICTED: eukaryotic translation initiation...    184   1e-55    
gb|KGB80103.1|  initiation factor 5a                                    184   1e-55    
ref|XP_003234306.1|  translation initiation factor 5A                   184   1e-55    
gb|KEZ40981.1|  hypothetical protein SAPIO_CDS7001                      184   1e-55    
ref|XP_002775237.1|  eukaryotic translation initiation factor 5A-...    184   2e-55    
emb|CDM26541.1|  Eukaryotic translation initiation factor 5A            184   2e-55    
gb|KIK29357.1|  hypothetical protein PISMIDRAFT_672825                  184   2e-55    
ref|XP_008620373.1|  translation initiation factor eIF-5A               184   2e-55    



>ref|XP_009619960.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Nicotiana 
tomentosiformis]
 ref|XP_009786891.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Nicotiana 
sylvestris]
 sp|P24922.1|IF5A2_NICPL RecName: Full=Eukaryotic translation initiation factor 5A-2; 
Short=eIF-5A-2; AltName: Full=eIF-4D [Nicotiana plumbaginifolia]
 emb|CAA45104.1| eukaryotic initiation factor 5A (2) [Nicotiana plumbaginifolia]
 gb|AIE54305.1| eukaryotic translation initiation factor 5A-3 [Nicotiana tabacum]
Length=159

 Score =   311 bits (797),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/154 (97%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DNLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_009775987.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Nicotiana 
sylvestris]
Length=159

 Score =   309 bits (792),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/154 (97%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+G+TKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGSTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  ENLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>gb|ACJ85889.1| unknown [Medicago truncatula]
 gb|AFK36612.1| unknown [Medicago truncatula]
 gb|KEH31974.1| eukaryotic translation initiation factor 5A4 [Medicago truncatula]
Length=160

 Score =   307 bits (786),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDL+LPTD
Sbjct  61   VAIDIFTSKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DSLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>gb|AIA09928.1| eukaryotic translation initiation factor 5A [Quercus suber]
Length=159

 Score =   306 bits (784),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIKDGFG+GKDLVVSVMSAMGEEQIC LK
Sbjct  121  DNLLTQIKDGFGDGKDLVVSVMSAMGEEQICGLK  154



>ref|XP_007037448.1| Eukaryotic elongation factor 5A-1 isoform 1 [Theobroma cacao]
 gb|EOY21949.1| Eukaryotic elongation factor 5A-1 isoform 1 [Theobroma cacao]
Length=159

 Score =   306 bits (784),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/154 (96%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESG TKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGGTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  ENLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>gb|AIT51844.1| eukaryotic translation initiation factor 5A [Lindernia brevidens]
Length=159

 Score =   305 bits (782),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LLTQIKDGFGEGKDLVVSVMS+MGEEQICALK
Sbjct  121  ESLLTQIKDGFGEGKDLVVSVMSSMGEEQICALK  154



>gb|AAQ08194.1| eukaryotic translation initiation factor 5A isoform IV [Hevea 
brasiliensis]
Length=160

 Score =   305 bits (781),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCD PHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDAPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  ENLLSQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>gb|AET97661.1| eukaryotic translation initiation factor 5A4 [Camellia sinensis]
Length=160

 Score =   305 bits (781),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LLTQIKDGFGEGKDLVV+VMSAMGEEQICALK
Sbjct  121  DVLLTQIKDGFGEGKDLVVTVMSAMGEEQICALK  154



>ref|XP_007045976.1| Eukaryotic elongation factor 5A-1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY01808.1| Eukaryotic elongation factor 5A-1 isoform 2, partial [Theobroma 
cacao]
Length=158

 Score =   305 bits (780),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  DNLLTQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>gb|KHG15047.1| Eukaryotic translation initiation factor 5A [Gossypium arboreum]
 gb|KHG29999.1| Eukaryotic translation initiation factor 5A [Gossypium arboreum]
Length=159

 Score =   305 bits (780),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESG+TKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL QIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  ENLLKQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_007045975.1| Eukaryotic elongation factor 5A-1 isoform 1 [Theobroma cacao]
 gb|EOY01807.1| Eukaryotic elongation factor 5A-1 isoform 1 [Theobroma cacao]
Length=159

 Score =   305 bits (780),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  DNLLTQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>gb|ACJ85877.1| unknown [Medicago truncatula]
 gb|AFK34201.1| unknown [Medicago truncatula]
 gb|AFK42588.1| unknown [Medicago truncatula]
 gb|AES96905.2| eukaryotic translation initiation factor 5A4 [Medicago truncatula]
Length=159

 Score =   305 bits (780),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESG TKDDL+LPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGGTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL+QIKDGFGEGKDL+VSVMSAMGEEQIC LK
Sbjct  121  ETLLSQIKDGFGEGKDLIVSVMSAMGEEQICGLK  154



>sp|Q9SC12.1|IF5A_SENVE RecName: Full=Eukaryotic translation initiation factor 5A; Short=eIF-5A 
[Senecio vernalis]
 emb|CAB65463.1| translation initiation factor 5A precursor protein (eIF-5A) [Senecio 
vernalis]
Length=159

 Score =   304 bits (779),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRK GHIVIKNR CKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKGGHIVIKNRACKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDL+LPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LLTQIKDGFGEGKDLVVSVMSAMGEEQICALK
Sbjct  121  DALLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  154



>gb|ABM53472.1| eIF5A [Rosa chinensis]
Length=159

 Score =   304 bits (779),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESK DAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKTDAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DNLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_002308400.1| eukaryotic translation initiation factor 5A isoform V family 
protein [Populus trichocarpa]
 gb|ABK93569.1| unknown [Populus trichocarpa]
 gb|ABK95266.1| unknown [Populus trichocarpa]
 gb|ABK96743.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE91923.1| eukaryotic translation initiation factor 5A isoform V family 
protein [Populus trichocarpa]
 gb|ACM79936.1| eIF5A2 [Populus deltoides]
 gb|AEF15862.1| eukaryotic translation initiation factor 5A2 [Populus tomentosa]
 gb|AEF15867.1| eukaryotic translation initiation factor 5A2 [Populus tremula 
x Populus alba]
 gb|AGK30189.1| eukaryotic translation initiation factor 5A2 [Populus simonii 
x Populus nigra]
Length=160

 Score =   304 bits (779),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRVDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGFGEGKDLVVSVMSAMGEEQICALK
Sbjct  121  DSLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  154



>gb|AEF15864.1| eukaryotic translation initiation factor 5A4 [Populus tomentosa]
 gb|AEF15869.1| eukaryotic translation initiation factor 5A4 [Populus tremula 
x Populus alba]
Length=160

 Score =   304 bits (778),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLT IKDGFGEGKDLVV+VMSAMGEEQICALK
Sbjct  121  DNLLTPIKDGFGEGKDLVVTVMSAMGEEQICALK  154



>gb|AIT51845.1| eukaryotic translation initiation factor 5A [Lindernia subracemosa]
Length=159

 Score =   304 bits (778),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL QIKDGF EGKDLVVSVMS+MGEEQICALK
Sbjct  121  ENLLAQIKDGFAEGKDLVVSVMSSMGEEQICALK  154



>gb|AAQ08191.1| eukaryotic translation initiation factor 5A isoform I [Hevea 
brasiliensis]
 gb|AAQ08192.1| eukaryotic translation initiation factor 5A isoform II [Hevea 
brasiliensis]
Length=160

 Score =   304 bits (778),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF  KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  ENLLSQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>gb|ABS01354.1| translation initiation factor [Carica papaya]
Length=159

 Score =   304 bits (778),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK+RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKSRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLLTQIKDGF EGKDLVVSVMS+MGEEQICALK
Sbjct  121  ENLLTQIKDGFAEGKDLVVSVMSSMGEEQICALK  154



>ref|XP_007045977.1| Eukaryotic elongation factor 5A-1 isoform 3, partial [Theobroma 
cacao]
 gb|EOY01809.1| Eukaryotic elongation factor 5A-1 isoform 3, partial [Theobroma 
cacao]
Length=198

 Score =   305 bits (781),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  92   AMSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
             MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  39   VMSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCH  98

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FV IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPT
Sbjct  99   FVGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPT  158

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            D+NLLTQIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  159  DDNLLTQIKDGFAEGKDLVVTVMSAMGEEQICALK  193



>gb|KHN01998.1| Eukaryotic translation initiation factor 5A [Glycine soja]
Length=159

 Score =   303 bits (777),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLTE+G TKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRIDYQLIDISEDGFVSLLTETGGTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLLTQIKDGF EGKDLVVSVMS+MGEEQICALK
Sbjct  121  ENLLTQIKDGFAEGKDLVVSVMSSMGEEQICALK  154



>gb|KJB53260.1| hypothetical protein B456_008G195800 [Gossypium raimondii]
Length=159

 Score =   303 bits (777),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT+SG+TKDDLRLPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDSGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLL QIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DNLLKQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_007202692.1| hypothetical protein PRUPE_ppa012643mg [Prunus persica]
 ref|XP_008242982.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Prunus mume]
 gb|EMJ03891.1| hypothetical protein PRUPE_ppa012643mg [Prunus persica]
Length=160

 Score =   303 bits (777),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL+QIKDGF +GKDLVV+VMSAMGEEQICALK
Sbjct  121  ESLLSQIKDGFADGKDLVVTVMSAMGEEQICALK  154



>emb|CDP00389.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   303 bits (776),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD+EH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLLTQIKDGF EGKDLVVSVM AMGEEQICALK
Sbjct  121  ENLLTQIKDGFSEGKDLVVSVMCAMGEEQICALK  154



>ref|XP_008360103.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Malus 
domestica]
 ref|XP_009356353.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Pyrus 
x bretschneideri]
Length=159

 Score =   303 bits (776),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DNLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>gb|KJB17390.1| hypothetical protein B456_003G098700 [Gossypium raimondii]
 gb|KJB39929.1| hypothetical protein B456_007G038700 [Gossypium raimondii]
Length=159

 Score =   303 bits (776),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT+SG+TKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDSGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL QIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  ENLLKQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_007223637.1| hypothetical protein PRUPE_ppa012654mg [Prunus persica]
 ref|XP_008221553.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Prunus 
mume]
 gb|EMJ24836.1| hypothetical protein PRUPE_ppa012654mg [Prunus persica]
Length=159

 Score =   303 bits (776),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGFGEGKDLVVSVMSAMGEEQICALK
Sbjct  121  DSLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_004287126.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Fragaria 
vesca subsp. vesca]
Length=159

 Score =   303 bits (776),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LLTQ+KDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  DALLTQLKDGFAEGKDLVVTVMSAMGEEQICALK  154



>ref|XP_011070968.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Sesamum 
indicum]
Length=159

 Score =   303 bits (775),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTSKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGFGEGKDLVVSVMSAMGEEQICALK
Sbjct  121  ENLLSQIKDGFGEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_009795916.1| PREDICTED: eukaryotic translation initiation factor 5A-1 [Nicotiana 
sylvestris]
 sp|P69039.1|IF5A1_NICPL RecName: Full=Eukaryotic translation initiation factor 5A-1; 
Short=eIF-5A-1; AltName: Full=eIF-4D [Nicotiana plumbaginifolia]
 sp|P69040.1|IF5A1_TOBAC RecName: Full=Eukaryotic translation initiation factor 5A-1; 
Short=eIF-5A-1; AltName: Full=eIF-4D [Nicotiana tabacum]
 emb|CAA45105.1| eukaryotic initiatin factor 5A (3) [Nicotiana tabacum]
Length=159

 Score =   303 bits (775),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLL  IKDGF EGKDLV+SVMSAMGEEQIC +K
Sbjct  121  DNLLALIKDGFAEGKDLVLSVMSAMGEEQICGIK  154



>ref|XP_008394324.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Malus domestica]
 ref|XP_008343897.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Malus domestica]
 ref|XP_009358446.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Pyrus x bretschneideri]
 ref|XP_009366169.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Pyrus x bretschneideri]
Length=160

 Score =   303 bits (775),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGF +GKDLVV+VMSAMGEEQICALK
Sbjct  121  DSLLTQIKDGFNDGKDLVVTVMSAMGEEQICALK  154



>ref|XP_004508713.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Cicer arietinum]
Length=160

 Score =   303 bits (775),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDL+LPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DSLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_006344253.1| PREDICTED: eukaryotic translation initiation factor 5A-4-like 
[Solanum tuberosum]
Length=159

 Score =   302 bits (774),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL+QIKDGF EGKDLVVSVMSAMGEEQI ALK
Sbjct  121  ESLLSQIKDGFAEGKDLVVSVMSAMGEEQINALK  154



>gb|KHG18622.1| Eukaryotic translation initiation factor 5A-2 [Gossypium arboreum]
 gb|KJB29802.1| hypothetical protein B456_005G143800 [Gossypium raimondii]
 gb|KJB29803.1| hypothetical protein B456_005G143800 [Gossypium raimondii]
Length=159

 Score =   302 bits (774),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDI+PSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTGKKLEDILPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIKDGF EGKDLVVSVMSAMGEEQIC LK
Sbjct  121  DNLLTQIKDGFAEGKDLVVSVMSAMGEEQICGLK  154



>gb|ACJ76772.1| eukaryotic translation initiation factor 5A1 [Glycine max]
Length=159

 Score =   302 bits (774),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLTE+G TKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRIDYQLIDISEDGFVSLLTETGGTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVVSVMS+MGEEQICALK
Sbjct  121  ENLLSQIKDGFAEGKDLVVSVMSSMGEEQICALK  154



>ref|XP_003634303.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Vitis 
vinifera]
 emb|CAN69723.1| hypothetical protein VITISV_018888 [Vitis vinifera]
 emb|CBI15181.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   302 bits (774),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESK DAGASKTYPQQAGTIRKNG+IVIK+RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKGDAGASKTYPQQAGTIRKNGYIVIKSRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DNLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_010923568.1| PREDICTED: eukaryotic translation initiation factor 5A isoform 
X2 [Elaeis guineensis]
Length=159

 Score =   302 bits (773),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  ENLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_007011943.1| Eukaryotic translation initiation factor 5A-1 [Theobroma cacao]
 gb|EOY29562.1| Eukaryotic translation initiation factor 5A-1 [Theobroma cacao]
 gb|KDP38674.1| hypothetical protein JCGZ_04027 [Jatropha curcas]
Length=160

 Score =   302 bits (773),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH F+SKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFDSKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  ENLLSQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>gb|ACU13235.1| unknown [Glycine max]
 gb|KHN03137.1| Eukaryotic translation initiation factor 5A [Glycine soja]
Length=159

 Score =   302 bits (773),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLTE+G TKDDLRLPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVNRIDYQLIDISEDGFVSLLTETGGTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLLTQIKDGF EGKDLVVSVMS+MGEEQICALK
Sbjct  121  ENLLTQIKDGFAEGKDLVVSVMSSMGEEQICALK  154



>gb|AEF15863.1| eukaryotic translation initiation factor 5A3 [Populus tomentosa]
Length=159

 Score =   302 bits (773),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEE  FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEQHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LL+QIKDGFGEGKDLVV+VMS+MGEEQICALK
Sbjct  121  DSLLSQIKDGFGEGKDLVVTVMSSMGEEQICALK  154



>gb|ADG27839.1| eukaryotic translation initiation factor 5A [Gossypium hirsutum]
 gb|KHG12949.1| Eukaryotic translation initiation factor 5A-2 [Gossypium arboreum]
Length=159

 Score =   301 bits (772),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESG+TKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL QIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  ENLLKQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>gb|AEF15868.1| eukaryotic translation initiation factor 5A3 [Populus tremula 
x Populus alba]
Length=159

 Score =   301 bits (772),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEE  FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEQHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LL+QIKDGFGEGKDLVV+VMS+MGEEQICALK
Sbjct  121  DSLLSQIKDGFGEGKDLVVTVMSSMGEEQICALK  154



>ref|XP_002325136.1| eukaryotic translation initiation factor 5A isoform V family 
protein [Populus trichocarpa]
 gb|ABK96021.1| unknown [Populus trichocarpa]
 gb|EEF03701.1| eukaryotic translation initiation factor 5A isoform V family 
protein [Populus trichocarpa]
 gb|ACM79938.1| eIF5A4 [Populus deltoides]
 gb|AGK30190.1| eukaryotic translation initiation factor 5A4 [Populus simonii 
x Populus nigra]
Length=160

 Score =   302 bits (773),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLT IKDGFGEGKDLVV+VMSAMGEEQICALK
Sbjct  121  DSLLTPIKDGFGEGKDLVVTVMSAMGEEQICALK  154



>gb|KDP31295.1| hypothetical protein JCGZ_11671 [Jatropha curcas]
Length=159

 Score =   301 bits (772),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVV+VMS+MGEEQICALK
Sbjct  121  ENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALK  154



>ref|XP_004237050.1| PREDICTED: eukaryotic translation initiation factor 5A-3-like 
[Solanum lycopersicum]
Length=159

 Score =   301 bits (772),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+ IKDGF EGKDLVVSVMSAMGEEQI ALK
Sbjct  121  ENLLSLIKDGFAEGKDLVVSVMSAMGEEQINALK  154



>gb|EPS70783.1| hypothetical protein M569_03977 [Genlisea aurea]
Length=159

 Score =   301 bits (772),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT+SG TKDDLRLPTD
Sbjct  61   VAIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDSGGTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL QIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  ENLLQQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_007157699.1| hypothetical protein PHAVU_002G090900g [Phaseolus vulgaris]
 gb|ESW29693.1| hypothetical protein PHAVU_002G090900g [Phaseolus vulgaris]
Length=159

 Score =   301 bits (772),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+G TKDDLRLPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTETGGTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL+QIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  ESLLSQIKDGFSEGKDLVVSVMSAMGEEQICALK  154



>ref|NP_001066843.1| Os12g0507200 [Oryza sativa Japonica Group]
 gb|ABA98689.1| Eukaryotic translation initiation factor 5A-2, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF29862.1| Os12g0507200 [Oryza sativa Japonica Group]
 gb|ABR25598.1| eukaryotic translation initiation factor 5a-2, putative [Oryza 
sativa Indica Group]
 dbj|BAG88155.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93887.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69347.1| hypothetical protein OsI_38459 [Oryza sativa Indica Group]
 gb|EEE53277.1| hypothetical protein OsJ_36226 [Oryza sativa Japonica Group]
Length=160

 Score =   301 bits (772),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 152/155 (98%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIFT KKLEDIVPSSHNCDVPHVNRT+YQLIDISEDGFVSLLTE+GNTKDDLRLPT
Sbjct  61   FVAIDIFTAKKLEDIVPSSHNCDVPHVNRTEYQLIDISEDGFVSLLTENGNTKDDLRLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            D+NLL+QIKDGFGEGKDLVV+VMSAMGEEQICALK
Sbjct  121  DDNLLSQIKDGFGEGKDLVVTVMSAMGEEQICALK  155



>ref|XP_002312268.1| eukaryotic translation initiation factor 5A isoform VI family 
protein [Populus trichocarpa]
 gb|ABK93726.1| unknown [Populus trichocarpa]
 gb|EEE89635.1| eukaryotic translation initiation factor 5A isoform VI family 
protein [Populus trichocarpa]
Length=159

 Score =   301 bits (772),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDL+LPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGFGEGKDLVV+VMS+MGEEQICALK
Sbjct  121  DSLLTQIKDGFGEGKDLVVTVMSSMGEEQICALK  154



>gb|KJB08360.1| hypothetical protein B456_001G078800 [Gossypium raimondii]
Length=159

 Score =   301 bits (771),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD++H FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDDHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT+SG+TKDDLRLPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDSGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL QIKDGFGEGKDLVVSVMSAMGEEQICALK
Sbjct  121  ENLLKQIKDGFGEGKDLVVSVMSAMGEEQICALK  154



>gb|AAQ08193.1| eukaryotic translation initiation factor 5A isoform III [Hevea 
brasiliensis]
Length=160

 Score =   301 bits (772),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEV TSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVPTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF  KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  ENLLSQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>ref|XP_010047111.1| PREDICTED: eukaryotic translation initiation factor 5A [Eucalyptus 
grandis]
 gb|KCW78908.1| hypothetical protein EUGRSUZ_C00350 [Eucalyptus grandis]
Length=160

 Score =   301 bits (771),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LL+QIKDGF EGKDLVVSVM+AMGEEQICALK
Sbjct  121  DSLLSQIKDGFAEGKDLVVSVMNAMGEEQICALK  154



>gb|KHG00291.1| Eukaryotic translation initiation factor 5A [Gossypium arboreum]
Length=159

 Score =   301 bits (771),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESG+TKDDLRLPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLL QIK+GF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DNLLKQIKEGFAEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_010101033.1| Eukaryotic translation initiation factor 5A-4 [Morus notabilis]
 gb|EXB86681.1| Eukaryotic translation initiation factor 5A-4 [Morus notabilis]
Length=160

 Score =   301 bits (771),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDLRLPTD
Sbjct  61   VAIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL+QIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  EALLSQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_008443857.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Cucumis 
melo]
Length=160

 Score =   301 bits (771),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH F+SKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFDSKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQ+KDGF EGKDLV++VMSAMGEEQICALK
Sbjct  121  DNLLTQLKDGFAEGKDLVLTVMSAMGEEQICALK  154



>ref|XP_006664051.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Oryza brachyantha]
Length=160

 Score =   301 bits (771),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 153/155 (99%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIFTGKKLEDIVPSSHNCDVPHVNRT+YQLIDISEDGFVSLLTE+GNTKDDLRLPT
Sbjct  61   FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTEYQLIDISEDGFVSLLTENGNTKDDLRLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            D++LL+QIKDGFGEGKDLVV+VMSAMGEEQICALK
Sbjct  121  DDSLLSQIKDGFGEGKDLVVTVMSAMGEEQICALK  155



>ref|XP_009628511.1| PREDICTED: eukaryotic translation initiation factor 5A-1 [Nicotiana 
tomentosiformis]
Length=159

 Score =   301 bits (771),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LL+ IKDGF EGKDLV+SVMSAMGEEQIC +K
Sbjct  121  DSLLSLIKDGFAEGKDLVLSVMSAMGEEQICGIK  154



>ref|NP_001234507.1| eukaryotic translation initiation factor 5A-3 [Solanum lycopersicum]
 sp|Q9AXQ4.1|IF5A3_SOLLC RecName: Full=Eukaryotic translation initiation factor 5A-3; 
Short=eIF-5A-3 [Solanum lycopersicum]
 gb|AAG53649.1|AF296085_1 eukaryotic translation initiation factor 5A-3 [Solanum lycopersicum]
Length=159

 Score =   301 bits (771),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+ IKDGF EGKDLVVSVMSAMGEEQI ALK
Sbjct  121  ENLLSLIKDGFAEGKDLVVSVMSAMGEEQINALK  154



>gb|AEF15861.1| eukaryotic translation initiation factor 5A1 [Populus tomentosa]
Length=159

 Score =   301 bits (771),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGFGEGKDLVV+VMS+MGEEQICALK
Sbjct  121  DSLLTQIKDGFGEGKDLVVTVMSSMGEEQICALK  154



>ref|XP_008339846.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Malus 
domestica]
 ref|XP_008352970.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Malus 
domestica]
 gb|AGG23544.1| eukaryotic translation initiation factor 5A [Malus hupehensis]
Length=159

 Score =   301 bits (771),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DSLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>gb|AFR23349.1| eukaryotic translation initiation factor 5A [Arachis hypogaea]
Length=160

 Score =   301 bits (771),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DSLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>sp|Q9AXJ4.2|IF5A_MANES RecName: Full=Eukaryotic translation initiation factor 5A; Short=eIF-5A 
[Manihot esculenta]
 gb|AAK55848.1|AF266464_1 translation initiation factor 5A [Manihot esculenta]
Length=160

 Score =   301 bits (771),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKV+EVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVMEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVVSVMSAMGEE+IC+LK
Sbjct  121  ENLLSQIKDGFAEGKDLVVSVMSAMGEERICSLK  154



>ref|XP_006650623.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Oryza 
brachyantha]
Length=161

 Score =   301 bits (770),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/155 (95%), Positives = 149/155 (96%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEH FESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESG TKDDLRLPT
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGGTKDDLRLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            DE LLTQIKDGF EGKDL+V+VMSAMGEEQICALK
Sbjct  121  DEALLTQIKDGFNEGKDLIVTVMSAMGEEQICALK  155



>gb|KHG23013.1| Eukaryotic translation initiation factor 5A [Gossypium arboreum]
Length=159

 Score =   301 bits (770),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD++H FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDDHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESG+TKDDLRLPTD
Sbjct  61   VGIDIFIGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL QIKDGFGEGKDLVVSVMSAMGEEQICALK
Sbjct  121  ENLLKQIKDGFGEGKDLVVSVMSAMGEEQICALK  154



>ref|NP_001274959.1| eukaryotic translation initiation factor 5A-5 [Solanum tuberosum]
 sp|P56337.1|IF5A5_SOLTU RecName: Full=Eukaryotic translation initiation factor 5A-5; 
Short=eIF-5A-5; AltName: Full=eIF-4D [Solanum tuberosum]
 dbj|BAA20879.1| eukaryotic initiation factor 5A5 [Solanum tuberosum]
 gb|ABB02627.1| eukaryotic initiation factor 5A5-like [Solanum tuberosum]
 gb|ABB16995.1| eukaryotic initiation factor 5A5-like protein [Solanum tuberosum]
Length=159

 Score =   301 bits (770),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRK+GHIVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKSGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LL Q+KDGF EGKDLV+SVMSAMGEEQIC +K
Sbjct  121  DTLLAQVKDGFAEGKDLVLSVMSAMGEEQICGIK  154



>ref|XP_009421077.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009421078.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009421079.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009421080.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Musa acuminata subsp. malaccensis]
Length=159

 Score =   301 bits (770),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LLTQ+K+GFGEGKDLVV+VMSAMGEEQICALK
Sbjct  121  ESLLTQLKEGFGEGKDLVVTVMSAMGEEQICALK  154



>ref|XP_010265598.1| PREDICTED: eukaryotic translation initiation factor 5A [Nelumbo 
nucifera]
Length=160

 Score =   300 bits (769),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD++H FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDDHHFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLLTQIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  ENLLTQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>ref|XP_010532657.1| PREDICTED: eukaryotic translation initiation factor 5A-5 [Tarenaya 
hassleriana]
Length=160

 Score =   300 bits (769),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNGHIVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT+SG+TKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDSGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL QIKDGF EGKDL+VSVMSAMGEEQIC LK
Sbjct  121  ESLLKQIKDGFEEGKDLIVSVMSAMGEEQICGLK  154



>gb|AFC01198.1| eukaryotic translation initiation factor [Ammopiptanthus mongolicus]
Length=160

 Score =   300 bits (769),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGF+SLLTE+GNTKDDL+LPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFLSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DNLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>sp|P26564.1|IF5A1_MEDSA RecName: Full=Eukaryotic translation initiation factor 5A-1; 
Short=eIF-5A-1; AltName: Full=eIF-4D [Medicago sativa]
 emb|CAA42065.1| eukaryotic translation initiation factor 4D [Medicago sativa]
Length=161

 Score =   300 bits (769),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 152/155 (98%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDI-VPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            VAIDIFT KKLE++ VPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDL+LPT
Sbjct  61   VAIDIFTSKKLEEVYVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLKLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            D++LLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DDSLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  155



>ref|XP_008452854.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Cucumis 
melo]
Length=159

 Score =   300 bits (769),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT+SG+TKDDLRLPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDSGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLL QIK+GF EGKDLVVSVMS+MGEEQICALK
Sbjct  121  DNLLKQIKEGFAEGKDLVVSVMSSMGEEQICALK  154



>ref|XP_009383000.1| PREDICTED: eukaryotic translation initiation factor 5A-5 [Musa 
acuminata subsp. malaccensis]
Length=159

 Score =   300 bits (769),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF  KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL QIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  ETLLAQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>gb|AAQ08198.1| eukaryotic translation initiation factor 5A isoform VIII [Hevea 
brasiliensis]
Length=158

 Score =   300 bits (768),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/153 (94%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +2

Query  98   SDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFV  277
            SDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHFV
Sbjct  1    SDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFV  60

Query  278  AIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTDE  457
             IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTDE
Sbjct  61   GIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDE  120

Query  458  NLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            NLLTQIKDGF EGKDLVV+VMS+MGEEQICALK
Sbjct  121  NLLTQIKDGFAEGKDLVVTVMSSMGEEQICALK  153



>gb|AGU01536.1| eukaryotic translation initiation factor 5A [Picrorhiza kurrooa]
Length=159

 Score =   300 bits (768),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDL+LPTD
Sbjct  61   VAIDIFTSKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DSLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>ref|NP_001234499.1| eukaryotic translation initiation factor 5A-1 [Solanum lycopersicum]
 sp|Q9AXQ6.1|IF5A1_SOLLC RecName: Full=Eukaryotic translation initiation factor 5A-1; 
Short=eIF-5A-1 [Solanum lycopersicum]
 gb|AAG53647.1|AF296083_1 eukaryotic translation initiation factor 5A-1 [Solanum lycopersicum]
Length=159

 Score =   300 bits (768),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRK GHIVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKGGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LL Q+KDGF EGKDLV+SVMSAMGEEQIC +K
Sbjct  121  DTLLAQVKDGFAEGKDLVLSVMSAMGEEQICGIK  154



>gb|AAQ08196.1| eukaryotic translation initiation factor 5A isoform VI [Hevea 
brasiliensis]
Length=159

 Score =   300 bits (768),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF  KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVV+VMS+MGEEQICALK
Sbjct  121  ENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALK  154



>ref|NP_001051336.1| Os03g0758800 [Oryza sativa Japonica Group]
 gb|AAK16176.1|AC079887_8 translation initiation factor 5A [Oryza sativa Japonica Group]
 gb|AAK63944.1|AC084282_25 translation initiation factor 5A [Oryza sativa Japonica Group]
 gb|ABF98985.1| Eukaryotic translation initiation factor 5A-2, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13250.1| Os03g0758800 [Oryza sativa Japonica Group]
 dbj|BAG87428.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00565.1| unnamed protein product [Oryza sativa Japonica Group]
Length=161

 Score =   300 bits (768),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 146/155 (94%), Positives = 149/155 (96%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEH FESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESG TKDDLRLP+
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGGTKDDLRLPS  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            DE LLTQIKDGF EGKDL+V+VMSAMGEEQICALK
Sbjct  121  DEALLTQIKDGFAEGKDLIVTVMSAMGEEQICALK  155



>gb|AEF15866.1| eukaryotic translation initiation factor 5A1 [Populus tremula 
x Populus alba]
Length=159

 Score =   300 bits (768),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDL+LPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGFGEGKDLVV+VMS+MGEEQICALK
Sbjct  121  DSLLTQIKDGFGEGKDLVVTVMSSMGEEQICALK  154



>ref|XP_011079412.1| PREDICTED: eukaryotic translation initiation factor 5A-3 [Sesamum 
indicum]
Length=160

 Score =   300 bits (767),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL QIK GF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  ESLLGQIKGGFEEGKDLVVSVMSAMGEEQICALK  154



>gb|ABK93539.1| unknown [Populus trichocarpa]
Length=165

 Score =   300 bits (768),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+G TKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGKTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLT IKDGFGEGKDLVV+VMSAMGEEQICALK
Sbjct  121  DSLLTPIKDGFGEGKDLVVTVMSAMGEEQICALK  154



>gb|ACM79935.1| eIF5A1 [Populus deltoides]
Length=159

 Score =   300 bits (767),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDL+LPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGFGEGKDLVV+VMS+MGEEQICALK
Sbjct  121  DSLLTQIKDGFGEGKDLVVTVMSSMGEEQICALK  154



>gb|AFK47838.1| unknown [Medicago truncatula]
 gb|KEH33401.1| eukaryotic translation initiation factor 5A4 [Medicago truncatula]
 gb|KEH33402.1| eukaryotic translation initiation factor 5A4 [Medicago truncatula]
Length=160

 Score =   300 bits (767),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDL+LPTD
Sbjct  61   VAIDIFTSKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIK+GF EGKDLVVSVMS+MGEEQI ALK
Sbjct  121  DNLLTQIKEGFAEGKDLVVSVMSSMGEEQINALK  154



>ref|NP_001238467.1| uncharacterized LOC100306157 [Glycine max]
 gb|ACU14205.1| unknown [Glycine max]
Length=159

 Score =   300 bits (767),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MS EEH FESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSGEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLTE+G TKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRIDYQLIDISEDGFVSLLTETGGTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVVSVMS+MGEEQICALK
Sbjct  121  ENLLSQIKDGFAEGKDLVVSVMSSMGEEQICALK  154



>ref|XP_004146682.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Cucumis 
sativus]
 ref|XP_004166940.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Cucumis 
sativus]
 gb|KGN65160.1| hypothetical protein Csa_1G256200 [Cucumis sativus]
Length=160

 Score =   300 bits (767),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH F+SKADAGASKT+PQQAG IRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFDSKADAGASKTFPQQAGAIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQ+KDGF EGKDLV++VMSAMGEEQICALK
Sbjct  121  DNLLTQLKDGFAEGKDLVLTVMSAMGEEQICALK  154



>ref|XP_006440666.1| hypothetical protein CICLE_v10022624mg [Citrus clementina]
 gb|ESR53906.1| hypothetical protein CICLE_v10022624mg [Citrus clementina]
Length=160

 Score =   299 bits (766),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK+RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKSRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF+GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFSGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQ+KDGF EGKDLV++VMS+MGEEQICALK
Sbjct  121  ETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK  154



>ref|XP_011463671.1| PREDICTED: mitotic checkpoint protein BUB3.3-like [Fragaria vesca 
subsp. vesca]
Length=490

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/155 (95%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  92   AMSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            AMSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  331  AMSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCH  390

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FV IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPT
Sbjct  391  FVGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPT  450

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            D+NLLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  451  DDNLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  485



>ref|NP_001237458.1| eukaryotic translation initiation factor 5A3 [Glycine max]
 ref|XP_003527096.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Glycine max]
 ref|XP_003549690.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
isoform 1 [Glycine max]
 gb|ACJ76773.1| eukaryotic translation initiation factor 5A2 [Glycine max]
 gb|ACJ76774.1| eukaryotic translation initiation factor 5A3 [Glycine max]
 gb|KHN06889.1| Eukaryotic translation initiation factor 5A-2 [Glycine soja]
 gb|KHN18577.1| Eukaryotic translation initiation factor 5A-2 [Glycine soja]
 gb|KHN45674.1| Eukaryotic translation initiation factor 5A-2 [Glycine soja]
 gb|KHN48712.1| Eukaryotic translation initiation factor 5A-2 [Glycine soja]
Length=160

 Score =   299 bits (766),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDI+EDGF+SLLTE+GNTKDDL+LPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDIAEDGFLSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  ESLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>gb|ACM79937.1| eIF5A3 [Populus deltoides]
Length=159

 Score =   299 bits (765),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEE  FESKADAGASKTYPQQAGTIRK+G+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEQHFESKADAGASKTYPQQAGTIRKSGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL+QIKDGFGEGKDLVV+VMS+MGEEQICALK
Sbjct  121  ESLLSQIKDGFGEGKDLVVTVMSSMGEEQICALK  154



>ref|XP_010906864.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Elaeis 
guineensis]
Length=159

 Score =   299 bits (765),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL QIKDGF EGKDLVVSVM+AMGEEQICALK
Sbjct  121  ENLLAQIKDGFAEGKDLVVSVMNAMGEEQICALK  154



>gb|EEC82388.1| hypothetical protein OsI_26733 [Oryza sativa Indica Group]
Length=173

 Score =   299 bits (766),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 151/156 (97%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   AMSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKC  268
            AMSD EEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKC
Sbjct  13   AMSDSEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKC  72

Query  269  HFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLP  448
            HFVAIDIF GKKLEDIVPSSHNCDVPHVNRT+YQLIDISEDGFVSLLTESGNTKDDLRLP
Sbjct  73   HFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTEYQLIDISEDGFVSLLTESGNTKDDLRLP  132

Query  449  TDENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            TD++LL QIK GFGEGKDLVV+VMSAMGEEQICALK
Sbjct  133  TDDSLLGQIKTGFGEGKDLVVTVMSAMGEEQICALK  168



>sp|P56336.1|IF5A4_SOLTU RecName: Full=Eukaryotic translation initiation factor 5A-4; 
Short=eIF-5A-4; AltName: Full=eIF-4D [Solanum tuberosum]
 dbj|BAA20878.1| eukaryotic initiation factor 5A4 [Solanum tuberosum]
Length=159

 Score =   299 bits (765),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRK+G+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKSGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LL+QIKDGF EGKDLVVSVMSAMGEEQI ALK
Sbjct  121  DSLLSQIKDGFAEGKDLVVSVMSAMGEEQINALK  154



>ref|XP_009380102.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Musa 
acuminata subsp. malaccensis]
 gb|ACP31200.1| eukaryotic initiation factor 5A1 [Musa hybrid cultivar]
Length=159

 Score =   299 bits (765),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF  KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTESGNTKDDL+LPTD
Sbjct  61   VAIDIFNAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTESGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL Q+KDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  ENLLAQLKDGFAEGKDLVVTVMSAMGEEQICALK  154



>gb|AFK46389.1| unknown [Lotus japonicus]
Length=159

 Score =   299 bits (765),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGT+RKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTVRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCD+PHVNRTDYQLIDISEDGFVSLLT+SG+TKDDL+LPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDIPHVNRTDYQLIDISEDGFVSLLTDSGDTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LL QIK+GFG+GKDLVVSVMSAMGEEQICALK
Sbjct  121  DALLKQIKEGFGDGKDLVVSVMSAMGEEQICALK  154



>gb|AAK12100.1|AF323604_1 initiation factor eIF5-A [Manihot esculenta]
Length=160

 Score =   299 bits (765),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKV+EVSTSKTG HGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVMEVSTSKTGXHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVVSVMSAMGEE+IC+LK
Sbjct  121  ENLLSQIKDGFAEGKDLVVSVMSAMGEERICSLK  154



>gb|AFP44116.1| eukaryotic translation initiation factor [Lycoris longituba]
Length=159

 Score =   298 bits (764),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG++VIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYLVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFTAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQIKDGF EGKDLVVSVMSAMGEEQIC LK
Sbjct  121  EALLTQIKDGFSEGKDLVVSVMSAMGEEQICGLK  154



>ref|XP_006453626.1| hypothetical protein CICLE_v10009759mg [Citrus clementina]
 ref|XP_006473995.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Citrus 
sinensis]
 gb|ESR66866.1| hypothetical protein CICLE_v10009759mg [Citrus clementina]
 gb|KDO59448.1| hypothetical protein CISIN_1g030552mg [Citrus sinensis]
Length=160

 Score =   298 bits (764),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCD PHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVV+VMS+MGEEQICALK
Sbjct  121  ENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALK  154



>ref|XP_004145502.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Cucumis 
sativus]
 ref|XP_004168177.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Cucumis 
sativus]
 gb|KGN55431.1| hypothetical protein Csa_4G651970 [Cucumis sativus]
Length=159

 Score =   298 bits (764),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAG IRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGAIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT+SG+TKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDSGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLL QIK+GF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DNLLKQIKEGFAEGKDLVVSVMSAMGEEQICALK  154



>gb|AGV54677.1| eukaryotic translation initiation factor 5A [Phaseolus vulgaris]
Length=160

 Score =   298 bits (764),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH F+S ADAGASKTYPQQAGTIRKNG+IVIK+RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFDSHADAGASKTYPQQAGTIRKNGYIVIKSRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LL+QIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DSLLSQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>gb|AFD22854.1| eukaryotic translation initiation factor 5A4 [Tamarix androssowii]
Length=159

 Score =   298 bits (764),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD+EH FESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHV+RTDYQLIDISEDGFVSLLTE+G+TKDDLRLPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVSRTDYQLIDISEDGFVSLLTETGSTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIKDGF EGKDL+VSVMSAMGEEQIC LK
Sbjct  121  DNLLTQIKDGFAEGKDLIVSVMSAMGEEQICGLK  154



>gb|AAQ08197.1| eukaryotic translation initiation factor 5A isoform VII [Hevea 
brasiliensis]
Length=159

 Score =   298 bits (764),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVV+VSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVDVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF  KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVV+VMS+MGEEQICALK
Sbjct  121  ENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALK  154



>ref|XP_003613947.1| Eukaryotic translation initiation factor 5A [Medicago truncatula]
Length=164

 Score =   298 bits (764),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 149/159 (94%), Gaps = 5/159 (3%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESG TKDDL+LPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGGTKDDLKLPTD  120

Query  455  ENLLTQ-----IKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL+Q     IKDGFGEGKDL+VSVMSAMGEEQIC LK
Sbjct  121  ETLLSQVSCVIIKDGFGEGKDLIVSVMSAMGEEQICGLK  159



>ref|XP_007155275.1| hypothetical protein PHAVU_003G187500g [Phaseolus vulgaris]
 gb|ESW27269.1| hypothetical protein PHAVU_003G187500g [Phaseolus vulgaris]
Length=160

 Score =   298 bits (763),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIK+GF +GKDLVVSVMSAMGEEQICALK
Sbjct  121  DSLLTQIKEGFADGKDLVVSVMSAMGEEQICALK  154



>ref|XP_011083979.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Sesamum 
indicum]
Length=160

 Score =   298 bits (763),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDL+LPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL QIK GF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  ENLLNQIKSGFEEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_008785934.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
isoform X1 [Phoenix dactylifera]
Length=159

 Score =   298 bits (763),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVARTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLLTQIKDGF EGKDLVV+VM+AMGEEQICALK
Sbjct  121  ENLLTQIKDGFAEGKDLVVTVMTAMGEEQICALK  154



>ref|XP_007138153.1| hypothetical protein PHAVU_009G184600g [Phaseolus vulgaris]
 gb|ESW10147.1| hypothetical protein PHAVU_009G184600g [Phaseolus vulgaris]
Length=160

 Score =   298 bits (763),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLL+QIKDGF EGKDLVVSVMSAMGEEQI ALK
Sbjct  121  DNLLSQIKDGFAEGKDLVVSVMSAMGEEQINALK  154



>gb|AAT01416.1| translation initiation factor 5A [Tamarix androssowii]
 gb|AFD22853.1| eukaryotic translation initiation factor 5A3 [Tamarix androssowii]
Length=159

 Score =   298 bits (763),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+G TKDDLRLP+D
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTETGGTKDDLRLPSD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQIKDGF EGKDL+VSVM AMGEEQICALK
Sbjct  121  ETLLTQIKDGFAEGKDLIVSVMCAMGEEQICALK  154



>gb|AFD22852.1| eukaryotic translation initiation factor 5A2 [Tamarix androssowii]
Length=159

 Score =   298 bits (763),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+G TKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTETGGTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LLTQIK+GF EGKDL+VSVMS+MGEEQIC LK
Sbjct  121  DTLLTQIKEGFAEGKDLIVSVMSSMGEEQICGLK  154



>ref|NP_001234503.1| eukaryotic translation initiation factor 5A-2 [Solanum lycopersicum]
 sp|Q9AXQ5.1|IF5A2_SOLLC RecName: Full=Eukaryotic translation initiation factor 5A-2; 
Short=eIF-5A-2 [Solanum lycopersicum]
 gb|AAG53648.1|AF296084_1 eukaryotic translation initiation factor 5A-2 [Solanum lycopersicum]
Length=160

 Score =   298 bits (763),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL Q+KDGF EGKDLVVSVMSAMGEEQI A+K
Sbjct  121  ENLLKQVKDGFQEGKDLVVSVMSAMGEEQINAVK  154



>ref|XP_011101969.1| PREDICTED: eukaryotic translation initiation factor 5A [Sesamum 
indicum]
Length=159

 Score =   298 bits (763),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVVSV S+MGEEQICALK
Sbjct  121  ENLLSQIKDGFAEGKDLVVSVQSSMGEEQICALK  154



>ref|NP_001275460.1| eukaryotic translation initiation factor 5A-4 [Solanum tuberosum]
 gb|ABA46751.1| eukaryotic initiation factor 5A4-like protein [Solanum tuberosum]
Length=159

 Score =   298 bits (763),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRK+G+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKSGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGK+LEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDLRLPTD
Sbjct  61   VAIDIFTGKRLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LL+QIKDGF EGKDLVVSVMSAMGEEQI ALK
Sbjct  121  DSLLSQIKDGFAEGKDLVVSVMSAMGEEQINALK  154



>ref|XP_006857226.1| hypothetical protein AMTR_s00065p00207570 [Amborella trichopoda]
 gb|ERN18693.1| hypothetical protein AMTR_s00065p00207570 [Amborella trichopoda]
Length=159

 Score =   298 bits (762),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FE +ADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFEPRADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGF SLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFASLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+L TQI+DGFGEGKDLVV+VMSAMGEEQICALK
Sbjct  121  ESLHTQIRDGFGEGKDLVVTVMSAMGEEQICALK  154



>gb|KHG20338.1| Eukaryotic translation initiation factor 5A-2 [Gossypium arboreum]
 gb|KJB50568.1| hypothetical protein B456_008G178700 [Gossypium raimondii]
Length=159

 Score =   298 bits (762),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDE+H FESKADAGASKT+PQQAGTIRKNGHIVIK+RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEDHHFESKADAGASKTFPQQAGTIRKNGHIVIKSRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKK+EDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD
Sbjct  61   VGIDIFTGKKVEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQIK GF EGKDL+V+VMSAMGEEQICALK
Sbjct  121  EFLLTQIKTGFAEGKDLIVTVMSAMGEEQICALK  154



>sp|P56335.1|IF5A3_SOLTU RecName: Full=Eukaryotic translation initiation factor 5A-3; 
Short=eIF-5A-3; AltName: Full=eIF-4D [Solanum tuberosum]
 dbj|BAA20877.1| eukaryotic initiation factor 5A3 [Solanum tuberosum]
 gb|ABA81854.1| eukaryotic initiation factor 5A3-like [Solanum tuberosum]
Length=160

 Score =   298 bits (762),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL Q+KDGF EGKDLVVSVMSAMGEEQI A+K
Sbjct  121  ESLLKQVKDGFQEGKDLVVSVMSAMGEEQINAIK  154



>emb|CAL69910.1| eIF-5A precursor protein [Phalaenopsis hybrid cultivar]
Length=159

 Score =   298 bits (762),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF  KKLEDIVPSSHNCDVPHVNRTDYQLIDI+EDGF+SLLTE+GNTKDDL+LPTD
Sbjct  61   VAIDIFNQKKLEDIVPSSHNCDVPHVNRTDYQLIDIAEDGFLSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  DNLLTQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>ref|XP_010275806.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Nelumbo 
nucifera]
Length=160

 Score =   298 bits (762),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD++H FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDDHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCD PHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDAPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  DNLLTQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>emb|CAB96075.1| translation initiation factor, eIF-5A [Oryza sativa]
 emb|CAC84392.1| translation initiation factor, eIF-5A [Oryza sativa]
Length=161

 Score =   298 bits (762),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 148/155 (95%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEH FESKADAGASKTYPQQAGTIRK GHIVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHHFESKADAGASKTYPQQAGTIRKTGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESG TKDDLRLP+
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGGTKDDLRLPS  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            DE LLTQIKDGF EGKDL+V+VMSAMGEEQICALK
Sbjct  121  DEALLTQIKDGFAEGKDLIVTVMSAMGEEQICALK  155



>ref|XP_002315023.1| hypothetical protein POPTR_0010s17020g [Populus trichocarpa]
 gb|ABK93683.1| unknown [Populus trichocarpa]
 gb|ABK95708.1| unknown [Populus trichocarpa]
 gb|EEF01194.1| hypothetical protein POPTR_0010s17020g [Populus trichocarpa]
Length=159

 Score =   297 bits (761),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEE  FESKADAGASKTYPQQAGTIRK+G+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEQHFESKADAGASKTYPQQAGTIRKSGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL+QIKDGFG+GKDLVV+VMS+MGEEQICALK
Sbjct  121  ESLLSQIKDGFGDGKDLVVTVMSSMGEEQICALK  154



>ref|XP_010108736.1| Eukaryotic translation initiation factor 5A-4 [Morus notabilis]
 gb|EXC20047.1| Eukaryotic translation initiation factor 5A-4 [Morus notabilis]
Length=213

 Score =   299 bits (766),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +2

Query  89   GAMSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKC  268
             AMSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKC
Sbjct  53   AAMSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKC  112

Query  269  HFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLP  448
            HFV IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDLRLP
Sbjct  113  HFVGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLP  172

Query  449  TDENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            TDE LLTQIKDGF +GKDLVVSVMSAMGEEQI ALK
Sbjct  173  TDEALLTQIKDGFADGKDLVVSVMSAMGEEQISALK  208



>ref|XP_008776061.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Phoenix dactylifera]
Length=159

 Score =   297 bits (761),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAG IRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGAIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD
Sbjct  61   VAIDIFTAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQIKDGF EGKDLVV+VMSAMGEEQIC LK
Sbjct  121  ETLLTQIKDGFAEGKDLVVTVMSAMGEEQICTLK  154



>ref|XP_006657914.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Oryza 
brachyantha]
Length=160

 Score =   297 bits (761),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIF GKKLEDIVPSSHNCDVPHVNRT+YQLIDISEDGFVSLLTE+GNTKDDLRLPT
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDVPHVNRTEYQLIDISEDGFVSLLTENGNTKDDLRLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            D+NLL QIK GFGEGKDLVV+VMSAMGEEQICALK
Sbjct  121  DDNLLGQIKAGFGEGKDLVVTVMSAMGEEQICALK  155



>ref|XP_010552563.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Tarenaya hassleriana]
Length=160

 Score =   297 bits (761),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNGHIVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT+SG+TKDDLRLPTD
Sbjct  61   VAIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDSGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL QI DGF EGKDL+VSVMSAMGEEQIC LK
Sbjct  121  ESLLKQITDGFNEGKDLIVSVMSAMGEEQICGLK  154



>gb|KJB38697.1| hypothetical protein B456_006G267400 [Gossypium raimondii]
Length=159

 Score =   297 bits (761),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT+SG+TKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDSGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL QIK+GF +GKDLVVSVMSAMGEEQICALK
Sbjct  121  ENLLKQIKEGFADGKDLVVSVMSAMGEEQICALK  154



>gb|ABC70326.1| eukaryotic translation initiation factor eIF5A [Rosa chinensis]
Length=157

 Score =   297 bits (760),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LLTQ+KDGF EGKDLVV+VMSAMGEE  CALK
Sbjct  121  DALLTQLKDGFAEGKDLVVTVMSAMGEEPNCALK  154



>ref|XP_008790089.1| PREDICTED: eukaryotic translation initiation factor 5A-2 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008790090.1| PREDICTED: eukaryotic translation initiation factor 5A-2 isoform 
X1 [Phoenix dactylifera]
Length=159

 Score =   297 bits (760),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG++VIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYLVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVP VNRTDYQLIDISEDGFVSLLT++GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPDVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  ESLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_009780915.1| PREDICTED: eukaryotic translation initiation factor 5A-3 [Nicotiana 
sylvestris]
 gb|AIL30515.1| eukaryotic translation initiation factor 5A-2 [Nicotiana tabacum]
Length=160

 Score =   297 bits (760),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL Q+KDGF EGKDLVVSVMSAMGEEQI A+K
Sbjct  121  EALLKQVKDGFQEGKDLVVSVMSAMGEEQINAVK  154



>gb|EEE67525.1| hypothetical protein OsJ_24987 [Oryza sativa Japonica Group]
Length=173

 Score =   297 bits (761),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 150/156 (96%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   AMSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKC  268
             MSD EEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKC
Sbjct  13   GMSDSEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKC  72

Query  269  HFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLP  448
            HFVAIDIF GKKLEDIVPSSHNCDVPHVNRT+YQLIDISEDGFVSLLTESGNTKDDLRLP
Sbjct  73   HFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTEYQLIDISEDGFVSLLTESGNTKDDLRLP  132

Query  449  TDENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            TD++LL QIK GFGEGKDLVV+VMSAMGEEQICALK
Sbjct  133  TDDSLLGQIKTGFGEGKDLVVTVMSAMGEEQICALK  168



>gb|AIC33055.1| translational initiation factor eIF-5a [Panax ginseng]
Length=159

 Score =   297 bits (760),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKT+PQQAGTIRKNG+IVIK R CKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTFPQQAGTIRKNGYIVIKGRACKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT+SG+TKDDL+LPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDSGSTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DALLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>gb|AIX10770.1| eukaryotic translation initiation factor [Panax notoginseng]
Length=159

 Score =   297 bits (760),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+I IKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYINIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVVSVMSAMGEEQI ALK
Sbjct  121  ENLLSQIKDGFAEGKDLVVSVMSAMGEEQINALK  154



>ref|XP_010908239.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Elaeis guineensis]
Length=159

 Score =   297 bits (760),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAID+FT KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLT+SGNTKDDLRLPTD
Sbjct  61   VAIDVFTAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTDSGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL QIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  ETLLAQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>ref|NP_001060174.1| Os07g0597000 [Oryza sativa Japonica Group]
 gb|AAC67555.1| translation initiation factor 5A [Oryza sativa Japonica Group]
 dbj|BAC55704.1| translation initiation factor 5A [Oryza sativa Japonica Group]
 dbj|BAF22088.1| Os07g0597000 [Oryza sativa Japonica Group]
 dbj|BAG88227.1| unnamed protein product [Oryza sativa Japonica Group]
Length=160

 Score =   297 bits (760),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIF GKKLEDIVPSSHNCDVPHVNRT+YQLIDISEDGFVSLLTESGNTKDDLRLPT
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDVPHVNRTEYQLIDISEDGFVSLLTESGNTKDDLRLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            D++LL QIK GFGEGKDLVV+VMSAMGEEQICALK
Sbjct  121  DDSLLGQIKTGFGEGKDLVVTVMSAMGEEQICALK  155



>gb|KDP41255.1| hypothetical protein JCGZ_15662 [Jatropha curcas]
Length=159

 Score =   296 bits (759),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNC+VPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCEVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLLTQIKDGF +GKDLVV+VMS+MGEEQICALK
Sbjct  121  ENLLTQIKDGFADGKDLVVTVMSSMGEEQICALK  154



>ref|XP_010551407.1| PREDICTED: eukaryotic translation initiation factor 5A [Tarenaya 
hassleriana]
Length=160

 Score =   296 bits (759),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLT+SG+TKDDLRLPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTDSGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL QIKDGF EGKDL+VSVMSAMGEEQIC LK
Sbjct  121  ESLLKQIKDGFEEGKDLIVSVMSAMGEEQICGLK  154



>ref|XP_002273265.1| PREDICTED: eukaryotic translation initiation factor 5A [Vitis 
vinifera]
 ref|XP_003635375.2| PREDICTED: eukaryotic translation initiation factor 5A-like [Vitis 
vinifera]
 emb|CAN70753.1| hypothetical protein VITISV_014697 [Vitis vinifera]
 emb|CBI40934.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   296 bits (758),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH F+SKADAGASKTYPQQAG IRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFDSKADAGASKTYPQQAGAIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLL+QIKDGF +GKDLVV+VMSAMGEEQICALK
Sbjct  121  DNLLSQIKDGFADGKDLVVTVMSAMGEEQICALK  154



>gb|EYU35322.1| hypothetical protein MIMGU_mgv1a015345mg [Erythranthe guttata]
Length=160

 Score =   296 bits (758),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRK G+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKGGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDL+LPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LL+QIK GF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DSLLSQIKGGFEEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_011033410.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Populus 
euphratica]
Length=171

 Score =   296 bits (759),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRVDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIKDGFGEGKDLVVSVMSAMGEEQ   ++
Sbjct  121  DNLLTQIKDGFGEGKDLVVSVMSAMGEEQFGLVR  154



>gb|AFK38403.1| unknown [Lotus japonicus]
Length=159

 Score =   296 bits (758),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRK+G+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKSGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDI+EDGF+SLLTE+GNTKDDL+LPTD
Sbjct  61   VAIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDIAEDGFLSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL+QIKDGF EGKDLV+SVMSAMGEEQICALK
Sbjct  121  EALLSQIKDGFAEGKDLVLSVMSAMGEEQICALK  154



>ref|NP_001275165.1| eukaryotic translation initiation factor 5A-3 [Solanum tuberosum]
 gb|AFW90607.1| eukaryotic initiation factor 5A3-like protein [Solanum tuberosum]
Length=160

 Score =   296 bits (758),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL Q+KDG  EGKDLVVSVMSAMGEEQI A+K
Sbjct  121  ESLLKQVKDGLQEGKDLVVSVMSAMGEEQINAIK  154



>ref|XP_010527943.1| PREDICTED: eukaryotic translation initiation factor 5A-1/2 [Tarenaya 
hassleriana]
Length=160

 Score =   296 bits (758),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL QIK GF EGKDLVVSVMSAMGEEQIC LK
Sbjct  121  ESLLNQIKSGFEEGKDLVVSVMSAMGEEQICGLK  154



>ref|XP_011015835.1| PREDICTED: mitotic checkpoint protein BUB3.3 [Populus euphratica]
Length=527

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 159/185 (86%), Gaps = 15/185 (8%)
 Frame = +2

Query  2    RFFSPFSVAALRTHLQ*reksekkrkerrGAMSDEEHQFESKADAGASKTYPQQAGTIRK  181
            R+F  F +A L +                 AMSDEE  FESKADAGASKTYPQQAGTIRK
Sbjct  353  RYFVCFVIATLLS---------------IAAMSDEEQHFESKADAGASKTYPQQAGTIRK  397

Query  182  NGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRT  361
            NG+IVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIF GKKLEDIVPSSHNCDVPHV RT
Sbjct  398  NGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVTRT  457

Query  362  DYQLIDISEDGFVSLLTESGNTKDDLRLPTDENLLTQIKDGFGEGKDLVVSVMSAMGEEQ  541
            DYQLIDISEDGFVSLLTE+GNTKDDLRLPTDE+LLTQIKDGFGEGKDLVV+VMS+MGEEQ
Sbjct  458  DYQLIDISEDGFVSLLTENGNTKDDLRLPTDESLLTQIKDGFGEGKDLVVTVMSSMGEEQ  517

Query  542  ICALK  556
            ICALK
Sbjct  518  ICALK  522



>ref|XP_002529374.1| initiation factor 5a, putative [Ricinus communis]
 gb|EEF32970.1| initiation factor 5a, putative [Ricinus communis]
Length=160

 Score =   296 bits (757),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRP KVV+VSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPTKVVDVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+G+TKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGSTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVVSVMS+MGEEQICALK
Sbjct  121  ENLLSQIKDGFAEGKDLVVSVMSSMGEEQICALK  154



>ref|XP_006477598.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Citrus sinensis]
Length=160

 Score =   296 bits (757),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF+GKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFSGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQ+KDGF EGKDLV++VMS+MGEEQICALK
Sbjct  121  ETLLTQLKDGFAEGKDLVLTVMSSMGEEQICALK  154



>gb|KHN42820.1| Eukaryotic translation initiation factor 5A-2 [Glycine soja]
Length=160

 Score =   296 bits (757),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH F+S+ADAGASKTYPQQAGTIRKNG+IVIK+RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFDSQADAGASKTYPQQAGTIRKNGYIVIKSRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDL+LPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL QIKDGF EGKDLVVSVMSAMGEEQIC+LK
Sbjct  121  EALLAQIKDGFSEGKDLVVSVMSAMGEEQICSLK  154



>gb|ACJ84199.1| unknown [Medicago truncatula]
Length=160

 Score =   296 bits (757),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRP KVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPRKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDL+LPTD
Sbjct  61   VAIDIFTSKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIK+GF EGKDLVVSVMS+MGEEQI ALK
Sbjct  121  DNLLTQIKEGFAEGKDLVVSVMSSMGEEQINALK  154



>ref|XP_009617160.1| PREDICTED: eukaryotic translation initiation factor 5A-3 [Nicotiana 
tomentosiformis]
Length=160

 Score =   296 bits (757),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL Q+KDGF EGKDLV+SVMSAMGEEQI A+K
Sbjct  121  EALLKQVKDGFQEGKDLVLSVMSAMGEEQINAVK  154



>ref|XP_009617887.1| PREDICTED: eukaryotic translation initiation factor 5A-1/2 [Nicotiana 
tomentosiformis]
Length=160

 Score =   295 bits (756),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL Q+K GF EGKDLV+SVMSAMGEEQI A+K
Sbjct  121  ENLLNQVKGGFEEGKDLVLSVMSAMGEEQIAAVK  154



>ref|XP_002514712.1| initiation factor 5a, putative [Ricinus communis]
 gb|EEF47818.1| initiation factor 5a, putative [Ricinus communis]
Length=160

 Score =   295 bits (756),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNGHIVIKNRPCKVVEVS SKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGHIVIKNRPCKVVEVSVSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VA+DIF  KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLT++GNTKDDLRLPTD
Sbjct  61   VAVDIFNSKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVV+VM +MGEEQICALK
Sbjct  121  ENLLSQIKDGFAEGKDLVVTVMCSMGEEQICALK  154



>ref|XP_004499516.1| PREDICTED: eukaryotic translation initiation factor 5A-4-like 
[Cicer arietinum]
Length=160

 Score =   295 bits (756),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+G+TKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGSTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGF EGKDLVVSVMSAMGEEQI ALK
Sbjct  121  DSLLTQIKDGFAEGKDLVVSVMSAMGEEQINALK  154



>ref|XP_010523479.1| PREDICTED: eukaryotic translation initiation factor 5A-4-like 
[Tarenaya hassleriana]
Length=160

 Score =   295 bits (756),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL+QIK GF +GKDLVVSVMSAMGEEQIC LK
Sbjct  121  ESLLSQIKSGFDDGKDLVVSVMSAMGEEQICGLK  154



>ref|XP_008236039.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Prunus mume]
Length=160

 Score =   295 bits (756),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
             AIDIF GKKLEDIVPSSHNC VPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   FAIDIFNGKKLEDIVPSSHNCGVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL+QIKDGF +GKDLV  VMSAMGEEQICALK
Sbjct  121  ESLLSQIKDGFADGKDLVAIVMSAMGEEQICALK  154



>ref|XP_004490179.1| PREDICTED: mitotic checkpoint protein bub3-like [Cicer arietinum]
Length=490

 Score =   306 bits (785),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  332  MSDEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  391

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESG TKDDL+LP+D
Sbjct  392  VGIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGGTKDDLKLPSD  451

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL+QIKDGFGEGKDL+VSVMSAMGEEQIC LK
Sbjct  452  ESLLSQIKDGFGEGKDLIVSVMSAMGEEQICGLK  485



>ref|XP_008790673.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Phoenix dactylifera]
Length=159

 Score =   295 bits (755),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V ID+FT KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDVFTAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL QIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  ETLLAQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>gb|AAR83875.1| mary storys protein [Capsicum annuum]
 gb|AAS48586.1| eukaryotic initiation factor 5A2 [Capsicum annuum]
Length=159

 Score =   295 bits (755),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LL+Q+K GF EGKDLV+SVMSAMGEEQICA+K
Sbjct  121  DTLLSQVKGGFEEGKDLVLSVMSAMGEEQICAVK  154



>ref|NP_001235981.1| uncharacterized protein LOC100305991 [Glycine max]
 gb|ACU13949.1| unknown [Glycine max]
Length=160

 Score =   295 bits (755),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGT RKNG+IVIK RPCKVVEVSTSKTGKHG AKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTTRKNGYIVIKGRPCKVVEVSTSKTGKHGRAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDI+EDGF+SLLTE+GNTKDDL+LPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDIAEDGFLSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  ESLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  154



>ref|XP_008446407.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Cucumis melo]
Length=159

 Score =   295 bits (754),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHV+RTDYQLIDISEDGF+SLLT+SG+TKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVSRTDYQLIDISEDGFISLLTDSGSTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLL+QIKDGF EGKDL+V+VMS+MGEEQICALK
Sbjct  121  DNLLSQIKDGFAEGKDLIVTVMSSMGEEQICALK  154



>gb|EMS51734.1| Eukaryotic translation initiation factor 5A-4 [Triticum urartu]
Length=233

 Score =   297 bits (761),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEHQFESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIFTGKKLEDIVPSSHNCDVPHVNRT+YQLIDISEDGFVSLLT++GNTKDDL+LPT
Sbjct  61   FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTEYQLIDISEDGFVSLLTDNGNTKDDLKLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            DE LL QIKDGF EGKDLVVSVMSAMGEEQI ALK
Sbjct  121  DETLLGQIKDGFAEGKDLVVSVMSAMGEEQINALK  155



>ref|XP_010037186.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Eucalyptus grandis]
 gb|KCW48866.1| hypothetical protein EUGRSUZ_K02493 [Eucalyptus grandis]
Length=159

 Score =   295 bits (754),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FE+K DAGASKT+PQQAGTIRK+G+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFEAKGDAGASKTFPQQAGTIRKSGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLL+QIKDGF +GKDLVVSVMS+MGEEQICALK
Sbjct  121  DNLLSQIKDGFADGKDLVVSVMSSMGEEQICALK  154



>ref|XP_002285505.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Vitis 
vinifera]
 emb|CAN62058.1| hypothetical protein VITISV_020593 [Vitis vinifera]
 emb|CBI21134.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   294 bits (753),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAG IRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGAIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLT+SG TKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTDSGGTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NLLTQIKDGF EGKDLVV+VM+AMGEEQICALK
Sbjct  121  DNLLTQIKDGFAEGKDLVVTVMTAMGEEQICALK  154



>ref|NP_001236395.1| uncharacterized protein LOC100305510 [Glycine max]
 gb|ACU13213.1| unknown [Glycine max]
Length=160

 Score =   294 bits (753),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH F+S+ADAGASKTYPQQAGTIRKNG+IVIK+RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFDSQADAGASKTYPQQAGTIRKNGYIVIKSRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
             AIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDL+LPTD
Sbjct  61   AAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL QIKDGF EGKDLVVSVMSAMGEEQIC+LK
Sbjct  121  EALLAQIKDGFSEGKDLVVSVMSAMGEEQICSLK  154



>ref|XP_006574334.1| PREDICTED: uncharacterized LOC100306157 isoform X1 [Glycine max]
Length=492

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  334  MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  393

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLTE+G TKDDLRLPTD
Sbjct  394  VAIDIFTGKKLEDIVPSSHNCDVPHVNRIDYQLIDISEDGFVSLLTETGGTKDDLRLPTD  453

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVVSVMS+MGEEQICALK
Sbjct  454  ENLLSQIKDGFAEGKDLVVSVMSSMGEEQICALK  487



>ref|XP_009390841.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Musa acuminata subsp. malaccensis]
 gb|ACP31199.1| eukaryotic initiation factor 5A2 [Musa hybrid cultivar]
Length=159

 Score =   294 bits (752),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAG IRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGAIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAID+F  KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLL E+GNTKDDLRLPTD
Sbjct  61   VAIDVFNAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLMENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL QIKDGF +GKDLVV+VMSAMGEEQICALK
Sbjct  121  ETLLAQIKDGFADGKDLVVTVMSAMGEEQICALK  154



>ref|XP_010936500.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Elaeis 
guineensis]
 ref|XP_010936501.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Elaeis 
guineensis]
 ref|XP_010936502.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Elaeis 
guineensis]
Length=159

 Score =   293 bits (751),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAG IRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGAIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V ID+F GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDVFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQIKDGF EGKDLVV+VMSAMGEEQIC+LK
Sbjct  121  ETLLTQIKDGFAEGKDLVVTVMSAMGEEQICSLK  154



>ref|XP_004135157.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Cucumis sativus]
 ref|XP_004168036.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Cucumis sativus]
 gb|KGN51957.1| hypothetical protein Csa_5G606480 [Cucumis sativus]
Length=159

 Score =   293 bits (751),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAG IRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGAIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHV+RTDYQLIDISEDGF+SLLT+SGNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVSRTDYQLIDISEDGFISLLTDSGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LLTQIKDGF EGKDL+V+VMS+MGEEQICALK
Sbjct  121  DGLLTQIKDGFAEGKDLIVTVMSSMGEEQICALK  154



>ref|XP_010106630.1| Eukaryotic translation initiation factor 5A-2 [Morus notabilis]
 gb|EXC11009.1| Eukaryotic translation initiation factor 5A-2 [Morus notabilis]
Length=160

 Score =   293 bits (751),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 149/155 (96%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            M+D EEH FESKADAGASKTYPQQAGT+RKNG+IVIK RPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MTDSEEHHFESKADAGASKTYPQQAGTVRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FV IDIFTGKK +DIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPT
Sbjct  61   FVGIDIFTGKKYDDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            D++LLTQIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  121  DDSLLTQIKDGFAEGKDLVVSVMSAMGEEQICALK  155



>sp|Q945F4.1|IF5A2_MEDSA RecName: Full=Eukaryotic translation initiation factor 5A-2; 
Short=eIF-5A-2 [Medicago sativa]
 gb|AAL10404.1|AF416338_1 eukaryotic translation initiation factor 5A-2 [Medicago sativa]
 gb|ACJ83948.1| unknown [Medicago truncatula]
 gb|ACJ86192.1| unknown [Medicago truncatula]
 gb|AFK35249.1| unknown [Medicago truncatula]
 gb|KEH32624.1| eukaryotic translation initiation factor 5A [Medicago truncatula]
Length=159

 Score =   293 bits (750),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FE  ADAGASKTYPQQAGTIRKNG+IVIK+RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFEPAADAGASKTYPQQAGTIRKNGYIVIKSRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++G+TKDDL+LPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGSTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGF +GKDLVVSVMSAMGEEQICALK
Sbjct  121  DSLLTQIKDGFADGKDLVVSVMSAMGEEQICALK  154



>ref|XP_009795107.1| PREDICTED: eukaryotic translation initiation factor 5A-1/2 [Nicotiana 
sylvestris]
Length=160

 Score =   293 bits (751),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL+Q+K GF EGKDLV+SVMSAMGEEQI A+K
Sbjct  121  EALLSQVKGGFEEGKDLVLSVMSAMGEEQIAAVK  154



>gb|EYU28817.1| hypothetical protein MIMGU_mgv1a015401mg [Erythranthe guttata]
Length=159

 Score =   293 bits (750),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++G+TKDDLRLPTD
Sbjct  61   VAIDIFTSKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGSTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LLTQIK+GF EGKDLVVSVMSAMGEEQI ALK
Sbjct  121  DALLTQIKEGFAEGKDLVVSVMSAMGEEQINALK  154



>ref|XP_004138702.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Cucumis sativus]
 ref|XP_004169098.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Cucumis sativus]
 gb|KGN62994.1| hypothetical protein Csa_2G382670 [Cucumis sativus]
Length=160

 Score =   293 bits (750),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKK+EDIVPSSHNCDVP V RTDYQLIDISEDGFVSLLT++G+TKDDLRLPTD
Sbjct  61   VAIDIFTGKKVEDIVPSSHNCDVPEVTRTDYQLIDISEDGFVSLLTDNGSTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LLTQIKDGF EGKDLVVSVMSAMGEEQIC LK
Sbjct  121  ESLLTQIKDGFAEGKDLVVSVMSAMGEEQICGLK  154



>ref|XP_011075552.1| PREDICTED: mitotic checkpoint protein BUB3.3-like [Sesamum indicum]
Length=503

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  345  MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  404

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDLRLPTD
Sbjct  405  VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTD  464

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVVSVMSAMGEEQICALK
Sbjct  465  ENLLSQIKDGFAEGKDLVVSVMSAMGEEQICALK  498



>ref|XP_008799658.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Phoenix dactylifera]
Length=159

 Score =   293 bits (750),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFES+ADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESQADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF  KKLEDIVPSSHNCD PHV RTDYQLIDISEDGFVSLL E+GNTKDDLRLPTD
Sbjct  61   VAIDIFNSKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLMENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL QIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  ETLLAQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>ref|XP_010938815.1| PREDICTED: eukaryotic translation initiation factor 5A [Elaeis 
guineensis]
 ref|XP_010938822.1| PREDICTED: eukaryotic translation initiation factor 5A [Elaeis 
guineensis]
Length=159

 Score =   293 bits (749),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVP V RTDYQLIDISEDGF+SLLTESGNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPDVTRTDYQLIDISEDGFLSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL+QIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  EALLSQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>ref|XP_004507734.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Cicer arietinum]
Length=160

 Score =   293 bits (749),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH F+S+ADAGASKTYPQQAGTIRKNG+IVIK+RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFDSQADAGASKTYPQQAGTIRKNGYIVIKSRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++G+TKDDL+LPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGSTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LLTQIK+GF EGKDLVVSVMSAMGEEQIC+LK
Sbjct  121  DALLTQIKEGFAEGKDLVVSVMSAMGEEQICSLK  154



>ref|XP_010942095.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Elaeis 
guineensis]
Length=159

 Score =   293 bits (749),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FES+ADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESQADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF  KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTESGNTKDDL+LPTD
Sbjct  61   VAIDIFNSKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTESGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL QIKDGF EGKDLVV+VMSAMGEEQIC+LK
Sbjct  121  ETLLAQIKDGFAEGKDLVVTVMSAMGEEQICSLK  154



>ref|NP_001234715.1| eukaryotic translation initiation factor 5A-4 [Solanum lycopersicum]
 sp|Q9AXQ3.1|IF5A4_SOLLC RecName: Full=Eukaryotic translation initiation factor 5A-4; 
Short=eIF-5A-4 [Solanum lycopersicum]
 gb|AAG53650.1|AF296086_1 eukaryotic translation initiation factor 5A-4 [Solanum lycopersicum]
Length=160

 Score =   292 bits (748),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF  KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LL Q+K GF EGKDLV+SVMSAMGEEQICA+K
Sbjct  121  DTLLNQVKGGFEEGKDLVLSVMSAMGEEQICAVK  154



>ref|XP_008787088.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Phoenix dactylifera]
 ref|XP_008787089.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Phoenix dactylifera]
 ref|XP_008787090.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Phoenix dactylifera]
Length=159

 Score =   292 bits (748),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGAS+T+PQQAGTIRKNG++VIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASRTFPQQAGTIRKNGYLVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLT++G+TKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTDNGSTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LLTQIKDGF EGKDLVVSVMS+MGEEQIC+LK
Sbjct  121  ESLLTQIKDGFAEGKDLVVSVMSSMGEEQICSLK  154



>ref|XP_001773059.1| predicted protein [Physcomitrella patens]
 gb|EDQ62099.1| predicted protein [Physcomitrella patens]
Length=161

 Score =   292 bits (748),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD+EHQFESKADAGASKTYPQQAGTIRK  H+VIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDEHQFESKADAGASKTYPQQAGTIRKGAHLVIKQRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFTGKKLEDIVPSSHNCDVPHV+R+DYQLIDISEDGFVSLLTE+G TKDDLRLPTD
Sbjct  61   VAIDIFTGKKLEDIVPSSHNCDVPHVSRSDYQLIDISEDGFVSLLTENGVTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQI+DGF EGKDLVV+VMSAMGEEQI ALK
Sbjct  121  EGLLTQIRDGFAEGKDLVVTVMSAMGEEQIAALK  154



>ref|XP_010258729.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Nelumbo 
nucifera]
Length=159

 Score =   292 bits (748),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDE+H FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEDHDFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF  KKLEDIVPSSHNCDVPHV+RTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD
Sbjct  61   VGIDIFNAKKLEDIVPSSHNCDVPHVSRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL  IK+GF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  ETLLASIKEGFAEGKDLVVTVMSAMGEEQICALK  154



>ref|XP_008780963.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
isoform X1 [Phoenix dactylifera]
Length=159

 Score =   292 bits (747),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAG IRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGAIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFT KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFTAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL+QIKDGF EGKDLVV+VM AMGEEQICALK
Sbjct  121  ESLLSQIKDGFAEGKDLVVTVMCAMGEEQICALK  154



>gb|ABF98987.1| Eukaryotic translation initiation factor 5A-2, putative, expressed 
[Oryza sativa Japonica Group]
Length=162

 Score =   292 bits (747),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 148/156 (95%), Gaps = 2/156 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKV-VEVSTSKTGKHGHAKC  268
            MSD EEH FESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKV + VSTSKTGKHGHAKC
Sbjct  1    MSDSEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVWIPVSTSKTGKHGHAKC  60

Query  269  HFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLP  448
            HFVAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESG TKDDLRLP
Sbjct  61   HFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGGTKDDLRLP  120

Query  449  TDENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +DE LLTQIKDGF EGKDL+V+VMSAMGEEQICALK
Sbjct  121  SDEALLTQIKDGFAEGKDLIVTVMSAMGEEQICALK  156



>ref|NP_001275082.1| eukaryotic translation initiation factor 5A-1/2 [Solanum tuberosum]
 sp|P56333.1|IF5A1_SOLTU RecName: Full=Eukaryotic translation initiation factor 5A-1/2; 
Short=eIF-5A-1/2; AltName: Full=eIF-4D [Solanum tuberosum]
 dbj|BAA20876.1| eukaryotic initiation factor 5A2 [Solanum tuberosum]
 dbj|BAA20880.1| eukaryotic initiation factor 5A1 [Solanum tuberosum]
Length=160

 Score =   292 bits (747),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRK+G+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKSGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LL Q+K GF EGKDLV+SVMSAMGEEQICA+K
Sbjct  121  DALLNQVKGGFEEGKDLVLSVMSAMGEEQICAVK  154



>gb|AFK42218.1| unknown [Lotus japonicus]
Length=160

 Score =   291 bits (746),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+I IKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYINIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTESG TKDDL+LPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTESGGTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LLTQIK+GF EGKDLVVSVMSAMGEEQI ALK
Sbjct  121  DALLTQIKEGFAEGKDLVVSVMSAMGEEQINALK  154



>ref|XP_010086858.1| Eukaryotic translation initiation factor 5A [Morus notabilis]
 gb|EXB24282.1| Eukaryotic translation initiation factor 5A [Morus notabilis]
Length=258

 Score =   295 bits (755),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH F++KADAGASKTYPQQAG IRKNG+IVIK+RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFDAKADAGASKTYPQQAGAIRKNGYIVIKSRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LL+QIKDGF EGK+LVVSVMSAMGEEQIC++K
Sbjct  121  DSLLSQIKDGFAEGKELVVSVMSAMGEEQICSVK  154



>ref|XP_010683086.1| PREDICTED: eukaryotic translation initiation factor 5A [Beta 
vulgaris subsp. vulgaris]
Length=159

 Score =   291 bits (746),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKC+F
Sbjct  1    MSDEEHQFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCNF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLT+SG+TKDDL+LPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTDSGDTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL Q+KDGF EGKDL+VSVM+AMGEEQIC LK
Sbjct  121  EALLKQLKDGFAEGKDLIVSVMNAMGEEQICGLK  154



>ref|XP_010030379.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Eucalyptus 
grandis]
 gb|KCW83673.1| hypothetical protein EUGRSUZ_B00553 [Eucalyptus grandis]
Length=160

 Score =   291 bits (745),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAG IRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGAIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF  KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+G TKDDLRLPTD
Sbjct  61   VGIDIFNNKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTETGGTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL QIKDGF EGKDLVV+VMSAMGEEQI  LK
Sbjct  121  ETLLAQIKDGFAEGKDLVVTVMSAMGEEQISTLK  154



>ref|XP_008445267.1| PREDICTED: eukaryotic translation initiation factor 5A-4-like 
[Cucumis melo]
Length=160

 Score =   291 bits (744),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVP V RTDYQLIDISEDGFVSLLT++G+TKDDLRLPTD
Sbjct  61   VAIDIFTAKKLEDIVPSSHNCDVPEVTRTDYQLIDISEDGFVSLLTDNGSTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL QIKDGF EGKDLVVSVMSAMGEEQIC LK
Sbjct  121  ESLLAQIKDGFAEGKDLVVSVMSAMGEEQICGLK  154



>ref|XP_010939062.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Elaeis 
guineensis]
 ref|XP_010939063.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Elaeis 
guineensis]
Length=159

 Score =   291 bits (744),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIK R CKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRACKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVP VNRT+YQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPDVNRTEYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  EPLLTQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>gb|ABK22126.1| unknown [Picea sitchensis]
 gb|ABK26207.1| unknown [Picea sitchensis]
 gb|ABK26338.1| unknown [Picea sitchensis]
 gb|ABR17244.1| unknown [Picea sitchensis]
 gb|ACN40133.1| unknown [Picea sitchensis]
 gb|ACN40553.1| unknown [Picea sitchensis]
Length=159

 Score =   291 bits (744),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDE++ FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEDNHFESKADAGASKTFPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHV RTD+QLIDISEDGFVSLL ++GNTKDDLRLP+D
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVTRTDFQLIDISEDGFVSLLADNGNTKDDLRLPSD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQIKDGFGEGKDLVV+VMSAMGEEQICALK
Sbjct  121  EQLLTQIKDGFGEGKDLVVTVMSAMGEEQICALK  154



>ref|XP_010554300.1| PREDICTED: eukaryotic translation initiation factor 5A-1/2-like 
[Tarenaya hassleriana]
Length=160

 Score =   291 bits (744),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEE  FESKADAGASKTYPQQAGTIRKNG+IV K RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEQHFESKADAGASKTYPQQAGTIRKNGYIVAKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKL++IVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++GNTKDDLRLPTD
Sbjct  61   VAIDIFNGKKLDEIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL QIK GF EGKDLVVSVMSAMGEEQIC LK
Sbjct  121  ENLLNQIKSGFEEGKDLVVSVMSAMGEEQICGLK  154



>gb|ABD66513.1| eukaryotic translation initiation factor 5A [Gymnadenia conopsea]
Length=159

 Score =   291 bits (744),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESK DAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKGDAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDIS DGF+SLLTE+GNTKDDLRLPT+
Sbjct  61   VAIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISSDGFLSLLTENGNTKDDLRLPTE  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LL+QIK+GFGEGKDLV+SVMSAMGEEQIC +K
Sbjct  121  DALLSQIKEGFGEGKDLVLSVMSAMGEEQICGVK  154



>ref|XP_009393847.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
[Musa acuminata subsp. malaccensis]
Length=159

 Score =   290 bits (743),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF  KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+LL  IKDGF EGKDLVVSVM +MGEEQICALK
Sbjct  121  ESLLAPIKDGFAEGKDLVVSVMCSMGEEQICALK  154



>ref|XP_010683083.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Beta 
vulgaris subsp. vulgaris]
Length=159

 Score =   290 bits (742),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKC+F
Sbjct  1    MSDEEHQFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCNF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHN DVPHVNRTDYQLIDISEDGFVSLLT+SG+TKDDL+LP+D
Sbjct  61   VGIDIFTGKKLEDIVPSSHNSDVPHVNRTDYQLIDISEDGFVSLLTDSGDTKDDLKLPSD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL Q+KDGF EGKDL+VSVM+AMGEEQIC LK
Sbjct  121  EALLKQLKDGFAEGKDLIVSVMNAMGEEQICGLK  154



>ref|XP_002512132.1| initiation factor 5a, putative [Ricinus communis]
 gb|EEF50801.1| initiation factor 5a, putative [Ricinus communis]
Length=509

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  351  MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  410

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF  KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  411  VGIDIFNAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  470

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF EGKDLVV+VMS+MGEEQICALK
Sbjct  471  ENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALK  504



>ref|XP_011027917.1| PREDICTED: mitotic checkpoint protein BUB3.3-like [Populus euphratica]
Length=522

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  89   GAMSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKC  268
             AMSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKC
Sbjct  362  AAMSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKC  421

Query  269  HFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLP  448
            HFV IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLP
Sbjct  422  HFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLP  481

Query  449  TDENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            TD++LLTQIKDGFGEGKDLVV+VMS+MGEEQI ALK
Sbjct  482  TDDSLLTQIKDGFGEGKDLVVTVMSSMGEEQIGALK  517



>gb|AFK35808.1| unknown [Lotus japonicus]
Length=160

 Score =   290 bits (741),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+I IKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYINIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTESG TKDDL+LPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTESGGTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LLTQIK+GF EGKDLVVSVM AMGEEQI ALK
Sbjct  121  DALLTQIKEGFAEGKDLVVSVMPAMGEEQINALK  154



>emb|CDP10227.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD+EH FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDEHHFESKADAGASKTFPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF+GKKLEDIVPSSHNCDVPHVNR+DYQLIDISEDGFVSLLTESG TKDDLRLPTD
Sbjct  61   VGIDIFSGKKLEDIVPSSHNCDVPHVNRSDYQLIDISEDGFVSLLTESGGTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LL QIK GF EGKDLVVSVMSAMGEEQICA+K
Sbjct  121  DTLLAQIKGGFEEGKDLVVSVMSAMGEEQICAVK  154



>ref|XP_004981693.1| PREDICTED: eukaryotic translation initiation factor 5A-1/2-like 
[Setaria italica]
Length=160

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++G TKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGGTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL+QI+ GF EGKDL+VSV SAMGEEQIC LK
Sbjct  121  EALLSQIRAGFDEGKDLIVSVQSAMGEEQICGLK  154



>ref|XP_010236032.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Brachypodium 
distachyon]
 ref|XP_010236034.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Brachypodium 
distachyon]
Length=160

 Score =   289 bits (739),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 148/155 (95%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEHQFESKADAGASKTYP QAG IRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHQFESKADAGASKTYPMQAGAIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIF GKKLEDIVPSSHNCDVPHV+RT+YQLIDISEDG+VSLLT++GNTKDDL+LPT
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDVPHVDRTEYQLIDISEDGYVSLLTDNGNTKDDLKLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            DEN+L QI +GF EGKDLV++VMSAMGEEQICALK
Sbjct  121  DENILRQINEGFAEGKDLVLTVMSAMGEEQICALK  155



>gb|KCW64912.1| hypothetical protein EUGRSUZ_G02468 [Eucalyptus grandis]
Length=159

 Score =   289 bits (739),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGF+SLLTE+G+TKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFLSLLTENGSTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LL QIKDGF EGKDLVV+ M +MGEEQICALK
Sbjct  121  DALLGQIKDGFAEGKDLVVTAMCSMGEEQICALK  154



>gb|ABF98986.1| Eukaryotic translation initiation factor 5A-2, putative, expressed 
[Oryza sativa Japonica Group]
Length=162

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 147/156 (94%), Gaps = 2/156 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEH FESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQ-LIDISEDGFVSLLTESGNTKDDLRLP  448
            FVAIDIF GKKLEDIVPSSHNCDVPHVNRTDY  L+ ISEDGFVSLLTESG TKDDLRLP
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYHYLLIISEDGFVSLLTESGGTKDDLRLP  120

Query  449  TDENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +DE LLTQIKDGF EGKDL+V+VMSAMGEEQICALK
Sbjct  121  SDEALLTQIKDGFAEGKDLIVTVMSAMGEEQICALK  156



>gb|AGZ03629.1| eukaryotic translation initiation factor 5A [Pinus contorta]
Length=159

 Score =   288 bits (738),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD++HQFESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDDHQFESKADAGASKTFPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF+GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTESG TKDDL+LPTD
Sbjct  61   VGIDIFSGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTESGQTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL QIK GF EGKDLVV+VMSAMGEEQIC+LK
Sbjct  121  EQLLAQIKAGFDEGKDLVVTVMSAMGEEQICSLK  154



>gb|KDO59447.1| hypothetical protein CISIN_1g030552mg [Citrus sinensis]
Length=175

 Score =   289 bits (739),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 148/169 (88%), Gaps = 15/169 (9%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCK---------------VVEV  229
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIKNRPCK               VVEV
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKPQVFKFPSFSLHSKQVVEV  60

Query  230  STSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLL  409
            STSKTGKHGHAKCHFV IDIF GKKLEDIVPSSHNCD PHV RTDYQLIDISEDGFVSLL
Sbjct  61   STSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLL  120

Query  410  TESGNTKDDLRLPTDENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            TE+GNTKDDLRLPTDENLL+QIKDGF EGKDLVV+VMS+MGEEQICALK
Sbjct  121  TETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALK  169



>gb|AAF27938.1|AF225297_1 translation initiation factor 5A [Euphorbia esula]
Length=156

 Score =   288 bits (737),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  107  EHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAID  286
            E  FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHFV ID
Sbjct  2    EDHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHFVGID  61

Query  287  IFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTDENLL  466
            IF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTDE+LL
Sbjct  62   IFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDESLL  121

Query  467  TQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +QIKDGFG+GKDLVV+VMS+MGEEQICALK
Sbjct  122  SQIKDGFGDGKDLVVTVMSSMGEEQICALK  151



>ref|XP_009404766.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Musa 
acuminata subsp. malaccensis]
Length=159

 Score =   288 bits (737),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH F+SKADAGASKTYPQQAGTIRKNG+IVIK R CKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFDSKADAGASKTYPQQAGTIRKNGYIVIKGRACKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF  KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGF+SLLTE+GNTKDDL+LPTD
Sbjct  61   VGIDIFNNKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFLSLLTENGNTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL QIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  ETLLAQIKDGFAEGKDLVVTVMSAMGEEQICALK  154



>ref|XP_006438769.1| hypothetical protein CICLE_v10032956mg [Citrus clementina]
 ref|XP_006438770.1| hypothetical protein CICLE_v10032956mg [Citrus clementina]
 ref|XP_006483084.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
isoform X1 [Citrus sinensis]
 ref|XP_006483085.1| PREDICTED: eukaryotic translation initiation factor 5A-2-like 
isoform X2 [Citrus sinensis]
 gb|ESR52009.1| hypothetical protein CICLE_v10032956mg [Citrus clementina]
 gb|ESR52010.1| hypothetical protein CICLE_v10032956mg [Citrus clementina]
 gb|KDO83049.1| hypothetical protein CISIN_1g031432mg [Citrus sinensis]
 gb|KDO83050.1| hypothetical protein CISIN_1g031432mg [Citrus sinensis]
Length=159

 Score =   287 bits (734),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD
Sbjct  61   VGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ENLL+QIKDGF  GKDLVVSV  AMGEEQI ALK
Sbjct  121  ENLLSQIKDGFESGKDLVVSVQCAMGEEQINALK  154



>emb|CAH59406.1| eukaryotic translation initiation factor 5A-1 [Plantago major]
Length=159

 Score =   287 bits (734),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFE++ADAGASKT+PQQAGTIRKNG+I IKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFEAQADAGASKTFPQQAGTIRKNGYINIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLT++G+TKDDLRLPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRVDYQLIDISEDGFVSLLTDNGSTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + L TQIK+GF EGKDLVVSVMSAMGEEQI A+K
Sbjct  121  DALATQIKEGFAEGKDLVVSVMSAMGEEQINAIK  154



>gb|AAX92692.1| eukaryotic translation initiation factor 5A [Picea abies]
 gb|ABK21188.1| unknown [Picea sitchensis]
 gb|ABK22311.1| unknown [Picea sitchensis]
 gb|ABK22588.1| unknown [Picea sitchensis]
 gb|ABK26100.1| unknown [Picea sitchensis]
 gb|ABK26214.1| unknown [Picea sitchensis]
 gb|ACN40990.1| unknown [Picea sitchensis]
Length=159

 Score =   286 bits (733),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD++HQFESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDDHQFESKADAGASKTFPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF+GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTESG TKDDL+LPTD
Sbjct  61   VGIDIFSGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTESGQTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LL QIK GF EGKDLVV+VMSAMGEEQIC+LK
Sbjct  121  DQLLAQIKAGFDEGKDLVVTVMSAMGEEQICSLK  154



>ref|NP_001058746.1| Os07g0112800 [Oryza sativa Japonica Group]
 dbj|BAC16153.1| putative translation initiation factor 5A [Oryza sativa Japonica 
Group]
 dbj|BAC22294.1| putative translation initiation factor 5A [Oryza sativa Japonica 
Group]
 dbj|BAF20660.1| Os07g0112800 [Oryza sativa Japonica Group]
 gb|EAZ02542.1| hypothetical protein OsI_24652 [Oryza sativa Indica Group]
 gb|EAZ38468.1| hypothetical protein OsJ_22854 [Oryza sativa Japonica Group]
 dbj|BAG86631.1| unnamed protein product [Oryza sativa Japonica Group]
Length=162

 Score =   286 bits (732),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 148/156 (95%), Gaps = 2/156 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FV IDIF GKKLEDIVPSSHNCDVPHV+RTDYQLIDISEDGFVSLLTESGNTKDDLRLPT
Sbjct  61   FVGIDIFNGKKLEDIVPSSHNCDVPHVDRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  120

Query  452  DENLLTQIKDGFG-EGKDLVVSVMSAMGEEQICALK  556
            D+ L  QIK+GFG EGKD++++VMSAMGEEQICA+K
Sbjct  121  DDTLTNQIKNGFGEEGKDMILTVMSAMGEEQICAVK  156



>ref|NP_001105606.1| eukaryotic translation initiation factor 5A [Zea mays]
 ref|NP_001105550.1| eukaryotic translation initiation factor 5A [Zea mays]
 sp|P80639.2|IF5A_MAIZE RecName: Full=Eukaryotic translation initiation factor 5A; Short=eIF-5A; 
AltName: Full=eIF-4D [Zea mays]
 emb|CAA69225.1| translation initiation factor 5A [Zea mays]
 gb|AAB88614.1| translation initiation factor 5A [Zea mays]
 gb|ACG24700.1| eukaryotic translation initiation factor 5A [Zea mays]
 gb|ACG30843.1| eukaryotic translation initiation factor 5A [Zea mays]
 gb|ACG31086.1| eukaryotic translation initiation factor 5A [Zea mays]
 gb|ACG31525.1| eukaryotic translation initiation factor 5A [Zea mays]
 gb|ACG31967.1| eukaryotic translation initiation factor 5A [Zea mays]
 gb|ACG32433.1| eukaryotic translation initiation factor 5A [Zea mays]
 gb|ACR34848.1| unknown [Zea mays]
 gb|AEG78305.1| eukaryotic translation initiation factor 5A [Zea mays]
 tpg|DAA41314.1| TPA: elongation initiation factor5A [Zea mays]
 tpg|DAA63453.1| TPA: eukaryotic translation initiation factor 5A [Zea mays]
Length=160

 Score =   285 bits (728),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEH FESKADAGASKTYPQQAGT+RKNG IVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHHFESKADAGASKTYPQQAGTVRKNGFIVIKNRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIF GKKLEDIVPSSHNCD+PHVNRT+YQLIDISEDGFVSLLT  GNTKDDLRLPT
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDIPHVNRTEYQLIDISEDGFVSLLTSDGNTKDDLRLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            DE L+ QIK+GF  GKDLVV+V SAMGEEQICALK
Sbjct  121  DETLVAQIKEGFESGKDLVVTVQSAMGEEQICALK  155



>gb|EMT02502.1| Eukaryotic translation initiation factor 5A-4 [Aegilops tauschii]
Length=173

 Score =   285 bits (729),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 150/168 (89%), Gaps = 14/168 (8%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKV-------------VEVS  232
            MSD EEHQFESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKV             VEVS
Sbjct  1    MSDSEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVILDVPLKCLPCRVVEVS  60

Query  233  TSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT  412
            TSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRT+YQLIDISEDGFVSLLT
Sbjct  61   TSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTEYQLIDISEDGFVSLLT  120

Query  413  ESGNTKDDLRLPTDENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++GNTKDDL+LPTDE LL QIKDGF EGKDLVVSVMSAMGEEQI ALK
Sbjct  121  DNGNTKDDLKLPTDETLLGQIKDGFAEGKDLVVSVMSAMGEEQINALK  168



>ref|NP_001131634.1| eukaryotic translation initiation factor 5A-1/2 [Zea mays]
 gb|ACF80134.1| unknown [Zea mays]
 gb|ACG32474.1| eukaryotic translation initiation factor 5A-1/2 [Zea mays]
 tpg|DAA42662.1| TPA: eukaryotic translation initiation factor 5A-1/2 [Zea mays]
Length=160

 Score =   285 bits (728),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHQFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V ID+FTGKKLEDIVPSSHNCDVPHV+RT+YQLIDI+EDGFVSLLT+SGNTKDDLRLPTD
Sbjct  61   VGIDVFTGKKLEDIVPSSHNCDVPHVDRTEYQLIDITEDGFVSLLTDSGNTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E L  QIK G+ +GKDL+++VMS+MGEEQICA+K
Sbjct  121  EALEGQIKSGYDDGKDLLLTVMSSMGEEQICAVK  154



>ref|XP_010258422.1| PREDICTED: mitotic checkpoint protein BUB3.3-like [Nelumbo nucifera]
Length=564

 Score =   298 bits (763),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  92   AMSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            AMSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCH
Sbjct  405  AMSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCH  464

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FV IDIF  KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPT
Sbjct  465  FVGIDIFNAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPT  524

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            DE LLT IKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  525  DEQLLTSIKDGFAEGKDLVVTVMSAMGEEQICALK  559



>ref|XP_006844852.1| hypothetical protein AMTR_s00058p00098620 [Amborella trichopoda]
 gb|ERN06527.1| hypothetical protein AMTR_s00058p00098620 [Amborella trichopoda]
Length=159

 Score =   283 bits (725),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FESKAD+GASKTYPQQAGTIRKNG+IVIK R CKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFESKADSGASKTYPQQAGTIRKNGYIVIKGRACKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF  KKLEDIVPSSHN DVPHV RTDYQLIDISEDGFV+LLTESG TKDDLRLPTD
Sbjct  61   VGIDIFNAKKLEDIVPSSHNSDVPHVTRTDYQLIDISEDGFVTLLTESGGTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E+L +QIKDGF EGKDLVV+VMSAMGEEQICALK
Sbjct  121  ESLCSQIKDGFSEGKDLVVTVMSAMGEEQICALK  154



>gb|AAX92691.1| eukaryotic translation initiation factor 5A 2 [Picea abies]
Length=159

 Score =   283 bits (725),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD++HQFESK DAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTS+TGKHGHAKCHF
Sbjct  1    MSDDDHQFESKGDAGASKTFPQQAGTIRKNGYIVIKARPCKVVEVSTSETGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIF+GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTESG TKDDL+LPTD
Sbjct  61   VGIDIFSGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTESGQTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LL QIK GF EGKDLVV+VMSAMGEEQIC+LK
Sbjct  121  DQLLAQIKAGFDEGKDLVVTVMSAMGEEQICSLK  154



>ref|XP_010683085.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Beta 
vulgaris subsp. vulgaris]
Length=161

 Score =   283 bits (724),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEHQFESKAD+GASKT+PQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKC+F
Sbjct  1    MSDEEHQFESKADSGASKTFPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCNF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDI+ED FVSLLTE+G+TKDDL+LP+D
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDIAEDDFVSLLTETGDTKDDLKLPSD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LL Q+K+GF +GKDL+VSV SAMGEEQIC +K
Sbjct  121  EALLKQLKEGFADGKDLIVSVQSAMGEEQICGVK  154



>ref|XP_004958204.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Setaria 
italica]
Length=160

 Score =   283 bits (723),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEH FESKADAGASKTYPQQAGTIRKNG IVIK RPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHHFESKADAGASKTYPQQAGTIRKNGFIVIKGRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIF GKKLEDIVPSSHNCDVPHVNRT+YQLIDISEDGFVSLLT  GNTKDDLRLPT
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDVPHVNRTEYQLIDISEDGFVSLLTSDGNTKDDLRLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            DE LL QIK+GF  GKDLVV+V SAMGEEQICALK
Sbjct  121  DETLLGQIKEGFDGGKDLVVTVQSAMGEEQICALK  155



>gb|AAS20967.1| eukaryotic translation initiation factor 5A-4 [Hyacinthus orientalis]
Length=159

 Score =   282 bits (722),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDE      +ADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEGASLRVEADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTE+G TKDDLRLPTD
Sbjct  61   VAIDIFTAKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGGTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGF EGK+LVVSVMSAMGEEQI ALK
Sbjct  121  DSLLTQIKDGFAEGKELVVSVMSAMGEEQINALK  154



>gb|EEE59965.1| hypothetical protein OsJ_12660 [Oryza sativa Japonica Group]
Length=490

 Score =   293 bits (751),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 149/168 (89%), Gaps = 14/168 (8%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCK-------------VVEVS  232
            MSD EEH FESKADAGASKTYPQQAGTIRKNGHIVIKNRPCK             VVEVS
Sbjct  317  MSDSEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKWSGNHASLLVDTKVVEVS  376

Query  233  TSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT  412
            TSKTGKHGHAKCHFVAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT
Sbjct  377  TSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT  436

Query  413  ESGNTKDDLRLPTDENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ESG TKDDLRLP+DE LLTQIKDGF EGKDL+V+VMSAMGEEQICALK
Sbjct  437  ESGGTKDDLRLPSDEALLTQIKDGFAEGKDLIVTVMSAMGEEQICALK  484



>gb|AHX42566.1| translation initiation factor5A [Saccharum hybrid cultivar ROC22]
Length=160

 Score =   281 bits (719),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEH FESKADAGASKTYPQQAGT+RKNG +VIK RPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHHFESKADAGASKTYPQQAGTVRKNGFLVIKGRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIF GKKLEDIVPSSHNCD+PHVNRT+YQLIDISEDGFVSLLT  GNTKDDLRLPT
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDIPHVNRTEYQLIDISEDGFVSLLTSDGNTKDDLRLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            DE L+ QIK+GF  GKDLVV+V SAMGEEQICALK
Sbjct  121  DETLVAQIKEGFESGKDLVVTVQSAMGEEQICALK  155



>gb|EEC76213.1| hypothetical protein OsI_13610 [Oryza sativa Indica Group]
Length=517

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 149/168 (89%), Gaps = 14/168 (8%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCK-------------VVEVS  232
            MSD EEH FESKADAGASKTYPQQAGTIRKNGHIVIKNRPCK             VVEVS
Sbjct  344  MSDSEEHHFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKWSGNHASLLVDTKVVEVS  403

Query  233  TSKTGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT  412
            TSKTGKHGHAKCHFVAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT
Sbjct  404  TSKTGKHGHAKCHFVAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT  463

Query  413  ESGNTKDDLRLPTDENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ESG TKDDLRLP+DE LLTQIKDGF EGKDL+V+VMSAMGEEQICALK
Sbjct  464  ESGGTKDDLRLPSDEALLTQIKDGFAEGKDLIVTVMSAMGEEQICALK  511



>ref|XP_006391021.1| hypothetical protein EUTSA_v10019263mg [Eutrema salsugineum]
 gb|ESQ28307.1| hypothetical protein EUTSA_v10019263mg [Eutrema salsugineum]
Length=158

 Score =   280 bits (717),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FES +DAGASKTYPQQAG IRK G+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFES-SDAGASKTYPQQAGNIRKGGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++G+TKDDL+LPTD
Sbjct  60   VAIDIFTSKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGSTKDDLKLPTD  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQ+K GF EGKD+VVSVMSAMGEEQ+CALK
Sbjct  120  EALLTQLKAGFEEGKDIVVSVMSAMGEEQMCALK  153



>ref|XP_004955320.1| PREDICTED: eukaryotic translation initiation factor 5A-like [Setaria 
italica]
Length=162

 Score =   280 bits (716),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEH FESKADAGASKTYPQQAGTIRKNG IVIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHHFESKADAGASKTYPQQAGTIRKNGFIVIKNRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FV IDIF GKKLEDIVPSSHNCDVPHVNRT+YQLIDISEDG+VSLLTESGNTKDDL+LPT
Sbjct  61   FVGIDIFNGKKLEDIVPSSHNCDVPHVNRTEYQLIDISEDGYVSLLTESGNTKDDLKLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            DE L  QI+ G+ EGKD++++V SAMGEEQIC+LK
Sbjct  121  DEALQAQIRSGYDEGKDIILTVQSAMGEEQICSLK  155



>ref|XP_002887234.1| hypothetical protein ARALYDRAFT_894722 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63493.1| hypothetical protein ARALYDRAFT_894722 [Arabidopsis lyrata subsp. 
lyrata]
Length=158

 Score =   279 bits (714),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD+EH FES +DAGASKTYPQQAG IRK GHIVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDEHHFES-SDAGASKTYPQQAGNIRKGGHIVIKGRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLT++G+TKDDL+LPTD
Sbjct  60   VAIDIFTSKKLEDIVPSSHNCDVPHVNRVDYQLIDISEDGFVSLLTDNGSTKDDLKLPTD  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQ+K+GF EGKD+VVSVMSAMGEEQ+CALK
Sbjct  120  EALLTQLKNGFDEGKDIVVSVMSAMGEEQMCALK  153



>ref|XP_003557675.1| PREDICTED: eukaryotic translation initiation factor 5A-1/2 [Brachypodium 
distachyon]
Length=161

 Score =   279 bits (714),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 146/155 (94%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD EEH FESKAD+GASKTYPQQAGTIRK+GHIVIK RPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEEHHFESKADSGASKTYPQQAGTIRKSGHIVIKGRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIF GKKLEDIVPSSHNCD+PHV+R DYQLIDI++DGFVSLLTE+G TKDDL+LPT
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDIPHVDRQDYQLIDITDDGFVSLLTENGGTKDDLKLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            D+ LLTQIKDGF  GKDL++SVMSAMGEEQICA+K
Sbjct  121  DDALLTQIKDGFDAGKDLILSVMSAMGEEQICAVK  155



>ref|NP_172848.1| translation initiation factor eIF-5A [Arabidopsis thaliana]
 sp|Q9XI91.1|IF5A1_ARATH RecName: Full=Eukaryotic translation initiation factor 5A-1; 
Short=AtELF5A-1; Short=eIF-5A-1 [Arabidopsis thaliana]
 gb|AAD39281.1|AC007576_4 initiation factor 5A-4 [Arabidopsis thaliana]
 gb|AAG53646.1|AF296082_1 eukaryotic translation initiation factor 5A [Arabidopsis thaliana]
 gb|AAL36087.1| putative initiation factor 5A-4 [Arabidopsis thaliana]
 gb|AAM51347.1| putative initiation factor 5A-4 [Arabidopsis thaliana]
 gb|AEE29088.1| translation initiation factor eIF-5A [Arabidopsis thaliana]
Length=158

 Score =   279 bits (714),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FES +DAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFES-SDAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDG+VSLLT++G+TKDDL+LP D
Sbjct  60   VAIDIFTSKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGYVSLLTDNGSTKDDLKLPND  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LL QIK GF +GKDLVVSVMSAMGEEQI ALK
Sbjct  120  DTLLQQIKSGFDDGKDLVVSVMSAMGEEQINALK  153



>ref|XP_003610324.1| Eukaryotic translation initiation factor 5A-1 [Medicago truncatula]
Length=676

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FE  ADAGASKTYPQQAGTIRKNG+IVIK+RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFEPAADAGASKTYPQQAGTIRKNGYIVIKSRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLT++G+TKDDL+LPTD
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTDNGSTKDDLKLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            ++LLTQIKDGF +GKDLVVSVMSAMGEEQICALK
Sbjct  121  DSLLTQIKDGFADGKDLVVSVMSAMGEEQICALK  154


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 68/128 (53%), Gaps = 48/128 (38%)
 Frame = +2

Query  146  KTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDIVPS  325
            KTYP QAG IR+NG+IVI++RP                                      
Sbjct  334  KTYPLQAGNIRRNGYIVIESRP--------------------------------------  355

Query  326  SHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTDENLLTQIKDGFGEGKDL  505
               C VPHVNR D +LIDISEDG VSLLT++G+TKD L       +L  IK+ F EGKDL
Sbjct  356  ---CKVPHVNRADDRLIDISEDGSVSLLTDNGSTKDTL-------VLGFIKEEFAEGKDL  405

Query  506  VVSVMSAM  529
            +V V+SAM
Sbjct  406  MVGVVSAM  413



>ref|XP_010068784.1| PREDICTED: mitotic checkpoint protein BUB3.3-like [Eucalyptus 
grandis]
Length=589

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  89   GAMSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKC  268
             AMSDEEH FESKADAGASKTYPQQAGTIRKNG+IVIKNRPCKVVEVSTSKTGKHGHAKC
Sbjct  429  AAMSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVVEVSTSKTGKHGHAKC  488

Query  269  HFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLP  448
            HFV IDIF GKKLEDIVPSSHNCDVPHV RTDYQLIDISEDGF+SLLTE+G+TKDDLRLP
Sbjct  489  HFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFLSLLTENGSTKDDLRLP  548

Query  449  TDENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            TD+ LL QIKDGF EGKDLVV+ M +MGEEQICALK
Sbjct  549  TDDALLGQIKDGFAEGKDLVVTAMCSMGEEQICALK  584



>ref|NP_177100.1| eukaryotic translation initiation factor 5A-3 [Arabidopsis thaliana]
 ref|XP_010511968.1| PREDICTED: eukaryotic translation initiation factor 5A-3 [Camelina 
sativa]
 ref|XP_010415588.1| PREDICTED: eukaryotic translation initiation factor 5A-3 [Camelina 
sativa]
 ref|XP_010470927.1| PREDICTED: eukaryotic translation initiation factor 5A-3 [Camelina 
sativa]
 sp|Q9C505.1|IF5A3_ARATH RecName: Full=Eukaryotic translation initiation factor 5A-3; 
Short=AtELF5A-3; Short=eIF-5A-3 [Arabidopsis thaliana]
 gb|AAG52496.1|AC018364_14 putative eukaryotic initiation factor 5A (eIF-5A); 7607-6714 
[Arabidopsis thaliana]
 gb|AAG60110.1|AC073178_21 Eukaryotic initiation factor 5A , putative [Arabidopsis thaliana]
 gb|AAM64601.1| initiation factor 5A-3 (eIF-5A 3) [Arabidopsis thaliana]
 gb|AEE34921.1| translation initiation factor eIF-5A [Arabidopsis thaliana]
Length=158

 Score =   279 bits (714),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD+EH FES +DAGASKTYPQQAG IRK GHIVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDEHHFES-SDAGASKTYPQQAGNIRKGGHIVIKGRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLT++G+TKDDL+LPTD
Sbjct  60   VAIDIFTSKKLEDIVPSSHNCDVPHVNRVDYQLIDISEDGFVSLLTDNGSTKDDLKLPTD  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQ+K+GF EGKD+VVSVMSAMGEEQ+CALK
Sbjct  120  EALLTQLKNGFEEGKDIVVSVMSAMGEEQMCALK  153



>emb|CDY71729.1| BnaCnng74170D [Brassica napus]
Length=158

 Score =   279 bits (713),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FES +DAGASKTYPQQAG IRK G+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFES-SDAGASKTYPQQAGNIRKGGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLT++G+TKDDL+LPTD
Sbjct  60   VAIDIFTSKKLEDIVPSSHNCDVPHVNRVDYQLIDISEDGFVSLLTDNGSTKDDLKLPTD  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQ+K GF EGKD+VVSVMSAMGEEQ+CALK
Sbjct  120  EALLTQLKSGFEEGKDIVVSVMSAMGEEQMCALK  153



>emb|CDY40919.1| BnaC06g30570D [Brassica napus]
 emb|CDX95937.1| BnaA07g27940D [Brassica napus]
Length=158

 Score =   279 bits (713),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FES +DAGASKTYPQQAG IRK G+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFES-SDAGASKTYPQQAGNIRKGGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLT++G+TKDDL+LPTD
Sbjct  60   VAIDIFTSKKLEDIVPSSHNCDVPHVNRVDYQLIDISEDGFVSLLTDNGSTKDDLKLPTD  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQ+K GF EGKD+VVSVMSAMGEEQ+CALK
Sbjct  120  EALLTQLKSGFEEGKDIVVSVMSAMGEEQMCALK  153



>ref|XP_002890031.1| eukaryotic translation initiation factor 5A-1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66290.1| eukaryotic translation initiation factor 5A-1 [Arabidopsis lyrata 
subsp. lyrata]
Length=158

 Score =   278 bits (712),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FES +DAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFES-SDAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDG+VSLLT++G+TKDDL+LPTD
Sbjct  60   VAIDIFTSKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGYVSLLTDNGSTKDDLKLPTD  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LL QIK GF +GKDLVVSVMSAMGEEQI ALK
Sbjct  120  DTLLQQIKSGFDDGKDLVVSVMSAMGEEQINALK  153



>ref|XP_009105486.1| PREDICTED: eukaryotic translation initiation factor 5A-3 [Brassica 
rapa]
Length=158

 Score =   278 bits (712),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FES +DAGASKTYPQQAG IRK G+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFES-SDAGASKTYPQQAGNIRKGGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLT++G+TKDDL+LPTD
Sbjct  60   VAIDIFTSKKLEDIVPSSHNCDVPHVNRVDYQLIDISEDGFVSLLTDNGSTKDDLKLPTD  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQ+K GF EGKD+VVSVMSAMGEEQ+CALK
Sbjct  120  EVLLTQLKSGFEEGKDIVVSVMSAMGEEQMCALK  153



>ref|XP_006302945.1| hypothetical protein CARUB_v10021084mg [Capsella rubella]
 gb|EOA35843.1| hypothetical protein CARUB_v10021084mg [Capsella rubella]
Length=158

 Score =   278 bits (711),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD+EH FES +DAGASKTYPQQAG IRK GHIVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDEHHFES-SDAGASKTYPQQAGNIRKGGHIVIKGRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VA+DIFT KKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLT++G+TKDDL+LPTD
Sbjct  60   VALDIFTSKKLEDIVPSSHNCDVPHVNRVDYQLIDISEDGFVSLLTDNGSTKDDLKLPTD  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQ+K+GF EGKD+VVSVMSAMGEEQ+CALK
Sbjct  120  EALLTQLKNGFEEGKDIVVSVMSAMGEEQMCALK  153



>sp|Q9AXQ7.1|IF5A_DIACA RecName: Full=Eukaryotic translation initiation factor 5A; Short=eIF-5A 
[Dianthus caryophyllus]
 gb|AAG53645.1|AF296081_1 eukaryotic translation initiation factor 5A [Dianthus caryophyllus]
Length=160

 Score =   278 bits (711),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD++H FES ADAGASKTYPQQAGTIRK+GHIVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDDHHFESSADAGASKTYPQQAGTIRKSGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHVNR DYQL+DI+EDGFVSLLT+SG+TKDDL+LP D
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVNRVDYQLLDITEDGFVSLLTDSGDTKDDLKLPAD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E L+ Q+K+GF  GKDL++SVM AMGEEQICA+K
Sbjct  121  EALVKQMKEGFEAGKDLILSVMCAMGEEQICAVK  154



>ref|XP_006417074.1| hypothetical protein EUTSA_v10008978mg [Eutrema salsugineum]
 gb|ESQ35427.1| hypothetical protein EUTSA_v10008978mg [Eutrema salsugineum]
Length=158

 Score =   278 bits (710),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FES +DAGASKTYPQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFES-SDAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNRTDYQLIDISEDG+VSLLT++G+TKDDL+LPTD
Sbjct  60   VAIDIFTSKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGYVSLLTDNGSTKDDLKLPTD  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + LL QIK GF +GKDLVVSVMSAMGEEQI ALK
Sbjct  120  DALLQQIKSGFEDGKDLVVSVMSAMGEEQINALK  153



>gb|AAK50073.1|AF372933_1 At1g69410/F10D13.8 [Arabidopsis thaliana]
 gb|AAL31161.1| At1g69410/F10D13.8 [Arabidopsis thaliana]
Length=158

 Score =   277 bits (709),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSD+EH FES +DAGASKTYPQQAG IRK GHIVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDDEHHFES-SDAGASKTYPQQAGNIRKGGHIVIKGRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLT++G+TKDDL+LPTD
Sbjct  60   VAIDIFTSKKLEDIVPSSHNCDVPHVNRVDYQLIDISEDGFVSLLTDNGSTKDDLKLPTD  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            E LLTQ+K+GF EGKD+VVSVMSA+GEEQ+CALK
Sbjct  120  EALLTQLKNGFEEGKDIVVSVMSAIGEEQMCALK  153



>emb|CAA45103.1| eukaryotic initiation factor 5A (1) [Nicotiana plumbaginifolia]
Length=145

 Score =   276 bits (707),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +2

Query  137  GASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDI  316
            GASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDI
Sbjct  1    GASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTGKKLEDI  60

Query  317  VPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTDENLLTQIKDGFGEG  496
            VPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTD+NLL  IKDGF EG
Sbjct  61   VPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDNLLALIKDGFAEG  120

Query  497  KDLVVSVMSAMGEEQICALK  556
            KDLV+SVMSAMGEEQIC +K
Sbjct  121  KDLVLSVMSAMGEEQICGIK  140



>gb|AAX92694.1| eukaryotic translation initiation factor 5A 2 [Picea abies]
Length=160

 Score =   277 bits (708),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDE++ FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEDNHFESKADAGASKTFPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHV RTD+QLIDISEDGF SLL ++GNTKDDLR P+D
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVTRTDFQLIDISEDGFGSLLADNGNTKDDLRPPSD  120

Query  455  ENLLTQIKDGF-GEGKDLVVSVMSAMGEEQICALK  556
            E LLTQIKDGF  EGKDLVV+VMSAMGEEQICALK
Sbjct  121  EQLLTQIKDGFLEEGKDLVVTVMSAMGEEQICALK  155



>ref|XP_002964180.1| hypothetical protein SELMODRAFT_142541 [Selaginella moellendorffii]
 gb|EFJ34513.1| hypothetical protein SELMODRAFT_142541 [Selaginella moellendorffii]
Length=159

 Score =   276 bits (707),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH F++KADAGASKTYPQQAGTIRKN +IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFDNKADAGASKTYPQQAGTIRKNAYIVIKQRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVP V RTDYQLIDISEDGFVSLLTE+G+TKDDLRLPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPEVTRTDYQLIDISEDGFVSLLTENGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + L  QI  GF +GKDLVV+VMSA+GEEQICALK
Sbjct  121  DQLNAQISSGFHDGKDLVVTVMSALGEEQICALK  154



>gb|AAX92690.1| eukaryotic translation initiation factor 5A [Picea abies]
Length=149

 Score =   276 bits (706),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDE++ FESKADAGASKT+PQQAGTIRKNG+IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEDNHFESKADAGASKTFPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIF GKKLEDIVPSSHNCDVPHV RTD+QLIDISEDGFVSLL ++GNT  DLRLP+D
Sbjct  61   VAIDIFNGKKLEDIVPSSHNCDVPHVTRTDFQLIDISEDGFVSLLADNGNTXXDLRLPSD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQ  541
            E LLTQIKDGFGEGKDLVV+VMSAMGEEQ
Sbjct  121  EQLLTQIKDGFGEGKDLVVTVMSAMGEEQ  149



>ref|XP_002988883.1| hypothetical protein SELMODRAFT_184164 [Selaginella moellendorffii]
 gb|EFJ10145.1| hypothetical protein SELMODRAFT_184164 [Selaginella moellendorffii]
Length=159

 Score =   276 bits (707),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH F++KADAGASKTYPQQAGTIRKN +IVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFDNKADAGASKTYPQQAGTIRKNAYIVIKQRPCKVVEVSTSKTGKHGHAKCHF  60

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            V IDIFTGKKLEDIVPSSHNCDVP V RTDYQLIDISEDGFVSLLTE+G+TKDDLRLPTD
Sbjct  61   VGIDIFTGKKLEDIVPSSHNCDVPEVTRTDYQLIDISEDGFVSLLTENGDTKDDLRLPTD  120

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + L  QI  GF +GKDLVV+VMSA+GEEQICALK
Sbjct  121  DQLNAQISTGFHDGKDLVVTVMSALGEEQICALK  154



>gb|AAZ95171.1| eukaryotic translation initiation factor 5A1 [Triticum aestivum]
 gb|ABB29983.1| translation initiation factor 5A [Dasypyrum hordeaceum]
 gb|ABB29984.1| translation initiation factor 5A [Secale cereale]
 gb|ABB29986.1| translation initiation factor 5A [Aegilops tauschii]
Length=161

 Score =   275 bits (702),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD +EH FESKAD+GASKTYPQQAG IRK GHIVIK RPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDTDEHHFESKADSGASKTYPQQAGAIRKGGHIVIKARPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIF GKKLEDIVPSSHNCDVPHV+R DYQLIDI++DG+VSLLTESGNTKDDL+LPT
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDVPHVDRQDYQLIDITDDGYVSLLTESGNTKDDLKLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            D+ LL QIK GF +GKDL++SVMSAMGEEQICA+K
Sbjct  121  DDVLLGQIKTGFADGKDLILSVMSAMGEEQICAVK  155



>gb|EMT06932.1| Eukaryotic translation initiation factor 5A [Aegilops tauschii]
Length=238

 Score =   277 bits (709),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 146/156 (94%), Gaps = 1/156 (1%)
 Frame = +2

Query  92   AMSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKC  268
            AMSD E+H FESKADAGASKTYP QAG IRK G +VIKNRPCKVVEVSTSKTGKHGHAKC
Sbjct  63   AMSDSEDHHFESKADAGASKTYPMQAGAIRKGGFLVIKNRPCKVVEVSTSKTGKHGHAKC  122

Query  269  HFVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLP  448
            HFVA+DIF GKKLEDIVPSSHNCDVPHV+RT+YQLIDISEDGFVSLLT++G+TKDDL+LP
Sbjct  123  HFVALDIFNGKKLEDIVPSSHNCDVPHVDRTEYQLIDISEDGFVSLLTDNGSTKDDLKLP  182

Query  449  TDENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            TD+ +LTQ+KDGF EGKDL ++VMSAMGEEQICA+K
Sbjct  183  TDDAILTQLKDGFAEGKDLALTVMSAMGEEQICAVK  218



>ref|XP_006415941.1| hypothetical protein EUTSA_v10008974mg [Eutrema salsugineum]
 gb|ESQ34294.1| hypothetical protein EUTSA_v10008974mg [Eutrema salsugineum]
Length=159

 Score =   274 bits (700),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FES +DAGASKTYPQQAG IRK GHIVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFES-SDAGASKTYPQQAGNIRKGGHIVIKGRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLT+SG TKDDL+LPTD
Sbjct  60   VAIDIFTAKKLEDIVPSSHNCDVPHVNRVDYQLIDISEDGFVSLLTDSGGTKDDLKLPTD  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NL   +K GF EGKD+VVSVMS+MGEEQICA+K
Sbjct  120  DNLAALMKSGFEEGKDVVVSVMSSMGEEQICAVK  153



>gb|EMS47402.1| Eukaryotic translation initiation factor 5A-2 [Triticum urartu]
Length=160

 Score =   274 bits (700),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD E+H FESKADAGASKTYP QAG IRK G +VIKNRPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDSEDHHFESKADAGASKTYPMQAGAIRKGGFLVIKNRPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVA+DIF GKKLEDIVPSSHNCDVPHV+RT+YQLIDISEDGFVSLLT++G+TKDDL+LPT
Sbjct  61   FVALDIFNGKKLEDIVPSSHNCDVPHVDRTEYQLIDISEDGFVSLLTDNGSTKDDLKLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            D+ +LTQ+KDGF EGKDL ++VMSAMGEEQICA+K
Sbjct  121  DDAILTQLKDGFAEGKDLALTVMSAMGEEQICAVK  155



>emb|CDY24141.1| BnaC03g57360D [Brassica napus]
 emb|CDX85035.1| BnaC05g20200D [Brassica napus]
Length=159

 Score =   274 bits (700),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FES +DAGASKTYPQQAG IRK GHIVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFES-SDAGASKTYPQQAGNIRKGGHIVIKGRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLT+SG TKDDL+LPTD
Sbjct  60   VAIDIFTAKKLEDIVPSSHNCDVPHVNRVDYQLIDISEDGFVSLLTDSGGTKDDLKLPTD  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NL   +K GF EGKD+VVSVMS+MGEEQICA+K
Sbjct  120  DNLSALMKSGFEEGKDVVVSVMSSMGEEQICAVK  153



>gb|ABB29987.1| translation initiation factor 5A [Secale sylvestre]
Length=161

 Score =   274 bits (700),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD +EH FESKAD+GASKTYPQQAG IRK GHIVIK RPCKVVEVSTSKTG+HGHAKCH
Sbjct  1    MSDTDEHHFESKADSGASKTYPQQAGAIRKGGHIVIKARPCKVVEVSTSKTGRHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIF GKKLEDIVPSSHNCDVPHV+R DYQLIDI++DG+VSLLTESGNTKDDL+LPT
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDVPHVDRQDYQLIDITDDGYVSLLTESGNTKDDLKLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            D+ LL QIK GF +GKDL++SVMSAMGEEQICA+K
Sbjct  121  DDVLLGQIKTGFADGKDLILSVMSAMGEEQICAVK  155



>ref|XP_009110029.1| PREDICTED: eukaryotic translation initiation factor 5A-2 [Brassica 
rapa]
 emb|CDY61621.1| BnaA08g19830D [Brassica napus]
Length=159

 Score =   273 bits (699),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FES +DAGASKTYPQQAG IRK GHIVIK RPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFES-SDAGASKTYPQQAGNIRKGGHIVIKGRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNR DYQLIDISEDGFVSLLT+SG TKDDL+LPTD
Sbjct  60   VAIDIFTAKKLEDIVPSSHNCDVPHVNRIDYQLIDISEDGFVSLLTDSGGTKDDLKLPTD  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            +NL   +K GF EGKD+VVSVMS+MGEEQICA+K
Sbjct  120  DNLSALMKSGFEEGKDVVVSVMSSMGEEQICAVK  153



>ref|XP_002893391.1| hypothetical protein ARALYDRAFT_472745 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69650.1| hypothetical protein ARALYDRAFT_472745 [Arabidopsis lyrata subsp. 
lyrata]
Length=159

 Score =   272 bits (696),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = +2

Query  95   MSDEEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  274
            MSDEEH FES +++GASKTYPQQAG IRK GHIVIKNRPCKVVEVSTSKTGKHGHAKCHF
Sbjct  1    MSDEEHHFES-SESGASKTYPQQAGNIRKGGHIVIKNRPCKVVEVSTSKTGKHGHAKCHF  59

Query  275  VAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTD  454
            VAIDIFT KKLEDIVPSSHNCDVPHVNR DYQLIDI+EDGFVSLLT+SG TKDDL+LPTD
Sbjct  60   VAIDIFTAKKLEDIVPSSHNCDVPHVNRVDYQLIDITEDGFVSLLTDSGGTKDDLKLPTD  119

Query  455  ENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            + L  Q++ GF EGKD+VVSVMS+MGEEQICA+K
Sbjct  120  DALTAQMRSGFDEGKDVVVSVMSSMGEEQICAVK  153



>ref|XP_004962923.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 5A-2-like [Setaria italica]
Length=162

 Score =   272 bits (695),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 145/156 (93%), Gaps = 2/156 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD E+HQF+SKADAGASKTYPQQAGT+RKNG++VIKNRPCKVVEVSTSKTGKHGH KCH
Sbjct  1    MSDSEDHQFDSKADAGASKTYPQQAGTVRKNGYLVIKNRPCKVVEVSTSKTGKHGHXKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTE-SGNTKDDLRLP  448
            FVA DIF GKKLEDIVPS HNCDVPHVN T+YQLIDISEDGFVS  ++ +GN KDDLRLP
Sbjct  61   FVASDIFNGKKLEDIVPSLHNCDVPHVNCTEYQLIDISEDGFVSESSDXNGNAKDDLRLP  120

Query  449  TDENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            TD+NLL+QIKDGFGEGKDLVV+VMS MGEEQICALK
Sbjct  121  TDDNLLSQIKDGFGEGKDLVVTVMSVMGEEQICALK  156



>gb|AAZ95173.1| eukaryotic translation initiation factor 5A3 [Triticum aestivum]
Length=161

 Score =   272 bits (695),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD +E  FESKAD+GASKTYPQQAG IRK GHIVIK RPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDTDERHFESKADSGASKTYPQQAGAIRKGGHIVIKARPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIF GKKLEDIVPSSHNCDVPHV+R DYQLIDI++DG+VSLLTESGNTKDDL+LPT
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDVPHVDRQDYQLIDITDDGYVSLLTESGNTKDDLKLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            D+ LL QIK GF +GKDL++SVMSAMGEEQICA+K
Sbjct  121  DDVLLGQIKTGFADGKDLILSVMSAMGEEQICAVK  155



>gb|AAZ95172.1| eukaryotic translation initiation factor 5A2 [Triticum aestivum]
Length=161

 Score =   272 bits (695),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = +2

Query  95   MSD-EEHQFESKADAGASKTYPQQAGTIRKNGHIVIKNRPCKVVEVSTSKTGKHGHAKCH  271
            MSD +EH FESKAD+GASKTYPQQAG IRK GHIVIK RPCKVVEVSTSKTGKHGHAKCH
Sbjct  1    MSDTDEHHFESKADSGASKTYPQQAGAIRKGGHIVIKARPCKVVEVSTSKTGKHGHAKCH  60

Query  272  FVAIDIFTGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPT  451
            FVAIDIF GKKLEDIVPSSHNCDVPHV+R DYQLIDI++DG+VSLLTESGN KDDL+LPT
Sbjct  61   FVAIDIFNGKKLEDIVPSSHNCDVPHVDRQDYQLIDITDDGYVSLLTESGNPKDDLKLPT  120

Query  452  DENLLTQIKDGFGEGKDLVVSVMSAMGEEQICALK  556
            D+ LL QIK GF +GKDL++SVMSAMGEEQICA+K
Sbjct  121  DDVLLGQIKTGFADGKDLILSVMSAMGEEQICAVK  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800